HHsearch alignment for GI: 254780999 and conserved domain: cd07564

>cd07564 nitrilases_CHs Nitrilases, cyanide hydratase (CH)s, and similar proteins (class 1 nitrilases). Nitrilases (nitrile aminohydrolases, EC:3.5.5.1) hydrolyze nitriles (RCN) to ammonia and the corresponding carboxylic acid. Most nitrilases prefer aromatic nitriles, some prefer arylacetonitriles and others aliphatic nitriles. This group includes the nitrilase cyanide dihydratase (CDH), which hydrolyzes inorganic cyanide (HCN) to produce formate. It also includes cyanide hydratase (CH), which hydrolyzes HCN to formamide. This group includes four Arabidopsis thaliana nitrilases (Ath)NIT1-4. AthNIT1-3 have a strong substrate preference for phenylpropionitrile (PPN) and other nitriles which may originate from the breakdown of glucosinolates. The product of PPN hydrolysis, phenylacetic acid has auxin activity. AthNIT1-3 can also convert indoacetonitrile to indole-3-acetic acid (IAA, auxin), but with a lower affinity and velocity. From their expression patterns, it has been speculated that
Probab=100.00  E-value=0  Score=342.78  Aligned_cols=244  Identities=22%  Similarity=0.279  Sum_probs=202.3

Q ss_pred             EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHC--------CHHHHHHH----HHHHHH
Q ss_conf             289999638836889999999999999999859989991664447998445414--------88999999----999999
Q gi|254780999|r    5 LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVF--------KKSFIQAC----SSAIDT   72 (562)
Q Consensus         5 mkIal~Q~n~~~gd~~~N~~~i~~~i~~A~~~gadLvvfPEl~LtGY~~~Dl~~--------~~~f~~~~----~~~l~~   72 (562)
T Consensus         1 mkVA~vQ~~~~~~d~~~Nl~~~~~~i~~Aa~~ga~lvvfPE~~~tGYp~~~~~~~~~~~~~~~~~~~~~a~~~~g~~~~~   80 (297)
T cd07564           1 VKVAAVQAAPVFLDLAATVEKACRLIEEAAANGAQLVVFPEAFIPGYPYWIWFGAPAEGRELFARYYENSVEVDGPELER   80 (297)
T ss_pred             CEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCHHHCCCCCCCHHHHHHHHHHCCCCCCHHHHH
T ss_conf             98999957787799999999999999999988995999589986578724431684003799999997464699989999


Q ss_pred             HHHHHHHCCCEEEEEEEEEECCEEEEEEEEEE-CCEEEEEEEEEEECCCCCCCCCCCCCCCC--CCCEEEECCEEEEECC
Q ss_conf             99998876978999999988898789999996-99799988777623554333210037788--8761476474562011
Q gi|254780999|r   73 LKSDTHDGGAGIVVGFPRQDQEGVLNSVVILD-AGNIIAVRDKINLPNYSEFHEKRTFISGY--SNDPIVFRDIRLGILI  149 (562)
Q Consensus        73 La~~~~~~~i~iivG~p~~~~~~~yNsa~vi~-~G~il~~y~K~~LP~y~~FdE~r~F~~G~--~~~~~~~~g~kiGv~I  149 (562)
T Consensus        81 l~~~A~~~~i~iv~G~~E~~~~~~yNtav~i~~~G~i~~~yrKi~-p~~---~E~~~f~~G~g~~~~v~~t~~griG~~I  156 (297)
T cd07564          81 LAEAARENGIYVVLGVSERDGGTLYNTQLLIDPDGELLGKHRKLK-PTH---AERLVWGQGDGSGLRVVDTPIGRLGALI  156 (297)
T ss_pred             HHHHHHHCCCEEEEEEEECCCCCEEEEEEEECCCCCEEEEECCCC-CCC---CCEEEECCCCCCCCEEECCCCEEEEEEE
T ss_conf             999999829599984166369956867999879995898965767-786---6224663578877457525871688786


Q ss_pred             CCCCCHHHHHHHHHHHCCCCEEEE--CCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCC---------------C
Q ss_conf             111110168999997147775993--15553335807888788999854337046421356887---------------6
Q gi|254780999|r  150 CEDIWKNSNICKHLKKQGAEFLFS--LNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQ---------------D  212 (562)
Q Consensus       150 CeDlw~~~~~~~~la~~Gadlii~--psASp~~~~k~~~R~~~~~~~a~e~~~~vvy~N~vGg~---------------d  212 (562)
T Consensus       157 CyD~~fP~-~~~~l~~~ga~i~va~~P~~~~~~~~~-~~w~~l~rarAiEnq~fVva~n~~g~~~~~~~~~~~~~~~~~~  234 (297)
T cd07564         157 CWENYMPL-ARYALYAQGEQIHVAPWPDFSPYYLSR-EAWLAASRHYALEGRCFVLSACQVVTEEDIPADCEDDEEADPL  234 (297)
T ss_pred             CCCCHHHH-HHHHHHHCCCEEEEECCCCCCCCCCCH-HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
T ss_conf             25410699-999998589809997378644677878-9999999999985595899965313633332003565445567


Q ss_pred             CCCCCCCCEEECCCCEEEEECCCCCCCEEEEEEEECCCCCCC
Q ss_conf             621048643555898599961677763799999833521236
Q gi|254780999|r  213 ELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQW  254 (562)
Q Consensus       213 ~lvf~G~S~I~d~~G~ii~~~~~f~e~~~i~d~d~d~~~~~~  254 (562)
T Consensus       235 ~~~~~G~S~Ii~P~G~vla~~~~~~e~ii~adiDl~~i~~~R  276 (297)
T cd07564         235 EVLGGGGSAIVGPDGEVLAGPLPDEEGILYADIDLDDIVEAK  276 (297)
T ss_pred             CCCCCCEEEEECCCCCEEECCCCCCCEEEEEEECHHHHHHHH
T ss_conf             764375589998999786564799974999995699999999