HHsearch alignment for GI: 254780999 and conserved domain: PRK02628

>PRK02628 nadE NAD synthetase; Reviewed.
Probab=100.00  E-value=0  Score=1122.49  Aligned_cols=557  Identities=25%  Similarity=0.369  Sum_probs=493.1

Q ss_pred             CCCC--EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9886--28999963883688999999999999999985998999166444799844541488999999999999999988
Q gi|254780999|r    1 MLKK--LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTH   78 (562)
Q Consensus         1 M~~~--mkIal~Q~n~~~gd~~~N~~~i~~~i~~A~~~gadLvvfPEl~LtGY~~~Dl~~~~~f~~~~~~~l~~La~~~~   78 (562)
T Consensus         7 ~~~~gfirvA~a~~~~~VgD~~~N~~~I~~~i~~A~~~ga~lvvfPEL~ltGY~~eDL~l~~~fl~~~~~aL~~l~~~t~   86 (678)
T PRK02628          7 IYRHGFVRVAAATPKVRVADPAFNAERILALAREAHDDGVALAVFPELSLSGYSCGDLFLQDALLDAVEDALAALVEASA   86 (678)
T ss_pred             HHHCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHCC
T ss_conf             46577127999478987538899999999999999988998998255203389889985799999999999999998578


Q ss_pred             HCCCEEEEEEEEEECCEEEEEEEEEECCEEEEEEEEEEECCCCCCCCCCCCCCCCCCC-----------------EEE--
Q ss_conf             7697899999998889878999999699799988777623554333210037788876-----------------147--
Q gi|254780999|r   79 DGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSND-----------------PIV--  139 (562)
Q Consensus        79 ~~~i~iivG~p~~~~~~~yNsa~vi~~G~il~~y~K~~LP~y~~FdE~r~F~~G~~~~-----------------~~~--  139 (562)
T Consensus        87 ~~~~~viVG~P~~~~~~LyN~A~vi~~G~Ilg~~~K~~LPNY~vFdE~R~F~~g~~~~~~~i~~~g~~vPfG~dllF~~~  166 (678)
T PRK02628         87 DLDPVLVVGAPLRVRHRLYNCAVVIHRGRILGVVPKSYLPNYREFYEKRWFAPGDGIRGETIRLCGQEVPFGTDLLFEAE  166 (678)
T ss_pred             CCCEEEEEECEEECCCCEEEEEEEEECCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEC
T ss_conf             98859999330620895488999999999999970433879976574636777777886168347822045665256541


Q ss_pred             -ECCEEEEECCCCCCCHHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCC--CCCC
Q ss_conf             -6474562011111110168999997147775993155533358078887889998543370464213568876--6210
Q gi|254780999|r  140 -FRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQD--ELIF  216 (562)
Q Consensus       140 -~~g~kiGv~ICeDlw~~~~~~~~la~~Gadlii~psASp~~~~k~~~R~~~~~~~a~e~~~~vvy~N~vGg~d--~lvf  216 (562)
T Consensus       167 ~~~g~~~GveICEDlW~~~~P~~~la~~GA~lI~NlSASp~~~gK~~~R~~lv~~~s~~~~~~yvY~n~G~gEsttDlVF  246 (678)
T PRK02628        167 DLPGFVFGVEICEDLWVPIPPSSYAALAGATVLANLSASNITVGKADYRRLLVASQSARCLAAYVYAAAGVGESTTDLAW  246 (678)
T ss_pred             CCCCCEEEEEEEECCCCCCCHHHHHHHCCCCEEEECCCCHHHCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCEEE
T ss_conf             66883899997211488998589998749887971688803348699999999999886288569982357876760699


Q ss_pred             CCCCEEECCCCEEEEECCCCCCC--EEEEEEEECCCCCCCCC---------------------------------CCCCC
Q ss_conf             48643555898599961677763--79999983352123655---------------------------------57555
Q gi|254780999|r  217 DGASFCFDGQQQLAFQMKHFSEQ--NFMTEWHYDQQLSQWNY---------------------------------MSDDS  261 (562)
Q Consensus       217 ~G~S~I~d~~G~ii~~~~~f~e~--~~i~d~d~d~~~~~~~~---------------------------------~~~~~  261 (562)
T Consensus       247 dG~s~I~~-nG~lla~~~~F~~~~~l~~adiDl~~l~~~R~~~~sf~~~~~~~~~~~~~~~~v~~~~~~~~~~~~l~r~v  325 (678)
T PRK02628        247 DGQTLIYE-NGELLAESERFPREEQLIIADIDLERLRQERLRNGSFDDNRRHHRNESAPFRTIPFALDPPTGDLGLRRPV  325 (678)
T ss_pred             ECCEEEEC-CCCEEEECCCCCCCCCEEEEEEEHHHHHHHHHHCCCCCCCCHHCCCCCCCCEEEEEECCCCCCCCCCCCCC
T ss_conf             68867872-88167533566667636899830777666664047622210001345566336543115664544433544


Q ss_pred             CCCCCCCCCH------HHHHHCCHHHHHHHHHHHCCCCEEEEECCCCCHHH---HHHHHHHHCCCH--HHEEEEECCCCC
Q ss_conf             5544789998------88642202035888764224540575215872368---999999841495--446797324666
Q gi|254780999|r  262 ASTMYIPLQE------EEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSA---LCAAIAVDALGK--ENVQTIMLPYKY  330 (562)
Q Consensus       262 ~~~~~~p~~~------~e~~~~Alvlgl~d~~~~~g~~~~viglSGGiDSa---l~a~la~~alg~--~~v~~~~mp~~~  330 (562)
T Consensus       326 ~~~PfvP~~~~~~~~~~~ei~~~qv~GL~dyl~k~g~~~vViGLSGGiDSaLaLLVaa~A~d~Lg~~r~~V~~vtMPs~~  405 (678)
T PRK02628        326 ERFPFVPSDPERLDQRCYEAYNIQVSGLAQRLRATGIKKVVIGISGGLDSTLALLVAAKAFDRLGLPRKNILAYTMPGFG  405 (678)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCHHCEEEEECCCCC
T ss_conf             66888888533445549999999999999999864998189967776447999999999999848971224899778876


Q ss_pred             CCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCC--CCCHHHHCCCCHHHHHHHHHHHHHCCCEECCCCCH
Q ss_conf             6522135699999972135426775899999886313234687--43101101233046677988875169544364324
Q gi|254780999|r  331 TSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEE--PSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNK  408 (562)
Q Consensus       331 ~s~~s~~~a~~la~~lg~~~~~i~I~~~~~~~~~~~~~~~~~~--~~~~~~eN~qaR~R~~~L~~~an~~~~lvl~t~nk  408 (562)
T Consensus       406 TS~~S~~dA~~La~~LGi~~~~I~I~~a~~~~~~di~~~~~~~~~~~Dvt~ENiQAR~R~~iLM~laNk~g~LVL~TGNk  485 (678)
T PRK02628        406 TTDRTKNNAVALMKALGVTAREIDIRPAALQMLKDIGHPFARGEKVYDVTFENVQAGERTQILFRLANQRGGLVIGTGDL  485 (678)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCC
T ss_conf             57878999999999729977997629999999998444222378776602665203556789999745779679736851


Q ss_pred             HHHHHHHCCC-CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHCCCCCCCCCCCC-------CCCC
Q ss_conf             4775411023-6665554010177633658999999631033222344446688788288988453899-------9770
Q gi|254780999|r  409 SEISVGYGTL-YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH-------QTDQ  480 (562)
Q Consensus       409 sE~~~Gy~T~-~GD~~g~~~p~~~l~Kt~v~~la~~~n~~~~~~~~~~~~~~ip~~i~~~~psaeL~~~-------Q~de  480 (562)
T Consensus       486 SElAvGy~Ty~yGD~mg~yavn~~VpKTlV~~L~r~~a~~~~---~~~~~~~vl~~Il~tpiSpEL~P~~~~~~i~QktE  562 (678)
T PRK02628        486 SELALGWCTYGVGDHMSHYNVNASVPKTLIQHLIRWVAESGQ---FDEAVSEVLLDILDTPISPELVPPDEEGEIVQKTE  562 (678)
T ss_pred             CHHHHCEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC---CCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             468648310477541246244678837899999999986244---45311256898546999914279886677887463


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCHHHHH----------------------HCCCHHHHHHHH----HHHHHHHHHHHHCCC
Q ss_conf             006887889999999982799977987----------------------189999999999----999874566873897
Q gi|254780999|r  481 ESLPPYPILDDIIKRIVENEESFINND----------------------QEYNDETVRYVE----HLLYGSEYKRRQAPV  534 (562)
Q Consensus       481 d~l~~Y~~lD~il~~~i~~~~~~~~~~----------------------~~~~~~~v~~~~----~~~~~~~~KR~~~pp  534 (562)
T Consensus       563 d~lgPYel~Df~Ly~~lr~g~~p~ki~~la~~af~~~~~~~~~~~~~~~~~y~~~~i~~wl~~f~~Rff~~QfKRs~~P~  642 (678)
T PRK02628        563 DIVGPYELQDFFLYYFLRYGFRPSKIAFLAWHAWKDAERG