HHsearch alignment for GI: 254780999 and conserved domain: cd07577

>cd07577 Ph0642_like Pyrococcus horikoshii Ph0642 and related proteins, members of the nitrilase superfamily (putative class 13 nitrilases). Uncharacterized subgroup of the nitrilase superfamily. This superfamily is comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. Pyrococcus horikoshii Ph0642 is a hypothetical protein belonging to this subgroup. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13). This subgroup was classified as belonging to class 13, which represents proteins that at the time were difficult to place in a distinct similarity group. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer.
Probab=100.00  E-value=0  Score=362.65  Aligned_cols=234  Identities=23%  Similarity=0.298  Sum_probs=200.1

Q ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHCCHHHHHHH--HHHHHHHHHHHHHCCCE
Q ss_conf             8999963883688999999999999999985998999166444799844541488999999--99999999998876978
Q gi|254780999|r    6 KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC--SSAIDTLKSDTHDGGAG   83 (562)
Q Consensus         6 kIal~Q~n~~~gd~~~N~~~i~~~i~~A~~~gadLvvfPEl~LtGY~~~Dl~~~~~f~~~~--~~~l~~La~~~~~~~i~   83 (562)
T Consensus         1 kIA~~Q~~~~~gd~~~Nl~k~~~~i~~a---~adlvvfPEl~ltGY~~~~~~~~~~~~~~~~~~~~~~~l~~~a~~~~i~   77 (259)
T cd07577           1 KVGYVQFNPKFGEVEKNLKKVESLIKGV---EADLIVLPELFNTGYAFTSKEEVASLAESIPDGPTTRFLQELARETGAY   77 (259)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHC---CCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHCCCE
T ss_conf             9999989898899999999999999975---9989997886102688899899998742536988999999999972958


Q ss_pred             EEEEEEEEECCEEEEEEEEEECCEEEEEEEEEEECCCCCCCCCCCCCCCCC-CCEEEECCEEEEECCCCCCCHHHHHHHH
Q ss_conf             999999988898789999996997999887776235543332100377888-7614764745620111111101689999
Q gi|254780999|r   84 IVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYS-NDPIVFRDIRLGILICEDIWKNSNICKH  162 (562)
Q Consensus        84 iivG~p~~~~~~~yNsa~vi~~G~il~~y~K~~LP~y~~FdE~r~F~~G~~-~~~~~~~g~kiGv~ICeDlw~~~~~~~~  162 (562)
T Consensus        78 iv~G~~e~~~~~~yNs~~~i~~~g~i~~y~K~hl~----~~E~~~f~~G~~~~~v~~~~~~kiG~~IC~D~~fPe-~~r~  152 (259)
T cd07577          78 IVAGLPERDGDKFYNSAVVVGPEGYIGIYRKTHLF----YEEKLFFEPGDTGFRVFDIGDIRIGVMICFDWYFPE-AART  152 (259)
T ss_pred             EEEEEEEEECCEEEEEEEEECCCCEEEEEECCCCC----CCCCEEEECCCCCCEEEEECCEEEEEEEEHHCCCHH-HHHH
T ss_conf             99979997799899999998199338999654799----752128827997504997799898645782117719-9999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCC----CCCCCCCCCCEEECCCCEEEEECCCCCC
Q ss_conf             971477759931555333580788878899985433704642135688----7662104864355589859996167776
Q gi|254780999|r  163 LKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGG----QDELIFDGASFCFDGQQQLAFQMKHFSE  238 (562)
Q Consensus       163 la~~Gadlii~psASp~~~~k~~~R~~~~~~~a~e~~~~vvy~N~vGg----~d~lvf~G~S~I~d~~G~ii~~~~~f~e  238 (562)
T Consensus       153 la~~Ga~ii~~ps~~~~~-----~~~~~~~arA~en~~~vv~~n~vG~~~~~~~~~~f~G~S~i~~P~G~ila~~~~~~E  227 (259)
T cd07577         153 LALKGADIIAHPANLVLP-----YCPKAMPIRALENRVFTITANRIGTEERGGETLRFIGKSQITSPKGEVLARAPEDGE  227 (259)
T ss_pred             HHHCCCCEEEEEECCCCH-----HHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCEECCCEEEECCCCCEEEECCCCCC
T ss_conf             998799899990046872-----159999999997498699997555157898873475894999899989887799988


Q ss_pred             CEEEEEEEECCCCC
Q ss_conf             37999998335212
Q gi|254780999|r  239 QNFMTEWHYDQQLS  252 (562)
Q Consensus       239 ~~~i~d~d~d~~~~  252 (562)
T Consensus       228 ~~l~adiDl~~~~~  241 (259)
T cd07577         228 EVLVAEIDPRLARD  241 (259)
T ss_pred             EEEEEEEEHHHHHH
T ss_conf             89999970699898