BLAST/PSIBLAST alignment of GI: 254780999 and GI: 218675144 at iteration 1
>gi|218675144|ref|ZP_03524813.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli GR56] Length = 559
 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/555 (57%), Positives = 400/555 (72%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            +IAI QLNP VGD+ GN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +FI+
Sbjct: 11  FRIAIGQLNPTVGDVTGNLAKAREARADAAREGAHLLVLTELFISGYPPEDLVLKPAFIR 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+++L +DT DGG G+++GFPRQD+ G  NSV +LD G +IAVRDK++LPNY EF 
Sbjct: 71  ACWKAVESLAADTADGGPGVIIGFPRQDENGRYNSVAVLDGGKVIAVRDKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI ICEDIW +  +C+ L + GAE L S N SPYY  K+
Sbjct: 131 EKRVFHQGAMPGPVNFRGVRLGIPICEDIWGDLGVCETLAESGAEILLSPNGSPYYRGKV 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     +T 
Sbjct: 191 DIRHQVVLKQVIETGLPLIYAAQLGGQDELVFDGASFAFNADRSLAFQMSEFETALAVTT 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   +  S W+      A    IP + EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 WKRGE--SGWHCAEGPMAR---IP-EGEEADYRACLLGFRDYVNKNGFKTVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI   V  F S
Sbjct: 305 SAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEQPVTGFSS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S   +   SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALSDLFEGTESGITEENLQSRARGVILMAISNKFGAMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ LA WRN +   + LGP  EVIP +I++K+PSAELRP Q DQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYALARWRNENVPPTALGPSGEVIPLNIIDKAPSAELRPDQKDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VE E +        +D  TV  VEHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559