HHsearch alignment for GI: 254780999 and conserved domain: cd07580

>cd07580 nitrilase_2 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases). The nitrilase superfamily is comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13). Class 13 represents proteins that at the time were difficult to place in a distinct similarity group; this subgroup represents either a new class or one that was included previously in class 13. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer.
Probab=100.00  E-value=0  Score=370.91  Aligned_cols=243  Identities=21%  Similarity=0.241  Sum_probs=208.1

Q ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHCCHHHHHHH--HHHHHHHHHHHHHCCCE
Q ss_conf             8999963883688999999999999999985998999166444799844541488999999--99999999998876978
Q gi|254780999|r    6 KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC--SSAIDTLKSDTHDGGAG   83 (562)
Q Consensus         6 kIal~Q~n~~~gd~~~N~~~i~~~i~~A~~~gadLvvfPEl~LtGY~~~Dl~~~~~f~~~~--~~~l~~La~~~~~~~i~   83 (562)
T Consensus         1 riA~~Q~~~~~gd~~~Nl~k~~~~i~~A~~~ga~lvvfPE~~ltGy~~~~~~~~~~~~~~~~~~~~~~~l~~~a~~~~i~   80 (268)
T cd07580           1 RVACVQFDPRVGDLDANLARSIELIREAADAGANLVVLPELANTGYVFESRDEAFALAEEVPDGASTRAWAELAAELGLY   80 (268)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHCCEE
T ss_conf             98999898987999999999999999999888919998888411698468899999865427988999999999972949


Q ss_pred             EEEEEEEEECCEEEEEEEEEECCEEEEEEEEEEECCCCCCCCCCCCCCCCC-CCEEEECCEEEEECCCCCCCHHHHHHHH
Q ss_conf             999999988898789999996997999887776235543332100377888-7614764745620111111101689999
Q gi|254780999|r   84 IVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYS-NDPIVFRDIRLGILICEDIWKNSNICKH  162 (562)
Q Consensus        84 iivG~p~~~~~~~yNsa~vi~~G~il~~y~K~~LP~y~~FdE~r~F~~G~~-~~~~~~~g~kiGv~ICeDlw~~~~~~~~  162 (562)
T Consensus        81 iv~g~~e~~~~~~yNs~~~i~~~g~i~~yrK~hl~~----~E~~~f~~G~~~~~v~~~~~g~iG~~IC~D~~fPe-~~r~  155 (268)
T cd07580          81 IVAGFAERDGDRLYNSAVLVGPDGVIGTYRKAHLWN----EEKLLFEPGDLGLPVFDTPFGRIGVAICYDGWFPE-TFRL  155 (268)
T ss_pred             EEEEEEECCCCEEEEEEEEECCCCEEEEEECCCCCC----CHHHEEECCCCCCEEEEECCCEEEEEEECCCCCHH-HHHH
T ss_conf             998357732996999899963995899995356897----07854857998703898078579998840113709-9999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHH----HHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCEEECCCCEEEEE-CCCCC
Q ss_conf             97147775993155533358078----88788999854337046421356887662104864355589859996-16777
Q gi|254780999|r  163 LKKQGAEFLFSLNASPYYHNKLK----KRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQ-MKHFS  237 (562)
Q Consensus       163 la~~Gadlii~psASp~~~~k~~----~R~~~~~~~a~e~~~~vvy~N~vGg~d~lvf~G~S~I~d~~G~ii~~-~~~f~  237 (562)
T Consensus       156 la~~Ga~ii~~p~~~~~~~~~~~~~~~~~~~l~~arA~en~~~v~~~n~~G~~~~~~~~G~S~IvdP~G~vla~~~~~~~  235 (268)
T cd07580         156 LALQGADIVCVPTNWVPMPRPPEGGPPMANILAMAAAHSNGLFIACADRVGTERGQPFIGQSLIVGPDGWPLAGPASGDE  235 (268)
T ss_pred             HHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCEECCCCEEECCCCCEEEECCCCCC
T ss_conf             99869979999266888677531036899999999998779889996776776896564888799999988841068998


Q ss_pred             CCEEEEEEEECCCCCC
Q ss_conf             6379999983352123
Q gi|254780999|r  238 EQNFMTEWHYDQQLSQ  253 (562)
Q Consensus       238 e~~~i~d~d~d~~~~~  253 (562)
T Consensus       236 e~ll~adiDl~~~~~~  251 (268)
T cd07580         236 EEILLADIDLTAARRK  251 (268)
T ss_pred             CEEEEEEECHHHHHHH
T ss_conf             7899999716999998