HHsearch alignment for GI: 254780999 and conserved domain: cd07575

>cd07575 Xc-1258_like Xanthomonas campestris XC1258 and related proteins, members of the nitrilase superfamily (putative class 13 nitrilases). Uncharacterized subgroup belonging to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), class 13 represents proteins that at the time were difficult to place in a distinct similarity group; this subgroup either represents a new class or one that was included previously in class 13. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer. XC1258 is a homotetramer.
Probab=100.00  E-value=0  Score=351.47  Aligned_cols=236  Identities=17%  Similarity=0.249  Sum_probs=201.4

Q ss_pred             EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             28999963883688999999999999999985998999166444799844541488999999999999999988769789
Q gi|254780999|r    5 LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGI   84 (562)
Q Consensus         5 mkIal~Q~n~~~gd~~~N~~~i~~~i~~A~~~gadLvvfPEl~LtGY~~~Dl~~~~~f~~~~~~~l~~La~~~~~~~i~i   84 (562)
T Consensus         1 mkial~Q~~~~~~d~e~Nl~~~~~~i~~a~-~~adlivfPEl~~tGy~~~~~~~ae~---~~~~~~~~l~~~A~~~~i~i   76 (252)
T cd07575           1 LKIALIQTDLVWEDPEANLAHFEEKIEQLK-EKTDLIVLPEMFTTGFSMNAEALAEP---MNGPTLQWMKAQAKKKGAAI   76 (252)
T ss_pred             CEEEEEECCCCCCCHHHHHHHHHHHHHHHH-CCCCEEECCCCCCCCCCCCHHHHCCC---CCCHHHHHHHHHHHHCCCEE
T ss_conf             989999667887999999999999999986-69999999886556899896884635---78889999999997569889


Q ss_pred             EEEEEEEECCEEEEEEEEEE-CCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCEEEECCEEEEECCCCCCCHHHHHHHHH
Q ss_conf             99999988898789999996-99799988777623554333210037788876147647456201111111016899999
Q gi|254780999|r   85 VVGFPRQDQEGVLNSVVILD-AGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHL  163 (562)
Q Consensus        85 ivG~p~~~~~~~yNsa~vi~-~G~il~~y~K~~LP~y~~FdE~r~F~~G~~~~~~~~~g~kiGv~ICeDlw~~~~~~~~l  163 (562)
T Consensus        77 ~g~~~~~~~~~~yNta~~i~~~G~i-~~YrK~hL~--~~~~E~~~f~~G~~~~v~~~~g~riGl~ICyDl~FPe-~~R~-  151 (252)
T cd07575          77 TGSLIIKEGGKYYNRLYFVTPDGEV-YHYDKRHLF--RMAGEHKVYTAGNERVIVEYKGWKILLQVCYDLRFPV-WSRN-  151 (252)
T ss_pred             EEEEEEEECCEEEEEEEEEECCCEE-EEEEEEECC--CCCCCCCCCCCCCCCEEEEECCEEEEEEEECCCCCHH-HHHH-
T ss_conf             9999998799589999999199669-998027669--9888660003898657998589667778864657679-9875-


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCC-CCCCCCCCCEEECCCCEEEEECCCCCCCEEE
Q ss_conf             714777599315553335807888788999854337046421356887-6621048643555898599961677763799
Q gi|254780999|r  164 KKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQ-DELIFDGASFCFDGQQQLAFQMKHFSEQNFM  242 (562)
Q Consensus       164 a~~Gadlii~psASp~~~~k~~~R~~~~~~~a~e~~~~vvy~N~vGg~-d~lvf~G~S~I~d~~G~ii~~~~~f~e~~~i  242 (562)
T Consensus       152 -~~~~dil~~~a~~P~~--~~~~w~~l~~aRA~eN~~~vv~~N~~G~~~~~~~~~G~S~Iv~P~G~ila~a~~-~e~~~~  227 (252)
T cd07575         152 -TNDYDLLLYVANWPAP--RRAAWDTLLKARAIENQAYVIGVNRVGTDGNGLEYSGDSAVIDPLGEPLAEAEE-DEGVLT  227 (252)
T ss_pred             -HCCCCEEEEEECCCCC--CHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCEEEEEEEEECCCCCEEEECCC-CCEEEE
T ss_conf             -3478747987148763--168999999999997497699965666689998884247999999778797799-985999


Q ss_pred             EEEEECCCCCC
Q ss_conf             99983352123
Q gi|254780999|r  243 TEWHYDQQLSQ  253 (562)
Q Consensus       243 ~d~d~d~~~~~  253 (562)
T Consensus       228 a~iD~~~i~~~  238 (252)
T cd07575         228 ATLDKEALQEF  238 (252)
T ss_pred             EEECHHHHHHH
T ss_conf             99658999999