RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780998|ref|YP_003065411.1| hypothetical protein CLIBASIA_04495 [Candidatus Liberibacter asiaticus str. psy62] (146 letters) >gnl|CDD|32349 COG2166, COG2166, SufE protein probably involved in Fe-S center assembly [General function prediction only]. Length = 144 Score = 116 bits (292), Expect = 2e-27 Identities = 53/138 (38%), Positives = 81/138 (58%), Gaps = 4/138 (2%) Query: 2 IPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENK 61 + I+ED + + DRY YLIELGK+LP P+E ++N V GC S++W+V E + Sbjct: 10 KTLEKIVEDFAELTNWEDRYRYLIELGKQLPPLPEELRAEENPVPGCQSQVWLVTEQND- 68 Query: 62 GDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRM 121 D + F+ SD++IV GLL I+ + Y+ K +EIL D L + LGL ++LS R Sbjct: 69 ---DGTLHFFGDSDARIVRGLLAILLAAYSGKTAAEILAFDPLDFFEELGLAQHLSPSRS 125 Query: 122 NGLYTIVNKIQDLTQEYL 139 NGL ++ +I+ + L Sbjct: 126 NGLEAMLKRIKRKAAQAL 143 >gnl|CDD|111544 pfam02657, SufE, Fe-S metabolism associated domain. This family consists of the SufE-related proteins. These have been implicated in Fe-S metabolism and export). Length = 125 Score = 85.9 bits (213), Expect = 4e-18 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 5/129 (3%) Query: 7 IIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDP 66 ++E + + D+Y L+ELGK+LP P E + N V GC S+LW+ + G Sbjct: 1 VVELFAEVTNWEDKYRQLLELGKELPALPDELLAQANEVQGCQSQLWLHYDVSEDG---- 56 Query: 67 IMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYT 126 I+ F+ S+++IV GL ++ + Y K +EIL D + LGL ++LS R+NGL Sbjct: 57 IVHFFGDSEARIVRGLAALLFAGYDGKTPAEILTFDPDFF-EELGLAQHLSPSRLNGLEA 115 Query: 127 IVNKIQDLT 135 + +I+ Sbjct: 116 LFARIKRKA 124 >gnl|CDD|38823 KOG3617, KOG3617, KOG3617, WD40 and TPR repeat-containing protein [General function prediction only]. Length = 1416 Score = 30.8 bits (69), Expect = 0.14 Identities = 14/52 (26%), Positives = 22/52 (42%) Query: 7 IIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEW 58 +IED ++ Y L EL KK+P + + V +L M +E Sbjct: 1336 LIEDHVSRKNYKPAYRALTELQKKVPNVDLSTFVETSTVDKVCDELEMRLER 1387 >gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory domain. There are four cPKC isoforms, named alpha, betaI, betaII, and gamma. cPKCs are potent kinases for histones, myelin basic protein, and protamine. PKC-gamma is mainly expressed in neuronal tissues. It plays a role in protection from ischemia. Length = 324 Score = 28.2 bits (63), Expect = 0.93 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 22/69 (31%) Query: 49 MSKLWMVIEWENKGD-----------QDPIMIFYAVSDSQIVCGLLYIVKSIYAHKK--I 95 M +L+ V+E+ N GD ++P +FYA ++I GL ++ H K I Sbjct: 73 MDRLYFVMEYVNGGDLMYHIQQVGKFKEPHAVFYA---AEIAIGLFFL------HSKGII 123 Query: 96 SEILKMDSL 104 LK+D++ Sbjct: 124 YRDLKLDNV 132 >gnl|CDD|36311 KOG1095, KOG1095, KOG1095, Protein tyrosine kinase [Signal transduction mechanisms]. Length = 1025 Score = 26.5 bits (58), Expect = 2.8 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 6/56 (10%) Query: 8 IEDMEMIEDLHDRYHYLIELGKKLPL--FPKEYMTDQNIVAGCMSKLWM--VIEWE 59 I D + D++D+ +Y LP+ P E + D + S +W V+ WE Sbjct: 843 IADFGLARDIYDKDYYRKHGEAMLPVKWMPPESLKDG--IFTSKSDVWSFGVLLWE 896 >gnl|CDD|73286 cd01907, GlxB, Glutamine amidotransferases class-II (Gn-AT)_GlxB-type. GlxB is a glutamine amidotransferase-like protein of unknown function found in bacteria and archaea. GlxB has a structural fold similar to that of other class II glutamine amidotransferases including glucosamine-fructose 6-phosphate synthase (GLMS or GFAT), glutamine phosphoribosylpyrophosphate (Prpp) amidotransferase (GPATase), asparagine synthetase B (AsnB), beta lactam synthetase (beta-LS) and glutamate synthase (GltS). The GlxB fold is also somewhat similar to the Ntn (N-terminal nucleophile) hydrolase fold of the proteasomal alpha and beta subunits.. Length = 249 Score = 26.3 bits (58), Expect = 3.1 Identities = 10/57 (17%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Query: 74 SDSQIVCGLLYIV--KSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIV 128 +D++++ L ++ K + I++M L L ++G +TI+ Sbjct: 134 TDTEVIAYYLDLLLRKGGLPLEYYKHIIRMPEEERELLLALRLTYRLADLDGPFTII 190 >gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only require PS. PKCs phosphorylate and modify the activities of a wide variety of cellular proteins including receptors, enzymes, cytoskeletal proteins, transcription factors, and other kinases. They play a central role in signal transduction pathways that regulate cell migration and polarity, proliferation, differentiation, and apoptosis. Also included in this subfamily are the PKC-like proteins, called PKNs. Length = 318 Score = 25.4 bits (56), Expect = 5.5 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 18/67 (26%) Query: 49 MSKLWMVIEWENKGD-----------QDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISE 97 +L+ V+E+ N GD +P FYA +IV GL + ++ I Sbjct: 68 KDRLFFVMEYVNGGDLMFHIQRSGRFDEPRARFYAA---EIVLGLQF----LHERGIIYR 120 Query: 98 ILKMDSL 104 LK+D++ Sbjct: 121 DLKLDNV 127 >gnl|CDD|35292 KOG0069, KOG0069, KOG0069, Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion]. Length = 336 Score = 24.6 bits (53), Expect = 10.0 Identities = 7/25 (28%), Positives = 16/25 (64%) Query: 97 EILKMDSLTILQHLGLTENLSQKRM 121 +L +D++ IL H+G ++++M Sbjct: 289 PLLTLDNVVILPHIGSATLETREKM 313 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.139 0.409 Gapped Lambda K H 0.267 0.0764 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,781,623 Number of extensions: 86672 Number of successful extensions: 199 Number of sequences better than 10.0: 1 Number of HSP's gapped: 195 Number of HSP's successfully gapped: 16 Length of query: 146 Length of database: 6,263,737 Length adjustment: 85 Effective length of query: 61 Effective length of database: 4,426,972 Effective search space: 270045292 Effective search space used: 270045292 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (24.1 bits)