HHsearch alignment for GI: 254780999 and conserved domain: TIGR03573

>TIGR03573 WbuX N-acetyl sugar amidotransferase. This enzyme has been implicated in the formation of the acetamido moiety (sugar-NC(=NH)CH3) which is found on some exopolysaccharides and is positively charged at neutral pH. The reaction involves ligation of ammonia with a sugar N-acetyl group, displacing water. In E. coli (O145 strain) and Pseudomonas aeruginosa (O12 strain) this gene is known as wbuX and ifnA respectively and likely acts on sialic acid. In Campylobacter jejuni, the gene is known as pseA and acts on pseudaminic acid in the process of flagellin glycosylation. In other Pseudomonas strains and various organisms it is unclear what the identity of the sugar substrate is, and in fact, the phylogenetic tree of this family sports a considerably deep branching suggestive of possible major differences in substrate structure. Nevertheless, the family is characterized by a conserved tetracysteine motif (CxxC.....[GN]xCxxC) possibly indicative of a metal binding site, as well as an
Probab=98.09  E-value=1e-05  Score=56.64  Aligned_cols=65  Identities=25%  Similarity=0.345  Sum_probs=57.5

Q ss_pred             EEEEECCCCCHHHHHHHHHHHCCCHHHEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCCCHHHHH
Q ss_conf             057521587236899999984149544679732466665221356999999721354267758999
Q gi|254780999|r  294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV  359 (562)
Q Consensus       294 ~~viglSGGiDSal~a~la~~alg~~~v~~~~mp~~~~s~~s~~~a~~la~~lg~~~~~i~I~~~~  359 (562)
T Consensus        61 DCiv~vSGGkDS~y~~~~l~~~~g-l~pL~vt~d~~~~t~~g~~Ni~~l~~~lgvD~i~~~~n~~~  125 (343)
T TIGR03573        61 DCIIGVSGGKDSTYQAHVLKKKLG-LNPLLVTVDPGWNTELGVKNLNNLIKKLGFDLHTITINPET  125 (343)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHHC-CCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEECCCHHH
T ss_conf             689868877289999999999829-92599983598779899999999998369985874699999