HHsearch alignment for GI: 254780999 and conserved domain: cd01996

>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This subfamily of proteins is predicted to bind ATP. This domain has a strongly conserved motif SGGKD at the N terminus.
Probab=97.84  E-value=4e-05  Score=52.71  Aligned_cols=64  Identities=25%  Similarity=0.359  Sum_probs=53.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHCCCHHHEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCCCHHHHH
Q ss_conf             057521587236899999984149544679732466665221356999999721354267758999
Q gi|254780999|r  294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV  359 (562)
Q Consensus       294 ~~viglSGGiDSal~a~la~~alg~~~v~~~~mp~~~~s~~s~~~a~~la~~lg~~~~~i~I~~~~  359 (562)
T Consensus         3 DcIVpvSGGKDS~y~~~~lk~kygl-npL~Vt~~~~~~t~~g~~Nl~nl~~~-g~D~~~~~~~~~~   66 (154)
T cd01996           3 DCIIGVSGGKDSSYALYLLKEKYGL-NPLAVTVDNGFNSEEAVKNIKNLIKK-GLDLDHLVINPEE   66 (154)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHHCC-CEEEEEECCCCCCHHHHHHHHHHHHC-CCCEEEEECCHHH
T ss_conf             7899688881899999999999499-65999967987546899999999974-9981699328889