HHsearch alignment for GI: 254780999 and conserved domain: PRK01269

>PRK01269 thiamine biosynthesis protein ThiI; Provisional.
Probab=97.88  E-value=6.4e-05  Score=51.36  Aligned_cols=185  Identities=16%  Similarity=0.223  Sum_probs=103.4

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCHHHEEEEEC--CCCCCCCCCHHHHHHHHHHHC----CCCCCCCHHHHHHHHHHHH
Q ss_conf             4057521587236899999984149544679732--466665221356999999721----3542677589999988631
Q gi|254780999|r  293 HKVIIGLSGGIDSALCAAIAVDALGKENVQTIML--PYKYTSPQSLEDAAACAKALG----CKYDVLPIHDLVNHFFSLM  366 (562)
Q Consensus       293 ~~~viglSGGiDSal~a~la~~alg~~~v~~~~m--p~~~~s~~s~~~a~~la~~lg----~~~~~i~I~~~~~~~~~~~  366 (562)
T Consensus       178 GkvL~LlSGGiDSPVAa~~mmKR-G~-~v~~l~F~lg~~~~e~~V~~va~~L~~~~~~~~~vr~~~V~f~~v~~eI~~~v  255 (483)
T PRK01269        178 EDVLSLISGGFDSGVASYMLMRR-GS-RVHYCFFNLGGAAHEIGVKQVAHYLWNRYGSSHRVRFISVDFEPVVGEILEKV  255 (483)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHC-CC-EEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHC
T ss_conf             86899952788838889999845-98-79999957998688999999999999973888870899976799999998738


Q ss_pred             CCCCCCCCCCHHHHCCCCHHHHHHHHHHHHHCCCEECCCCCH-----HHHHHHHCCCC-CCCCCCCCCCCCCCHHHHHHH
Q ss_conf             323468743101101233046677988875169544364324-----47754110236-665554010177633658999
Q gi|254780999|r  367 SQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNK-----SEISVGYGTLY-GDMSGGFNPLKDLYKTQVFQL  440 (562)
Q Consensus       367 ~~~~~~~~~~~~~eN~qaR~R~~~L~~~an~~~~lvl~t~nk-----sE~~~Gy~T~~-GD~~g~~~p~~~l~Kt~v~~l  440 (562)
T Consensus       256 ~~----~~~~vv----~KR~M~R~A~~iA~~~g~~ALVTGESLGQVASQTL~NL~~i~~~~~~pVlRPLIg~DK~eII~~  327 (483)
T PRK01269        256 DN----GQMGVV----LKRMMLRAASKVAERYGIQALVTGEALGQVSSQTLTNLRLIDNVTDTLILRPLIAMDKEDIIDL  327 (483)
T ss_pred             CH----HHEEHH----HHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCHHHHHHH
T ss_conf             76----344399----9999999999999985998898555034567767878899887407740047667988999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCH--HHCCCCCCCCCCCCCCCCCCCC-CHHHHHHHHH
Q ss_conf             9996310332223444466887--8828898845389997700068-8788999999
Q gi|254780999|r  441 ASWRNSHGITSGLGPLTEVIPP--SILEKSPSAELRPHQTDQESLP-PYPILDDIIK  494 (562)
Q Consensus       441 a~~~n~~~~~~~~~~~~~~ip~--~i~~~~psaeL~~~Q~ded~l~-~Y~~lD~il~  494 (562)
T Consensus       328 Ar~IGTye~s-------~~~pEyCgvis~~P~~~a~~~~ie~ee~~fd~~vl~~~v~  377 (483)
T PRK01269        328 ARQIGTEDFA-------KTMPEYCGVISKKPTVKAVKEKIEAEEKKFDFAILDRVVE  377 (483)
T ss_pred             HHHHCHHHHH-------CCCCCCEEECCCCCCCCCCHHHHHHHHHHCCHHHHHHHHH
T ss_conf             9983928776-------0368650512689836558999899987199999999998