HHsearch alignment for GI: 254780999 and conserved domain: TIGR00420

>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; InterPro: IPR004506 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (2.1.1.61 from EC) catalyses the addition of 5-methylaminomethyl-2-thiouridylate to tRNAs using S-adenosyl-L-methionine as a substrate and releasing S-adenosyl-L-homocysteine. The enzyme is cytoplasmic and is involved in tRNA processing.; GO: 0004808 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase activity, 0008033 tRNA processing, 0005737 cytoplasm.
Probab=99.13  E-value=5.1e-10  Score=84.70  Aligned_cols=146  Identities=25%  Similarity=0.347  Sum_probs=88.5

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCHHHEEEEECCC--------------------CCCCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             405752158723689999998414954467973246--------------------666522135699999972135426
Q gi|254780999|r  293 HKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPY--------------------KYTSPQSLEDAAACAKALGCKYDV  352 (562)
Q Consensus       293 ~~~viglSGGiDSal~a~la~~alg~~~v~~~~mp~--------------------~~~s~~s~~~a~~la~~lg~~~~~  352 (562)
T Consensus         1 ~kv~VglSGGVDSSVsA~lL~~q-g~-~v~G~ylk~W~~~~~~d~~GH~~~N~~K~~C~~~~dl~~a~~ic~~LGi~l~~   78 (394)
T TIGR00420         1 KKVIVGLSGGVDSSVSAYLLKQQ-GY-EVVGVYLKNWDEDEKNDILGHKKINENKSGCSSAEDLRDAQAICEKLGIPLEK   78 (394)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHC-CC-EEEEEEEEEEECCCCCCCCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             94899806854789999999714-96-58999877651246666443165624677883688799999999855981898


Q ss_pred             CCHHHHHHH--HHHHHCCCCCCCC--CCH-HHHCCCCHHH-HHHHHHHHHH-C--CCEECCCCCHHHHH-H---------
Q ss_conf             775899999--8863132346874--310-1101233046-6779888751-6--95443643244775-4---------
Q gi|254780999|r  353 LPIHDLVNH--FFSLMSQFLQEEP--SGI-VAENIQSRIR-GNILMALSNH-S--KAMLLTTSNKSEIS-V---------  413 (562)
Q Consensus       353 i~I~~~~~~--~~~~~~~~~~~~~--~~~-~~eN~qaR~R-~~~L~~~an~-~--~~lvl~t~nksE~~-~---------  413 (562)
T Consensus        79 ~nf~~~Y~~~Vf~~~i~~y~~G~TPnPDi~C--N~--~iKFG~-~~e~~~~~~Gtg~~~~aTGHYAr~~q~~~~~~~~~L  153 (394)
T TIGR00420        79 VNFQKEYWNKVFEPFIQEYKEGLTPNPDILC--NK--LIKFGL-LLEYAKQLLGTGNDKIATGHYARIAQEIENKSLFEL  153 (394)
T ss_pred             ECHHHHHHHHHHHHHHHHHHCCCCCCCCCCC--CC--CCCHHH-HHHHHHHHCCCCCCEEECCHHHHHHHHHCCCCHHHH
T ss_conf             5507887888889999987367777862004--71--200378-999999852899543442447654434213101444


Q ss_pred             --H--------HCCC--C-CCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             --1--------1023--6-66555401017763365899999963
Q gi|254780999|r  414 --G--------YGTL--Y-GDMSGGFNPLKDLYKTQVFQLASWRN  445 (562)
Q Consensus       414 --G--------y~T~--~-GD~~g~~~p~~~l~Kt~v~~la~~~n  445 (562)
T Consensus       154 ~~~~D~~KDQSYFL~~l~~~~~~~~~FPlG~L~K~~vR~iA~~~~  198 (394)
T TIGR00420       154 LRALDKNKDQSYFLYHLSQEQLAKLLFPLGELLKPEVRQIAKNAG  198 (394)
T ss_pred             HCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCC
T ss_conf             304678886117376401898887505301036778999998648