BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780998|ref|YP_003065411.1| hypothetical protein CLIBASIA_04495 [Candidatus Liberibacter asiaticus str. psy62] (146 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780998|ref|YP_003065411.1| hypothetical protein CLIBASIA_04495 [Candidatus Liberibacter asiaticus str. psy62] Length = 146 Score = 298 bits (763), Expect = 3e-83, Method: Compositional matrix adjust. Identities = 146/146 (100%), Positives = 146/146 (100%) Query: 1 MIPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWEN 60 MIPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWEN Sbjct: 1 MIPINDIIEDMEMIEDLHDRYHYLIELGKKLPLFPKEYMTDQNIVAGCMSKLWMVIEWEN 60 Query: 61 KGDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKR 120 KGDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKR Sbjct: 61 KGDQDPIMIFYAVSDSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKR 120 Query: 121 MNGLYTIVNKIQDLTQEYLNVHIKER 146 MNGLYTIVNKIQDLTQEYLNVHIKER Sbjct: 121 MNGLYTIVNKIQDLTQEYLNVHIKER 146 >gi|254781011|ref|YP_003065424.1| orotate phosphoribosyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 228 Score = 23.5 bits (49), Expect = 1.9, Method: Compositional matrix adjust. Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 8/77 (10%) Query: 38 YMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCGLLYI--VKSIYAHKKI 95 Y QNI+A ++K+ I+ N ++P Y ++ + LYI K I + Sbjct: 5 YFPQQNIIAELVAKMLFEIKAVNFSPENP----YHLTSG--IVSPLYIDCRKLISFVRAR 58 Query: 96 SEILKMDSLTILQHLGL 112 S I+ + + T+L+++G Sbjct: 59 SMIMDLTAKTVLRNIGF 75 >gi|254781128|ref|YP_003065541.1| hypothetical protein CLIBASIA_05150 [Candidatus Liberibacter asiaticus str. psy62] Length = 225 Score = 22.3 bits (46), Expect = 3.7, Method: Compositional matrix adjust. Identities = 7/16 (43%), Positives = 9/16 (56%) Query: 48 CMSKLWMVIEWENKGD 63 C + W V +W KGD Sbjct: 201 CYDQPWDVSKWREKGD 216 >gi|254780823|ref|YP_003065236.1| double-strand break repair protein AddB [Candidatus Liberibacter asiaticus str. psy62] Length = 1040 Score = 21.9 bits (45), Expect = 4.6, Method: Compositional matrix adjust. Identities = 16/66 (24%), Positives = 31/66 (46%), Gaps = 8/66 (12%) Query: 75 DSQIVCGLLYIVKSIYAHKKISEILKMDSLTILQHLGLTENLSQKRMNGLYTIVNKIQDL 134 D + V L YI ++ + K+D +T + + LS+K + L IV +Q+ Sbjct: 953 DCRKVANLFYI--------RLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNG 1004 Query: 135 TQEYLN 140 Q +++ Sbjct: 1005 EQPFIS 1010 >gi|254781094|ref|YP_003065507.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 702 Score = 21.9 bits (45), Expect = 4.7, Method: Compositional matrix adjust. Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 2 IPINDIIEDMEMIEDLHDR 20 IP++ IED +I HDR Sbjct: 523 IPLSQFIEDQNLILFFHDR 541 >gi|254780567|ref|YP_003064980.1| hypothetical protein CLIBASIA_02270 [Candidatus Liberibacter asiaticus str. psy62] Length = 246 Score = 21.2 bits (43), Expect = 9.1, Method: Compositional matrix adjust. Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Query: 84 YIVKSIYAHKKISEIL--KMDSLTILQHLGLTENLS 117 YIV+ + +E L KMD+L + + +G+T +L+ Sbjct: 200 YIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLA 235 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.139 0.409 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,544 Number of Sequences: 1233 Number of extensions: 3881 Number of successful extensions: 10 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 7 length of query: 146 length of database: 328,796 effective HSP length: 66 effective length of query: 80 effective length of database: 247,418 effective search space: 19793440 effective search space used: 19793440 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 34 (17.7 bits)