HHsearch alignment for GI: 254780999 and conserved domain: KOG0571

>KOG0571 consensus.
Probab=98.22  E-value=1.7e-05  Score=55.14  Aligned_cols=149  Identities=20%  Similarity=0.247  Sum_probs=88.2

Q ss_pred             HCCHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCH------HHEEEEECCCCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             2202035888764224540575215872368999999841495------4467973246666522135699999972135
Q gi|254780999|r  276 YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGK------ENVQTIMLPYKYTSPQSLEDAAACAKALGCK  349 (562)
Q Consensus       276 ~~Alvlgl~d~~~~~g~~~~viglSGGiDSal~a~la~~alg~------~~v~~~~mp~~~~s~~s~~~a~~la~~lg~~  349 (562)
T Consensus       211 r~~~~~aV~KRLM~d~--p~GvLLSGGLDSSLvAsia~R~lk~~~~~~~~~lhsFaIGle-~SP-DL~aarkVAd~igt~  286 (543)
T KOG0571         211 RHTLEKAVRKRLMTDV--PFGVLLSGGLDSSLVASIAARELKKAQAARGSKLHSFAIGLE-DSP-DLLAARKVADFIGTI  286 (543)
T ss_pred             HHHHHHHHHHHHHCCC--CEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC-CCH-HHHHHHHHHHHHCCC
T ss_conf             9999999999863168--615895077318999999999998766412787547885289-985-378889999874885


Q ss_pred             CCCCC--HHHHHHHHHHHHCCCCCCCCCCHHHHCCCCHHHHHHHHHHHHHCCC-EECCCCCHHHHHHHHCCCCCCCCCCC
Q ss_conf             42677--5899999886313234687431011012330466779888751695-44364324477541102366655540
Q gi|254780999|r  350 YDVLP--IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKA-MLLTTSNKSEISVGYGTLYGDMSGGF  426 (562)
Q Consensus       350 ~~~i~--I~~~~~~~~~~~~~~~~~~~~~~~~eN~qaR~R~~~L~~~an~~~~-lvl~t~nksE~~~Gy~T~~GD~~g~~  426 (562)
T Consensus       287 Hhe~~ft~qegidal~eVI~h---LETYDvt--tIRastpmyLlsr~Ikk~gvkmvlSGEGsDEifggYlYfh------~  355 (543)
T KOG0571         287 HHEHTFTIQEGIDALDEVIYH---LETYDVT--TIRASTPMYLLSRKIKKLGVKMVLSGEGSDEIFGGYLYFH------K  355 (543)
T ss_pred             CEEEEECHHHHHHHHHHHHEE---EECCCCC--EEECCCCHHHHHHHHHHCCEEEEEECCCCHHHHCCEEEEE------C
T ss_conf             238997588877788877424---1013441--5861774678999997655289981577134421121100------3


Q ss_pred             CCCCCCCHHHHHH
Q ss_conf             1017763365899
Q gi|254780999|r  427 NPLKDLYKTQVFQ  439 (562)
Q Consensus       427 ~p~~~l~Kt~v~~  439 (562)
T Consensus       356 APs~~~fh~E~~r  368 (543)
T KOG0571         356 APSAEEFHEESVR  368 (543)
T ss_pred             CCCHHHHHHHHHH
T ss_conf             8897898899999