HHsearch alignment for GI: 254780999 and conserved domain: cd07568

>cd07568 ML_beta-AS_like mammalian-like beta-alanine synthase (beta-AS) and similar proteins (class 5 nitrilases). This family includes mammalian-like beta-AS (EC 3.5.1.6, also known as beta-ureidopropionase or N-carbamoyl-beta-alanine amidohydrolase). This enzyme catalyzes the third and final step in the catabolic pyrimidine catabolic pathway responsible for the degradation of uracil and thymine, the hydrolysis of N-carbamyl-beta-alanine and N-carbamyl-beta-aminoisobutyrate to the beta-amino acids, beta-alanine and beta-aminoisobutyrate respectively. This family belongs to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 5. Members of this superfamily generally form homomeric
Probab=100.00  E-value=0  Score=369.58  Aligned_cols=250  Identities=17%  Similarity=0.191  Sum_probs=214.7

Q ss_pred             CCCEEEEEEECC-------CCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHCC-HHHHHHH--HHHHH
Q ss_conf             886289999638-------8368899999999999999998599899916644479984454148-8999999--99999
Q gi|254780999|r    2 LKKLKIAIAQLN-------PVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFK-KSFIQAC--SSAID   71 (562)
Q Consensus         2 ~~~mkIal~Q~n-------~~~gd~~~N~~~i~~~i~~A~~~gadLvvfPEl~LtGY~~~Dl~~~-~~f~~~~--~~~l~   71 (562)
T Consensus         1 ~~~~~~~~~q~~~~~~~~aPv~~d~eanl~k~~~li~eAa~~Ga~LivfPE~~~tgy~~~~~~~~~~~~a~~~~~gp~~~   80 (287)
T cd07568           1 SRIVRVGLIQASNVIPTDAPIEKQKEAMIQKHVTMIREAAEAGAQIVCLQEIFYGPYFCAEQDTKWYEFAEEIPNGPTTK   80 (287)
T ss_pred             CCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCHHHH
T ss_conf             94699999914378898887123399999999999999998859199878886568776544447888617058988999


Q ss_pred             HHHHHHHHCCCEEEEEEEEEE-CCEEEEEEEEEE-CCEEEEEEEEEEECCCCCCCCCCCCCCCCC-CCEEEECCEEEEEC
Q ss_conf             999998876978999999988-898789999996-997999887776235543332100377888-76147647456201
Q gi|254780999|r   72 TLKSDTHDGGAGIVVGFPRQD-QEGVLNSVVILD-AGNIIAVRDKINLPNYSEFHEKRTFISGYS-NDPIVFRDIRLGIL  148 (562)
Q Consensus        72 ~La~~~~~~~i~iivG~p~~~-~~~~yNsa~vi~-~G~il~~y~K~~LP~y~~FdE~r~F~~G~~-~~~~~~~g~kiGv~  148 (562)
T Consensus        81 ~l~~~Ar~~~i~iv~g~~e~~~~g~lyNt~~~i~~~G~ii~~yrK~hlp~~~~~~E~~~f~~G~~~~~Vf~t~~g~iG~l  160 (287)
T cd07568          81 RFAALAKEYNMVLILPIYEKEQGGTLYNTAAVIDADGTYLGKYRKNHIPHVGGFWEKFYFRPGNLGYPVFDTAFGKIGVY  160 (287)
T ss_pred             HHHHHHHHCCCEEEEEEEEECCCCCEEEEEEEECCCCCEEEEECCCCCCCCCCCCEEEEECCCCCCCEEEEECCEEEEEE
T ss_conf             99999998592899635787699968999999999997966880134979998470035768898845999799069886


Q ss_pred             CCCCCCHHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCC---CCCCCCCCEEECC
Q ss_conf             1111110168999997147775993155533358078887889998543370464213568876---6210486435558
Q gi|254780999|r  149 ICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQD---ELIFDGASFCFDG  225 (562)
Q Consensus       149 ICeDlw~~~~~~~~la~~Gadlii~psASp~~~~k~~~R~~~~~~~a~e~~~~vvy~N~vGg~d---~lvf~G~S~I~d~  225 (562)
T Consensus       161 ICyD~~fPE-~~r~la~~Ga~ii~~Psa~~~~~~~~-~w~~~~~arA~en~~yv~~~n~~G~e~~~~~~~~~G~S~Ii~P  238 (287)
T cd07568         161 ICYDRHFPE-GWRALGLNGAEIVFNPSATVAGLSEY-LWKLEQPAAAVANGYFVGAINRVGTEAPWNIGEFYGSSYFVDP  238 (287)
T ss_pred             ECCCCCCHH-HHHHHHHCCCCEEEECCCCCCCCCHH-HHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCEEEECC
T ss_conf             512325729-99999987997998377777775504-5778988888875936999545566678877856375089889


Q ss_pred             CCEEEEECCCCCCCEEEEEEEECCCCCC
Q ss_conf             9859996167776379999983352123
Q gi|254780999|r  226 QQQLAFQMKHFSEQNFMTEWHYDQQLSQ  253 (562)
Q Consensus       226 ~G~ii~~~~~f~e~~~i~d~d~d~~~~~  253 (562)
T Consensus       239 ~G~via~~~~~~e~ii~adiDl~~~~~~  266 (287)
T cd07568         239 RGQFVASASRDKDELLVAELDLDLIREV  266 (287)
T ss_pred             CCCEEEECCCCCCEEEEEEECHHHHHHH
T ss_conf             9988865379988899999658999999