RPSBLAST alignment of GI: 254780998 and MMDB domain: 1ni7_A_1-45_86-155

>1ni7_A (A:1-45,A:86-155) ER75, hypothetical protein YGDK; RD-structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Escherichia coli}Length = 115
 Score = 76.3 bits (188), Expect = 2e-15
 Identities = 29/136 (21%), Positives = 43/136 (31%), Gaps = 44/136 (32%)

Query: 7   IIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWENKGDQDP 66
           +      +    D+Y  LI LGK+LP                                  
Sbjct: 20  LRNTFAPLTQWEDKYRQLIMLGKQLP---------------------------------- 45

Query: 67  IMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYT 126
                     +IV GLL ++ +    K  +E+     L +   LGL   LS  R  GL  
Sbjct: 46  ----------RIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNA 95

Query: 127 IVNKIQDLTQEYLNVH 142
           +   I   T++ L  H
Sbjct: 96  LSEAIIAATKQVLEHH 111