HHsearch alignment for GI: 254780999 and conserved domain: pfam00764

>pfam00764 Arginosuc_synth Arginosuccinate synthase. This family contains a PP-loop motif.
Probab=95.47  E-value=0.2  Score=28.45  Aligned_cols=57  Identities=23%  Similarity=0.349  Sum_probs=20.9

Q ss_pred             EECCCCCHHHHHHHHHHHCCCHHHEEEEECCCCCCCCCCHHHHHHHHHHHCC-CCCCCCHH
Q ss_conf             5215872368999999841495446797324666652213569999997213-54267758
Q gi|254780999|r  297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGC-KYDVLPIH  356 (562)
Q Consensus       297 iglSGGiDSal~a~la~~alg~~~v~~~~mp~~~~s~~s~~~a~~la~~lg~-~~~~i~I~  356 (562)
T Consensus         2 LAySGGLDTSv~l~wL~e~-~~-eVia~~~d~-Gq~~ed~~~i~~kA~~~GA~~~~v~D~r   59 (389)
T pfam00764         2 LAYSGGLDTSVCIPWLKEK-YY-EVIAVAVDV-GQGEEDLDEAREKALKLGAVKHYVIDAK   59 (389)
T ss_pred             EEECCCCHHHHHHHHHHHC-CC-EEEEEEEEC-CCCHHHHHHHHHHHHHHCCCEEEEECCH
T ss_conf             6036762899999999970-99-289999979-9977878999999998299789997379