HHsearch alignment for GI: 254780999 and conserved domain: cd01997

>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase. It contains two subdomains; the ATP pyrophosphatase domain which closes to the N-termial and the dimerization domain at C-terminal end. The ATP-PPase is a twisted, five-stranded parallel beta-sheet sandwiched between helical layers. It has a signature nucleotide-binding motif, or P-loop, at the end of the first-beta strand.The dimerization domain formed by the C-terminal 115 amino acid for prokaryotic proteins. It is adjacent to teh ATP-binding site of the ATP-PPase subdomain. The largest difference between the primary sequence of prokaryotic and eukaryotic GMP synthetase map to the dimerization domain.Eukaryotic GMP synthetase has several large insertions relative to prokaryotes.
Probab=99.13  E-value=3.8e-10  Score=85.58  Aligned_cols=157  Identities=23%  Similarity=0.319  Sum_probs=92.1

Q ss_pred             EEEEECCCCCHHHHHHHHHHHCCCHHHEEEEECCCCCCCCCCHHH-HHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCC
Q ss_conf             057521587236899999984149544679732466665221356-9999997213542677589999988631323468
Q gi|254780999|r  294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLED-AAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQE  372 (562)
Q Consensus       294 ~~viglSGGiDSal~a~la~~alg~~~v~~~~mp~~~~s~~s~~~-a~~la~~lg~~~~~i~I~~~~~~~~~~~~~~~~~  372 (562)
T Consensus         1 kVi~~lSGGVDStV~A~Ll~kAig-~~l~~vfVDnGlmRk~E~e~V~~~~~~~~~~~~~~vdas---~~Fl~~L~gv~DP   76 (295)
T cd01997           1 KVILALSGGVDSTVAAVLLHKAIG-DRLTCVFVDNGLLRKNEAERVEELFSKLLGINLIVVDAS---ERFLSALKGVTDP   76 (295)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHH-CCEEEEEECCCCCCCCCHHHHHHHHHHHCCCCEEEECHH---HHHHHHHCCCCCH
T ss_conf             989990578289999999998865-056999985897888829999999987069977995669---9999986587792


Q ss_pred             CCCCHHHHCCCCHHHHHHHHHHHHHCC---CEECCCC--CHHHHHHHH------CCCC------CCCC-CCCCCCCCCCH
Q ss_conf             743101101233046677988875169---5443643--244775411------0236------6655-54010177633
Q gi|254780999|r  373 EPSGIVAENIQSRIRGNILMALSNHSK---AMLLTTS--NKSEISVGY------GTLY------GDMS-GGFNPLKDLYK  434 (562)
Q Consensus       373 ~~~~~~~eN~qaR~R~~~L~~~an~~~---~lvl~t~--nksE~~~Gy------~T~~------GD~~-g~~~p~~~l~K  434 (562)
T Consensus        77 E~KRKiIG~~----Fi~vf~~~~~~~~~~~~L~QGTlyPDvIES~~~~~~a~~IKsHHNvggLp~~~~~kliEPLr~LfK  152 (295)
T cd01997          77 EEKRKIIGET----FIEVFEEEAKKLGLAEYLAQGTLYPDVIESGSGKGSADTIKSHHNVGGLPEDMKLKLIEPLRDLFK  152 (295)
T ss_pred             HHHHHHHHHH----HHHHHHHHHHHCCCCCEEEECCCCCCEEECCCCCCCCCEEEEECCCCCCCHHCCCCCCHHHHHHHH
T ss_conf             5636565389----999999999755886189724302625750788888751452245677723226540016788745


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCHHHCCCCCCCC
Q ss_conf             65899999963103322234444668878828898845
Q gi|254780999|r  435 TQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAE  472 (562)
Q Consensus       435 t~v~~la~~~n~~~~~~~~~~~~~~ip~~i~~~~psae  472 (562)
T Consensus       153 DEVR~lG~~LG--------------lp~~iv~RhPFPG  176 (295)
T cd01997         153 DEVRELGRELG--------------LPEEIVERHPFPG  176 (295)
T ss_pred             HHHHHHHHHHC--------------CCHHHEEECCCCC
T ss_conf             99999999868--------------9788822079999