HHsearch alignment for GI: 254780999 and conserved domain: COG0037

>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning].
Probab=98.33  E-value=8.7e-06  Score=57.02  Aligned_cols=143  Identities=17%  Similarity=0.139  Sum_probs=91.3

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCHHHEEEEECCCCCC--CCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             405752158723689999998414954467973246666--522135699999972135426775899999886313234
Q gi|254780999|r  293 HKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYT--SPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFL  370 (562)
Q Consensus       293 ~~~viglSGGiDSal~a~la~~alg~~~v~~~~mp~~~~--s~~s~~~a~~la~~lg~~~~~i~I~~~~~~~~~~~~~~~  370 (562)
T Consensus        22 ~~ilVavSGGkDS~~ll~~L~~l~~~~~~~a~~Vd~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~------   95 (298)
T COG0037          22 YKILVAVSGGKDSLALLHLLKELGRRIEVEAVHVDHGLRGYSDQEAELVEKLCEKLGIPLIVERVTDDLGRETL------   95 (298)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHHHCCC------
T ss_conf             85899937878999999999984225738999970898864328999999999964998488620454310024------


Q ss_pred             CCCCCCHHHHCCCCHHHHHHHHHHHHHCCCEECCCC-CHHHHH----------------HHHCCCCCCCCC--CCCCCCC
Q ss_conf             687431011012330466779888751695443643-244775----------------411023666555--4010177
Q gi|254780999|r  371 QEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTS-NKSEIS----------------VGYGTLYGDMSG--GFNPLKD  431 (562)
Q Consensus       371 ~~~~~~~~~eN~qaR~R~~~L~~~an~~~~lvl~t~-nksE~~----------------~Gy~T~~GD~~g--~~~p~~~  431 (562)
T Consensus        96 ~----~~~~c~~c~~~R~~~l~~~a~~~g~~~i~tgH~~dD~~et~lm~l~~g~~~~~l~~~~~~~~~~~~~~~iRPL~~  171 (298)
T COG0037          96 D----GKSICAACRRLRRGLLYKIAKELGADKIATGHHLDDQAETFLMNLLRGSGLRGLRGMPPKRPFEGGLLIIRPLLY  171 (298)
T ss_pred             C----CCCHHHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHCCCCHHHHHCCCCCCCCCCCCEEECCCCC
T ss_conf             6----767879999999999999999859998985678468999999998617522456408852445788645475746


Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             63365899999963
Q gi|254780999|r  432 LYKTQVFQLASWRN  445 (562)
Q Consensus       432 l~Kt~v~~la~~~n  445 (562)
T Consensus       172 ~~~~ei~~~~~~~~  185 (298)
T COG0037         172 VREKEIELYAKEKG  185 (298)
T ss_pred             CCHHHHHHHHHHCC
T ss_conf             88999999999759