HHsearch alignment for GI: 254780999 and conserved domain: cd07571

>cd07571 ALP_N-acyl_transferase Apolipoprotein N-acyl transferase (class 9 nitrilases). ALP N-acyl transferase (Lnt), is an essential membrane-bound enzyme in gram-negative bacteria, which catalyzes the N-acylation of apolipoproteins, the final step in lipoprotein maturation. This is a reverse amidase (i.e. condensation) reaction. This subgroup belongs to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 9.
Probab=99.98  E-value=1.7e-29  Score=212.15  Aligned_cols=224  Identities=19%  Similarity=0.298  Sum_probs=178.3

Q ss_pred             EEEEEEECCCCC------CCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             289999638836------88999999999999999985998999166444799844541488999999999999999988
Q gi|254780999|r    5 LKIAIAQLNPVV------GDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTH   78 (562)
Q Consensus         5 mkIal~Q~n~~~------gd~~~N~~~i~~~i~~A~~~gadLvvfPEl~LtGY~~~Dl~~~~~f~~~~~~~l~~La~~~~   78 (562)
T Consensus         1 ~~V~lVQ~Ni~~~~k~~~~~~~~~~~~~~~ls~~~~~~~~dlIVwPEta~p~~~~~-----------~~~~~~~~~~~~~   69 (270)
T cd07571           1 LRVALVQGNIPQDEKWDPEQRQATLDRYLDLTRELADEKPDLVVWPETALPFDLQR-----------DPDALARLARAAR   69 (270)
T ss_pred             CEEEEEECCCCHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHH-----------CHHHHHHHHHHHH
T ss_conf             98999907998145128546999999999999877617999999489466765111-----------8899999999987


Q ss_pred             HCCCEEEEEEEEEECC--EEEEEEEEEE-CCEEEEEEEEEEECCCCCC---------------CCCCCCCCCCCCCEEEE
Q ss_conf             7697899999998889--8789999996-9979998877762355433---------------32100377888761476
Q gi|254780999|r   79 DGGAGIVVGFPRQDQE--GVLNSVVILD-AGNIIAVRDKINLPNYSEF---------------HEKRTFISGYSNDPIVF  140 (562)
Q Consensus        79 ~~~i~iivG~p~~~~~--~~yNsa~vi~-~G~il~~y~K~~LP~y~~F---------------dE~r~F~~G~~~~~~~~  140 (562)
T Consensus        70 ~~~~~li~G~~~~~~~~~~~yNs~~~~~~~g~~~~~Y~K~hLVPFGEyiP~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~  149 (270)
T cd07571          70 AVGAPLLTGAPRREPGGGRYYNSALLLDPGGGILGRYDKHHLVPFGEYVPLRDLLRFLGLLFDLPMGDFSPGTGPQPLLL  149 (270)
T ss_pred             HCCCEEEEEEEEEECCCCCEEEEEEEECCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEC
T ss_conf             55997999554565698867889999989998420784332206541366177777788752466586314999864652


Q ss_pred             CC-EEEEECCCCCCCHHHHHHHHHHHCCCCEEEECCC-CCCCC-CCHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCC
Q ss_conf             47-4562011111110168999997147775993155-53335-807888788999854337046421356887662104
Q gi|254780999|r  141 RD-IRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA-SPYYH-NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFD  217 (562)
Q Consensus       141 ~g-~kiGv~ICeDlw~~~~~~~~la~~Gadlii~psA-Sp~~~-~k~~~R~~~~~~~a~e~~~~vvy~N~vGg~d~lvf~  217 (562)
T Consensus       150 ~~~~~~~~~ICYE~~f~~-~~r~~~~~ga~~lv~~tNdaWfg~s~~~~Qhl~~ar~RAiE~~r~~vr~~nt---------  219 (270)
T cd07571         150 GGGVRVGPLICYESIFPE-LVRDAVRQGADLLVNITNDAWFGDSAGPYQHLAMARLRAIETGRPLVRAANT---------  219 (270)
T ss_pred             CCCCEEEEEEEEHHHCHH-HHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEECCC---------
T ss_conf             798258889975343649-9999864487099997366456788417999999898899829963986696---------


Q ss_pred             CCCEEECCCCEEEEECCCCCCCEEEEEEEECC
Q ss_conf             86435558985999616777637999998335
Q gi|254780999|r  218 GASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQ  249 (562)
Q Consensus       218 G~S~I~d~~G~ii~~~~~f~e~~~i~d~d~d~  249 (562)
T Consensus       220 GiSa~Id~~G~i~~~~~~~~~~~l~~~v~~~~  251 (270)
T cd07571         220 GISAVIDPDGRIVARLPLFEAGVLVAEVPLRT  251 (270)
T ss_pred             EEEEEECCCCCEEEECCCCCCEEEEEEEECCC
T ss_conf             26899999987888747998279999950588