RPSBLAST alignment for GI: 254780998 and conserved domain: PRK09296

>gnl|CDD|181767 PRK09296, PRK09296, cysteine desufuration protein SufE; Provisional. Length = 138
 Score = 81.2 bits (201), Expect = 8e-17
 Identities = 36/113 (31%), Positives = 62/113 (54%), Gaps = 4/113 (3%)

Query: 19  DRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQI 78
           ++Y Y+IELG++LP    E  + QN++ GC S++W+V+    +G    I+     SD+ I
Sbjct: 22  EKYLYIIELGQRLPPLTDEDRSPQNLIQGCQSQVWIVMRQNAQG----IIELQGDSDAAI 77

Query: 79  VCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKI 131
           V GL+ +V  +Y      +I+  D     + L LT++L+  R  GL  ++  I
Sbjct: 78  VKGLIAVVFILYQQMTPQDIVNFDVRPWFEKLALTQHLTPSRSQGLEAMIRAI 130