HHsearch alignment for GI: 254780999 and conserved domain: cd07579

>cd07579 nitrilase_1_R2 Second nitrilase domain of an uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases). Members of this subgroup have two nitrilase domains. This is the second of those two domains. The nitrilase superfamily is comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13). Class 13 represents proteins that at the time were difficult to place in a distinct similarity group; this subgroup represents either a new class or one that was included previously in class 13. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer.
Probab=100.00  E-value=1.4e-45  Score=318.01  Aligned_cols=233  Identities=21%  Similarity=0.227  Sum_probs=191.3

Q ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCEEE
Q ss_conf             89999638836889999999999999999859989991664447998445414889999999999999999887697899
Q gi|254780999|r    6 KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGIV   85 (562)
Q Consensus         6 kIal~Q~n~~~gd~~~N~~~i~~~i~~A~~~gadLvvfPEl~LtGY~~~Dl~~~~~f~~~~~~~l~~La~~~~~~~i~ii   85 (562)
T Consensus         1 rvA~~Q~~~~-~d~~~Nl~~~~~~i~~Aa~~ga~lvvlPE~~~tg~~~~~~~a----~~~~g~~~~~l~~lA~~~~i~iv   75 (279)
T cd07579           1 RIAVAQFAPT-PDIAGNLATIDRLAAEAKATGAELVVFPELALTGLDDPASEA----ESDTGPAVSALRRLARRLRLYLV   75 (279)
T ss_pred             CEEEEECCCC-CCHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCHHHHC----CCCCCHHHHHHHHHHHHCCEEEE
T ss_conf             9999946589-999999999999999999879959997999411599547743----55998899999999997591999


Q ss_pred             EEEEEEECCEEEEEEEEEEC-CEEEEEEEEEEECCCCCCCCCCCCCCCCCCCEEEECCEEEEECCCCCCCHHHHHHHHHH
Q ss_conf             99999888987899999969-97999887776235543332100377888761476474562011111110168999997
Q gi|254780999|r   86 VGFPRQDQEGVLNSVVILDA-GNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLK  164 (562)
Q Consensus        86 vG~p~~~~~~~yNsa~vi~~-G~il~~y~K~~LP~y~~FdE~r~F~~G~~~~~~~~~g~kiGv~ICeDlw~~~~~~~~la  164 (562)
T Consensus        76 ~G~~e~~~~~~yNs~~~i~~~G-~i~~YrK~HL~~----~E~~~~~~G~~~~v~~t~~griGl~ICyD~rFPE-~~R~la  149 (279)
T cd07579          76 AGFAEADGDGLYNSAVLVGPEG-LVGTYRKTHLIE----PERSWATPGDTWPVYDLPLGRVGLLIGHDALFPE-AGRVLA  149 (279)
T ss_pred             EEEEECCCCEEEEEEEEECCCC-CEEEEEECCCCC----CCCEEECCCCCCEEEEECCEEEEEEEECCCCHHH-HHHHHH
T ss_conf             9899945993788899985997-678997025897----5441133898055999899889988880201289-999999


Q ss_pred             HCCCCEEEECCCCC--C---------------CCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCEEECCCC
Q ss_conf             14777599315553--3---------------358078887889998543370464213568876621048643555898
Q gi|254780999|r  165 KQGAEFLFSLNASP--Y---------------YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ  227 (562)
Q Consensus       165 ~~Gadlii~psASp--~---------------~~~k~~~R~~~~~~~a~e~~~~vvy~N~vGg~d~lvf~G~S~I~d~~G  227 (562)
T Consensus       150 ~~GA~il~~PaA~~~~~~~~~~~~~~~~~~~~~~g~~~~hw~llraRAieN~~~v~~an~~~~~~~--~~G~s~i~gp~~  227 (279)
T cd07579         150 LRGCDLLACPAAIAIPFVGAHAGTSVPQPYPIPTGADPTHWHLARVRAGENNVYFAFANVPDPARG--YTGWSGVFGPDT  227 (279)
T ss_pred             HCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEEECCCCCCCC--CCCEEEEEECCC
T ss_conf             879939997663466755333453233455544465347999999888646759999435467678--663469996575


Q ss_pred             EEEEEC---CCCCCCEEEEEEEECCCC
Q ss_conf             599961---677763799999833521
Q gi|254780999|r  228 QLAFQM---KHFSEQNFMTEWHYDQQL  251 (562)
Q Consensus       228 ~ii~~~---~~f~e~~~i~d~d~d~~~  251 (562)
T Consensus       228 ~~~p~~~~~~~~~egi~~A~iDl~~~~  254 (279)
T cd07579         228 FAFPRQEAAIGDEEGIAWALIDTSNLD  254 (279)
T ss_pred             CCCCCEEEECCCCCCEEEEEECHHHHH
T ss_conf             543531350388772799997589974