PSIBLAST alignment of GI: 254780998 and protein with PDB id: 1mzg

>gi|28373819|pdb|1MZG|A Chain A, X-Ray Structure Of Sufe From E.Coli Northeast Structural Genomics (Nesg) Consortium Target Er30 Length = 146
>gi|28373820|pdb|1MZG|B Chain B, X-Ray Structure Of Sufe From E.Coli Northeast Structural Genomics (Nesg) Consortium Target Er30 Length = 146
 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 60/120 (50%), Gaps = 4/120 (3%)

Query: 5   NDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQ 64
             ++ +     +  ++Y Y+IELG++LP    E  + QN + GC S++W+V     + + 
Sbjct: 8   EKLLRNFLRCANWEEKYLYIIELGQRLPELRDEDRSPQNSIQGCQSQVWIV----XRQNA 63

Query: 65  DPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGL 124
             I+     SD+ IV GL+ +V  +Y      +I+  D     +   LT++L+  R  GL
Sbjct: 64  QGIIELQGDSDAAIVKGLIAVVFILYDQXTPQDIVNFDVRPWFEKXALTQHLTPSRSQGL 123