HHsearch alignment for GI: 254780999 and conserved domain: cd07581

>cd07581 nitrilase_3 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases). The nitrilase superfamily is comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13). Class 13 represents proteins that at the time were difficult to place in a distinct similarity group; this subgroup represents either a new class or one that was included previously in class 13. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer.
Probab=100.00  E-value=0  Score=367.32  Aligned_cols=239  Identities=21%  Similarity=0.257  Sum_probs=209.9

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             99996388368899999999999999998599899916644479984454148899999999999999998876978999
Q gi|254780999|r    7 IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVV   86 (562)
Q Consensus         7 Ial~Q~n~~~gd~~~N~~~i~~~i~~A~~~gadLvvfPEl~LtGY~~~Dl~~~~~f~~~~~~~l~~La~~~~~~~i~iiv   86 (562)
T Consensus         1 IA~~Q~~~~-gd~~~Nl~ki~~~i~~A~~~gadlvvfPE~~l~~~~~~~~~~~~~a~~~~~~~~~~l~~~A~~~~i~iv~   79 (255)
T cd07581           1 VALAQFASS-GDKEENLEKVRRLLAEAAAAGADLVVFPEYTMARFGDGLDDYARVAEPLDGPFVSALARLARELGITVVA   79 (255)
T ss_pred             CEEEECCCC-CCHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHCCCEEEE
T ss_conf             489994799-9999999999999999998839899989882005994377888764246869999999999877997998


Q ss_pred             EEEEEEC-CEEEEEEEEEE-CCEEEEEEEEEEECCCCCCCCCCCCCCCCCCC--EEEECCEEEEECCCCCCCHHHHHHHH
Q ss_conf             9999888-98789999996-99799988777623554333210037788876--14764745620111111101689999
Q gi|254780999|r   87 GFPRQDQ-EGVLNSVVILD-AGNIIAVRDKINLPNYSEFHEKRTFISGYSND--PIVFRDIRLGILICEDIWKNSNICKH  162 (562)
Q Consensus        87 G~p~~~~-~~~yNsa~vi~-~G~il~~y~K~~LP~y~~FdE~r~F~~G~~~~--~~~~~g~kiGv~ICeDlw~~~~~~~~  162 (562)
T Consensus        80 G~~e~~~~~~~yNta~~i~~~G~i~~~y~K~hL~~~~~~~E~~~f~~G~~~~~~~~~~~g~~iG~~IC~D~~fPe-~~r~  158 (255)
T cd07581          80 GMFEPAGDGRVYNTLVVVGPDGEIIAVYRKIHLYDAFGFRESDTVAPGDELPPVVFVVGGVKVGLATCYDLRFPE-LARA  158 (255)
T ss_pred             EEEEECCCCCEEEEEEEEECCCCEEEEEEEEECCCCCCCCEEEEEECCCCCCEEEEEECCEEEEEEEEEECCCCH-HHHH
T ss_conf             003788999489999999689965889953425777887623457359987518998299589978877067819-9999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCEEECCCCEEEEECCCCCCCEEE
Q ss_conf             97147775993155533358078887889998543370464213568876621048643555898599961677763799
Q gi|254780999|r  163 LKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM  242 (562)
Q Consensus       163 la~~Gadlii~psASp~~~~k~~~R~~~~~~~a~e~~~~vvy~N~vGg~d~lvf~G~S~I~d~~G~ii~~~~~f~e~~~i  242 (562)
T Consensus       159 la~~Ga~li~~psa~~~~~~~~~~w~~~~~arA~en~~~vv~~n~~G~~----~~G~S~Iv~P~G~ila~~~~-~E~~i~  233 (255)
T cd07581         159 LALAGADVIVVPAAWVAGPGKEEHWETLLRARALENTVYVAAAGQAGPR----GIGRSMVVDPLGVVLADLGE-REGLLV  233 (255)
T ss_pred             HHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCC----CCCEEEEECCCCCEEEECCC-CCCEEE
T ss_conf             9987997999877888988759999999999999659879999471799----74159999899749775599-982899


Q ss_pred             EEEEECCCCC
Q ss_conf             9998335212
Q gi|254780999|r  243 TEWHYDQQLS  252 (562)
Q Consensus       243 ~d~d~d~~~~  252 (562)
T Consensus       234 a~iDl~~~~~  243 (255)
T cd07581         234 ADIDPERVEE  243 (255)
T ss_pred             EEECHHHHHH
T ss_conf             9954999999