HHsearch alignment for GI: 254780999 and conserved domain: pfam01507

>pfam01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family. This domain is found in phosphoadenosine phosphosulfate (PAPS) reductase enzymes or PAPS sulfotransferase. PAPS reductase is part of the adenine nucleotide alpha hydrolases superfamily also including N type ATP PPases and ATP sulphurylases. The enzyme uses thioredoxin as an electron donor for the reduction of PAPS to phospho-adenosine-phosphate (PAP). It is also found in NodP nodulation protein P from Rizobium which has ATP sulfurylase activity (sulfate adenylate transferase).
Probab=97.06  E-value=0.0064  Score=38.29  Aligned_cols=143  Identities=19%  Similarity=0.184  Sum_probs=77.8

Q ss_pred             EEEEECCCCCHHHHHHHHHHHCCCHHHEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCC
Q ss_conf             05752158723689999998414954467973246666522135699999972135426775899999886313234687
Q gi|254780999|r  294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEE  373 (562)
Q Consensus       294 ~~viglSGGiDSal~a~la~~alg~~~v~~~~mp~~~~s~~s~~~a~~la~~lg~~~~~i~I~~~~~~~~~~~~~~~~~~  373 (562)
T Consensus         1 ~v~vsfSGGKDS~vlL~L~~~~~~~--~~vvf~Dtg~efpet~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~   74 (174)
T pfam01507         1 ELVVSFSGGKDSLVLLHLASKAFPP--GPVIFIDTGYEFPETYEFVDELEEKYGLNLKVYRPEDSFAEGINPEGI----P   74 (174)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCC--CCEEEEECCCCCHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHCCC----C
T ss_conf             9999957609999999999984899--757999789986899999999999849818998086779877631279----5


Q ss_pred             CCCHHHHCCCCHHH--HHHHHHHHHHCCCEECCCCCHHH-HHHH----HCCCCCCCCC--CCCCCCCCCHHHHHHHHHHH
Q ss_conf             43101101233046--67798887516954436432447-7541----1023666555--40101776336589999996
Q gi|254780999|r  374 PSGIVAENIQSRIR--GNILMALSNHSKAMLLTTSNKSE-ISVG----YGTLYGDMSG--GFNPLKDLYKTQVFQLASWR  444 (562)
Q Consensus       374 ~~~~~~eN~qaR~R--~~~L~~~an~~~~lvl~t~nksE-~~~G----y~T~~GD~~g--~~~p~~~l~Kt~v~~la~~~  444 (562)
T Consensus        75 ~~~~~-~~-~~~~~K~~p~~~~l~-~~~~~~~i~GiR~~Es~~R~~~~~~~~~~~~~~~~~~~PI~~Wt~~DVw~yi~~~  151 (174)
T pfam01507        75 SKLWE-DC-PCRLRKVEPLKRALK-KLDFDAWFTGLRRDESPSRAKLPIVSIDGDFPKVIKVFPLLNWTETDVWQYILAN  151 (174)
T ss_pred             HHHCC-CC-CHHHHHHHHHHHHHH-HCCCCEEEEEEECCCHHHHHHCCEEEEECCCCCEEEEECHHHCCHHHHHHHHHHC
T ss_conf             01145-45-214665179999998-6599689995100244566407167430578885999500529999999999983


Q ss_pred             H
Q ss_conf             3
Q gi|254780999|r  445 N  445 (562)
Q Consensus       445 n  445 (562)
T Consensus       152 ~  152 (174)
T pfam01507       152 N  152 (174)
T ss_pred             C
T ss_conf             9