BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780999|ref|YP_003065412.1| NAD synthetase [Candidatus
Liberibacter asiaticus str. psy62]
         (562 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780999|ref|YP_003065412.1| NAD synthetase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040676|gb|ACT57472.1| NAD synthetase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 562

 Score = 1171 bits (3029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/562 (100%), Positives = 562/562 (100%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK
Sbjct: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY
Sbjct: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY
Sbjct: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
           HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN
Sbjct: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS
Sbjct: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN
Sbjct: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
           HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG
Sbjct: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ
Sbjct: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           ESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA
Sbjct: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540

Query: 541 KSFGRDRLYPISNKFRDHISEE 562
           KSFGRDRLYPISNKFRDHISEE
Sbjct: 541 KSFGRDRLYPISNKFRDHISEE 562


>gi|315122406|ref|YP_004062895.1| NAD synthetase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495808|gb|ADR52407.1| NAD synthetase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 561

 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/554 (77%), Positives = 492/554 (88%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           LKIAIAQLNP VGD++GNIAKAR+AREEANRQG DLI+FTELFISGYP EDL+ K+SFIQ
Sbjct: 5   LKIAIAQLNPTVGDVSGNIAKARQAREEANRQGADLIIFTELFISGYPAEDLILKESFIQ 64

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC   + TLK DT D GAGI++GFPRQDQEG+ NSV ILDAG I+++RDKI+LPNY+EFH
Sbjct: 65  ACYDGMLTLKDDTRDNGAGIIIGFPRQDQEGIFNSVAILDAGKIVSIRDKIHLPNYNEFH 124

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKRTFISG +ND +VFRD  +GILICEDIWKNSNIC+HLKKQGA+ L +LNASPY  NKL
Sbjct: 125 EKRTFISGNTNDIVVFRDNPIGILICEDIWKNSNICRHLKKQGAKILLTLNASPYCRNKL 184

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           K RHEI++ QISHV++PI+YVNQVGGQDELIFDGASFCF+G +QLAFQMKHF EQN +T+
Sbjct: 185 KTRHEIISTQISHVNIPIVYVNQVGGQDELIFDGASFCFNGDRQLAFQMKHFEEQNLITQ 244

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W+YD++ S  N +SD S S +YI   EEE DYNACV+ LRDYV+KNNFHKVIIGLSGGID
Sbjct: 245 WYYDKKSSSLNCISDYSQSKIYIFPTEEETDYNACVVGLRDYVKKNNFHKVIIGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SALCA IAVDALGKENVQTIMLPYKYTS +SLEDAAACAK+L C+YDVLPIHDLV+HFFS
Sbjct: 305 SALCATIAVDALGKENVQTIMLPYKYTSNESLEDAAACAKSLDCRYDVLPIHDLVDHFFS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
           +MSQFLQEEPSGIVAENIQSRIRGNILM LSN S+AMLLTT+NKSEIS+GYGTLYGDMSG
Sbjct: 365 IMSQFLQEEPSGIVAENIQSRIRGNILMTLSNKSEAMLLTTNNKSEISIGYGTLYGDMSG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNPLKDLYKT+V++LA WRN+H I  GLGP  EVIPP ILEK+PSAELRP+Q D++SLP
Sbjct: 425 GFNPLKDLYKTKVYKLAYWRNAHCIPCGLGPFKEVIPPRILEKAPSAELRPNQIDEDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFG 544
           PY ILD+II+ IVEN+ES  N  ++Y+ ET+RY+E+LLY SEYKRRQ+P GTKIT+KSFG
Sbjct: 485 PYAILDNIIEDIVENKESLKNTKKKYSTETIRYIENLLYRSEYKRRQSPPGTKITSKSFG 544

Query: 545 RDRLYPISNKFRDH 558
           RDRLYPISNKFRD 
Sbjct: 545 RDRLYPISNKFRDQ 558


>gi|86357986|ref|YP_469878.1| NAD synthetase [Rhizobium etli CFN 42]
 gi|86282088|gb|ABC91151.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli CFN
           42]
          Length = 559

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/555 (57%), Positives = 401/555 (72%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            +IAI QLNP VGD+AGN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +FI+
Sbjct: 11  FRIAIGQLNPTVGDVAGNLAKAREARADAGREGAHLLVLTELFISGYPPEDLVLKPAFIR 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+++L +DT DGG G+V+GFPRQDQ G  NSV +LD G ++AVRDK++LPNY EF 
Sbjct: 71  ACWKAVESLAADTADGGPGVVIGFPRQDQTGRYNSVAVLDGGKVVAVRDKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F+ G    P+ FR +RLGI ICEDIW +  +C+ L + GAE L S N SPYY  K+
Sbjct: 131 EKRVFVQGAMPGPVNFRGVRLGIPICEDIWGDLGVCETLAESGAEILLSPNGSPYYRGKV 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     +T 
Sbjct: 191 DIRHQVVLKQVIETGLPLIYAAQLGGQDELVFDGASFAFNADKSLAFQMSQFETALAVTT 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   +  + W+      A    IP ++EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 WKRGE--AGWHCAEGPMAR---IP-EDEEADYRACLLGFRDYVNKNGFKTVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+C AIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI   V  F S
Sbjct: 305 SAICTAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEQPVTGFSS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S   +   SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALSNLFEGTESGITEENLQSRARGVILMAISNKFGAMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ LA WRN +     LGP  EVIP +I++K+PSAELRP Q DQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYALARWRNENVPPGALGPSGEVIPQNIIDKAPSAELRPDQKDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VE E +        +D  TV  VEHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|241204941|ref|YP_002976037.1| NAD synthetase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858831|gb|ACS56498.1| NAD+ synthetase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 559

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/555 (56%), Positives = 400/555 (72%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            +IAI QLNP VGD+AGN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +FI+
Sbjct: 11  FRIAIGQLNPTVGDVAGNLAKAREARTDAAREGAHLLVLTELFISGYPPEDLVLKPAFIR 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A++ L +DT DGG G+++GFPRQD+ G  NSV +LDAG +IAVRDKI+LPNY EF 
Sbjct: 71  ACWKAVENLAADTADGGPGVIIGFPRQDETGRYNSVAVLDAGKVIAVRDKIDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +R+GI ICEDIW +  +C+ L + GAE L S N SPYY  K+
Sbjct: 131 EKRVFDQGAMPGPVNFRGVRIGIPICEDIWGDLGVCETLAESGAEILLSPNGSPYYRGKV 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     +T 
Sbjct: 191 DIRHQVVLKQVIETGLPLIYAAQLGGQDELVFDGASFAFNADKSLAFQMSQFETALAVTT 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   +    W+      A   +IP + EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 WKRGED--GWHCAEGPMA---HIP-ESEEADYRACLLGFRDYVNKNGFKTVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CA+ALGC+YD++PI   V  F S
Sbjct: 305 SAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCARALGCRYDIVPIEQPVTGFSS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++   +   SGI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALASLFEGTDSGITEENLQSRARGVILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ ++ WRN +     LGP  EVIP +I++K+PSAELRP Q DQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYAISRWRNENVPPGALGPSGEVIPQNIIDKAPSAELRPDQKDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VE E +        +D  TV  VEHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|222148504|ref|YP_002549461.1| NAD synthetase [Agrobacterium vitis S4]
 gi|221735490|gb|ACM36453.1| NAD synthetase [Agrobacterium vitis S4]
          Length = 559

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/557 (55%), Positives = 403/557 (72%), Gaps = 7/557 (1%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           + L+IA+AQ NP VGD+ GN++ AR AR +A   G DL+L +ELFISGYPPEDLV K +F
Sbjct: 9   ETLRIAVAQFNPTVGDVVGNLSLARTARAKAASLGADLLLLSELFISGYPPEDLVLKPAF 68

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           +QAC +A++ L +DT DGG G+++GFPRQ  +G  NSV I+D G I+ +RDKI+LPNY E
Sbjct: 69  LQACKAAVEELAADTADGGPGVIIGFPRQGDKGRHNSVAIIDGGKILGLRDKIDLPNYGE 128

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F+ G    P+ FR +RLG+ ICE+IW +  +C+ L + GAE L   N SPYYH 
Sbjct: 129 FDEKRVFVEGDMPGPVNFRGVRLGVPICEEIWNDLGVCETLAESGAEILLVPNGSPYYHG 188

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           KL+ R+++V  Q+    LP+++ NQVGGQDEL+FDGASFCF+  + LAFQM  F E   +
Sbjct: 189 KLEVRYQVVLRQVIESGLPLVFANQVGGQDELVFDGASFCFNADKTLAFQMPQFEESIVL 248

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
           T W   ++   W     + ++   IP + EEADY AC+L  RDYV KN F  V++GLSGG
Sbjct: 249 TTWT--READGWRCAPGEVSA---IP-EGEEADYRACMLGFRDYVNKNGFKSVVLGLSGG 302

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSA+CAA+AVDALG E V+TIMLPY+YTS +S +DAA CAKALGC YD++PI + V  F
Sbjct: 303 IDSAICAAMAVDALGHERVRTIMLPYRYTSEESFKDAADCAKALGCHYDIVPISEPVEGF 362

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            + ++   +   SGI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM
Sbjct: 363 LASLADMFEGTESGITEENLQSRTRGTILMAVSNKFGSMVVTTGNKSEMSVGYATLYGDM 422

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGFNP+KDLYK QV+ L++WRN+H     LGP  EVIP +I+ K+PSAELRP Q DQ+S
Sbjct: 423 NGGFNPIKDLYKMQVYALSAWRNAHVPVGALGPAGEVIPANIIAKAPSAELRPDQKDQDS 482

Query: 483 LPPYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPYP+LDDI++ +VE E S        +D  TV  VEHLLY +EYKRRQ+  G KIT K
Sbjct: 483 LPPYPVLDDILECLVEKEMSVDEILGRGHDIATVHRVEHLLYLAEYKRRQSAPGVKITKK 542

Query: 542 SFGRDRLYPISNKFRDH 558
           +FGRDR YPI+N+FRD 
Sbjct: 543 NFGRDRRYPITNRFRDR 559


>gi|227822241|ref|YP_002826212.1| NAD synthetase [Sinorhizobium fredii NGR234]
 gi|227341241|gb|ACP25459.1| glutamine-dependent NAD(+) synthetase [Sinorhizobium fredii NGR234]
          Length = 560

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/557 (58%), Positives = 407/557 (73%), Gaps = 9/557 (1%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           KL+IA+AQLNP VGDIAGN+A+AR AR +A RQG DL+LFTELFISGYPPEDLV K +F+
Sbjct: 10  KLRIAVAQLNPTVGDIAGNMARAREARADAARQGADLVLFTELFISGYPPEDLVLKPAFL 69

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
            AC  A++ L ++T DGG G+++GFPRQ      NSV +LDAG I+AVRDK++LPNY EF
Sbjct: 70  AACLRAVEKLAAETADGGPGVIIGFPRQASLQRHNSVAVLDAGKIVAVRDKVDLPNYGEF 129

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            EKR F +G    P+ FR IR+GI ICEDIW    +C+ LK+ GAE L S N SPYY  K
Sbjct: 130 DEKRVFDAGEMPGPVNFRGIRIGIPICEDIWGELGVCETLKESGAEILLSPNGSPYYRGK 189

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
           +  RH+IV  Q+    LP+IY NQ+GGQDEL+FDGASF F+  + LAFQM  F E   ++
Sbjct: 190 VDVRHQIVLKQVIETGLPMIYANQLGGQDELVFDGASFGFNADKSLAFQMSQFEEALSIS 249

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQE-EEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
           EW   +    W      S S +   L E +EADY AC+L LRDYV KN F  V++GLSGG
Sbjct: 250 EWARAED--GWV-----STSGLQSRLPESDEADYRACMLGLRDYVNKNGFKNVVLGLSGG 302

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSA+CAA+AVDALG+E V+TIMLPY+YTS +SL+DA ACAKALGC YDV+ I + V  F
Sbjct: 303 IDSAICAALAVDALGEERVRTIMLPYRYTSQESLKDAEACAKALGCYYDVVAIEEPVEGF 362

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            + ++   +   SGI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM
Sbjct: 363 LNALADTFEGTESGITEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDM 422

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGFNP+KDLYK QV+ L+ WRN       LGP  EVIP +I++K+PSAELRP+QTDQ+S
Sbjct: 423 NGGFNPIKDLYKMQVYGLSRWRNGAVPPGALGPSGEVIPQNIIDKAPSAELRPNQTDQDS 482

Query: 483 LPPYPILDDIIKRIVENEESFINNDQEYNDE-TVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPYP+LDDI++ +VE E S        +DE TV  +EHLLY +EYKRRQ+  G KIT K
Sbjct: 483 LPPYPVLDDILECLVERELSTEEIVARGHDEATVHRIEHLLYIAEYKRRQSAPGVKITKK 542

Query: 542 SFGRDRLYPISNKFRDH 558
           +FGRDR YPI+N+FRD 
Sbjct: 543 NFGRDRRYPITNRFRDR 559


>gi|150396775|ref|YP_001327242.1| NAD synthetase [Sinorhizobium medicae WSM419]
 gi|150028290|gb|ABR60407.1| NAD+ synthetase [Sinorhizobium medicae WSM419]
          Length = 560

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/555 (56%), Positives = 403/555 (72%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP VGDIAGN+ KAR AR  A R+G DL+LFTELF+SGYPPEDLV K +F+ 
Sbjct: 11  LRIAVAQLNPTVGDIAGNMTKAREARAAAAREGADLLLFTELFLSGYPPEDLVLKPAFLS 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A++ L ++T DGG GIV+GFPRQ      NSV +LD G IIAVRDK++LPNY EF 
Sbjct: 71  ACEQAVEKLAAETADGGPGIVIGFPRQAAALRHNSVAVLDGGKIIAVRDKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F +G    P+ FR +R+GI +CEDIW +  +C+ L + GAE L S N SPYY  KL
Sbjct: 131 EKRVFDAGEMPGPVNFRGVRIGIPVCEDIWGDLGVCETLAESGAEILLSPNGSPYYRGKL 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++V  Q+    LP+IY NQ+GGQDEL+FDGASF F+  + LAFQM  F E   ++E
Sbjct: 191 DVRHQVVLRQVIETGLPMIYANQLGGQDELVFDGASFAFNADKSLAFQMSQFEEAVAVSE 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W          ++S +   +  +P + EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 WRRGAD----GWVSGNGLKSR-VP-EGEEADYRACMLGFRDYVNKNGFRNVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+C A+AVDALG+E V+T+MLPY+YTS +SL+DA ACA+ALGC+YD++ I + V  F S
Sbjct: 305 SAICTALAVDALGEERVRTVMLPYRYTSRESLQDAEACARALGCRYDIVAIEEPVEGFLS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S   +   +GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALSDMFEGTEAGITEENLQSRTRGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ LA WRN       LGP  EVIP +I++K+PSAELRP QTDQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYALARWRNGTVPPGALGPSGEVIPQNIIDKAPSAELRPDQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQEYNDE-TVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VE E S  +     ++E TV  +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVEKEMSTEDVVARGHEEATVHRIEHLLYIAEYKRRQSAPGVKITRKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|190892049|ref|YP_001978591.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli
           CIAT 652]
 gi|190697328|gb|ACE91413.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli
           CIAT 652]
          Length = 559

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/555 (57%), Positives = 398/555 (71%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            +IAI QLNP VGD+AGN+ KAR AR +A R+G  L++ TELFISGYPPEDLV K +FI+
Sbjct: 11  FRIAIGQLNPTVGDVAGNLTKAREARADAAREGAHLLVLTELFISGYPPEDLVLKPAFIR 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+++L +DT DGG G+++GFPRQD+ G  NSV +LD G +IAVRDK++LPNY EF 
Sbjct: 71  ACWKAVESLAADTVDGGPGVIIGFPRQDENGRYNSVAVLDGGKVIAVRDKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR IRLGI ICEDIW    +C+ L + GAE L S N SPYY  K+
Sbjct: 131 EKRVFHQGAMPGPVNFRGIRLGIPICEDIWGELGVCETLAESGAEILLSPNGSPYYRGKV 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     +T 
Sbjct: 191 DIRHQVVLKQVIETGLPLIYAAQLGGQDELVFDGASFAFNADKSLAFQMSEFETALAVTT 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   +  S W+      A    IP + EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 WKRGE--SGWHCAEGPMAR---IP-EGEEADYRACLLGFRDYVNKNGFKTVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI   V  F S
Sbjct: 305 SAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEQPVTGFSS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S   +   SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALSDLFEGTESGITEENLQSRARGVILMAISNKFGAMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ L+ WRN +   S LGP  EVIP +I++K+PSAELRP Q DQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYALSRWRNENVPPSALGPSGEVIPQNIIDKAPSAELRPDQKDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
            YP+LDDI++ +VE E +        +D  TV  VEHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 AYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|218675144|ref|ZP_03524813.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli
           GR56]
          Length = 559

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/555 (57%), Positives = 400/555 (72%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            +IAI QLNP VGD+ GN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +FI+
Sbjct: 11  FRIAIGQLNPTVGDVTGNLAKAREARADAAREGAHLLVLTELFISGYPPEDLVLKPAFIR 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+++L +DT DGG G+++GFPRQD+ G  NSV +LD G +IAVRDK++LPNY EF 
Sbjct: 71  ACWKAVESLAADTADGGPGVIIGFPRQDENGRYNSVAVLDGGKVIAVRDKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI ICEDIW +  +C+ L + GAE L S N SPYY  K+
Sbjct: 131 EKRVFHQGAMPGPVNFRGVRLGIPICEDIWGDLGVCETLAESGAEILLSPNGSPYYRGKV 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     +T 
Sbjct: 191 DIRHQVVLKQVIETGLPLIYAAQLGGQDELVFDGASFAFNADRSLAFQMSEFETALAVTT 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   +  S W+      A    IP + EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 WKRGE--SGWHCAEGPMAR---IP-EGEEADYRACLLGFRDYVNKNGFKTVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI   V  F S
Sbjct: 305 SAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEQPVTGFSS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S   +   SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALSDLFEGTESGITEENLQSRARGVILMAISNKFGAMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ LA WRN +   + LGP  EVIP +I++K+PSAELRP Q DQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYALARWRNENVPPTALGPSGEVIPLNIIDKAPSAELRPDQKDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VE E +        +D  TV  VEHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|15965599|ref|NP_385952.1| NAD synthetase [Sinorhizobium meliloti 1021]
 gi|307302719|ref|ZP_07582475.1| NAD+ synthetase [Sinorhizobium meliloti BL225C]
 gi|15074780|emb|CAC46425.1| Putative NH3-dependent NAD+ synthetase [Sinorhizobium meliloti
           1021]
 gi|306903083|gb|EFN33674.1| NAD+ synthetase [Sinorhizobium meliloti BL225C]
          Length = 560

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/557 (56%), Positives = 403/557 (72%), Gaps = 11/557 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP VGDIAGN+AKAR AR  A R+G DL+L TELFISGYPPEDLV K +F++
Sbjct: 11  LRIAVAQLNPTVGDIAGNVAKAREARTAAAREGADLLLLTELFISGYPPEDLVLKPAFLK 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A++ L ++T DGG G+V+GFPRQ      NSV +LD G +IA+RDK++LPNY EF 
Sbjct: 71  ACEQAVEKLAAETADGGPGVVIGFPRQAAGLRHNSVAVLDGGRVIAIRDKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F +G    P+ FR +R+GI +CEDIW +  +C+ L + GAE L S N SPYY  K+
Sbjct: 131 EKRVFDAGEMPGPVNFRGVRIGIPVCEDIWGDLGVCETLAESGAEILLSPNGSPYYRGKV 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++V  Q+    LP+IY NQ+GGQDEL+FDGASF F+  + LAFQM  F E   ++E
Sbjct: 191 DVRHQVVLRQVIETGLPMIYANQLGGQDELVFDGASFAFNADKSLAFQMSQFEEAVAVSE 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W    +     ++S +   +  IP + EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 W----KRGAGGWISANGLKSR-IP-EGEEADYRACMLGFRDYVNKNGFRNVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+C A+AVDALG+E V+T+MLPY+YTS +SL DA ACAKALGC+YD++ I + V  F S
Sbjct: 305 SAICTALAVDALGEERVRTVMLPYRYTSRESLRDAEACAKALGCRYDIVAIEEPVEGFLS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++   +   +GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALADTFEGTEAGITEENLQSRTRGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ LA WRN       LGP  EVIP +I++K+PSAELRP QTDQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYALARWRNGTVPPGALGPSGEVIPQNIIDKAPSAELRPDQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           PYP+LDDI++ +VE E   E  +    E  + TV  +EHLLY +EYKRRQ+  G KIT K
Sbjct: 485 PYPVLDDILECLVEKEMSTEEIVARGHE--EATVHRIEHLLYIAEYKRRQSAPGVKITRK 542

Query: 542 SFGRDRLYPISNKFRDH 558
           +FGRDR YPI+N+FRD 
Sbjct: 543 NFGRDRRYPITNRFRDR 559


>gi|327190628|gb|EGE57716.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli
           CNPAF512]
          Length = 559

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/555 (58%), Positives = 399/555 (71%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            +IAI QLNP VGD+ GN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +FI+
Sbjct: 11  FRIAIGQLNPTVGDVTGNLAKAREARADAAREGAHLLVLTELFISGYPPEDLVLKPAFIR 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+++L +DT DGG G+++GFPRQD+ G  NSV +LD G +IAVRDK++LPNY EF 
Sbjct: 71  ACWKAVESLAADTVDGGPGVIIGFPRQDENGRYNSVAVLDGGKVIAVRDKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    PI FR IRLGI ICEDIW    +C+ L + GAE L S N SPYY  K+
Sbjct: 131 EKRVFHQGAMPGPINFRGIRLGIPICEDIWGELGVCETLAESGAEILLSPNGSPYYRGKV 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     +T 
Sbjct: 191 DIRHQVVLKQVIETGLPLIYAAQLGGQDELVFDGASFAFNADKSLAFQMSEFETALAVTT 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   +  S W+      A    IP + EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 WKRGE--SGWHCAEGPMAR---IP-EGEEADYRACLLGFRDYVNKNGFKTVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI   V  F S
Sbjct: 305 SAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEQPVTGFSS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S   +   SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALSDLFEGTDSGITEENLQSRARGVILMAISNKFGAMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ L+ WRN +   S LGP  EVIP +I++K+PSAELRP Q DQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYALSRWRNENVPPSALGPSGEVIPQNIIDKAPSAELRPDQKDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VE E +        +D  TV  VEHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|209549596|ref|YP_002281513.1| NAD synthetase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535352|gb|ACI55287.1| NAD+ synthetase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 559

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/555 (57%), Positives = 400/555 (72%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            +IAI QLNP+VGD+AGN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +FI+
Sbjct: 11  FRIAIGQLNPMVGDVAGNLAKAREARADAAREGAHLLVLTELFISGYPPEDLVLKPAFIR 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+++L +DT DGG G+++GFPRQDQ G  NSV +LD G +IAVRDKI+LPNY EF 
Sbjct: 71  ACWKAVESLAADTADGGPGVLIGFPRQDQTGRYNSVAVLDGGKVIAVRDKIDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +R+GI ICEDIW    +C+ L + GAE L S N SPYY  K+
Sbjct: 131 EKRVFNQGAMPGPVNFRGVRIGIPICEDIWGELGVCETLAESGAEILLSPNGSPYYRGKV 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++V  Q+    LP++Y  Q+GGQDEL+FDGASF F+  + LAFQM  F     +T 
Sbjct: 191 DIRHQVVLKQVIETGLPLVYAAQLGGQDELVFDGASFAFNADKSLAFQMSQFETALAVTT 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   +  + W+      A   +IP + EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 WK--RGGAGWHCAEGPMA---HIP-EGEEADYRACLLGFRDYVNKNGFKTVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+C AIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI   V  F S
Sbjct: 305 SAICTAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEQPVTGFSS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S       SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALSDLFAGTESGITEENLQSRARGVILMAISNKFGAMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ LA WRN +   S LGP  EVIP +I++K+PSAELRP Q DQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYALARWRNENVPPSALGPSREVIPKNIIDKAPSAELRPDQKDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYPILDDI++ +VE E +        +D  TV  +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPILDDILECLVEKEMAVEEIVARGHDVVTVHRIEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|307318567|ref|ZP_07598001.1| NAD+ synthetase [Sinorhizobium meliloti AK83]
 gi|306895907|gb|EFN26659.1| NAD+ synthetase [Sinorhizobium meliloti AK83]
          Length = 560

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/557 (56%), Positives = 403/557 (72%), Gaps = 11/557 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP VGDIAGN+AKAR AR  A R+G DL+L TELFISGYPPEDLV K +F++
Sbjct: 11  LRIAVAQLNPTVGDIAGNVAKAREARTAAAREGADLLLLTELFISGYPPEDLVLKPAFLK 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A++ L ++T DGG G+V+GFPRQ      NSV +LD G +IA+RDK++LPNY EF 
Sbjct: 71  ACEQAVEKLAAETADGGPGVVIGFPRQAAGLRHNSVAVLDGGRVIAIRDKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F +G    P+ FR +R+GI +CEDIW +  +C+ L + GAE L S N SPYY  K+
Sbjct: 131 EKRVFDAGEMPGPVNFRGVRIGIPVCEDIWGDLGVCETLAESGAEILLSPNGSPYYRGKV 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++V  Q+    LP+IY NQ+GGQDEL+FDGASF F+  + LAFQM  F E   ++E
Sbjct: 191 DVRHQVVLRQVIETGLPMIYANQLGGQDELVFDGASFAFNADKSLAFQMSQFEEAVAVSE 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W    +     ++S +   +  IP + EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 W----KRGAGGWISANGLKSR-IP-EGEEADYRACMLGFRDYVNKNGFRNVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+C A+AVDALG+E V+T+MLPY+YTS +SL DA ACAKALGC+Y+++ I + V  F S
Sbjct: 305 SAICTALAVDALGEERVRTVMLPYRYTSRESLRDAEACAKALGCRYNIVAIEEPVEGFLS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++   +   +GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALADTFEGTEAGITEENLQSRTRGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ LA WRN       LGP  EVIP +I++K+PSAELRP QTDQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYALARWRNGTVPPGALGPSGEVIPQNIIDKAPSAELRPDQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           PYP+LDDI++ +VE E   E  +    E  + TV  +EHLLY +EYKRRQ+  G KIT K
Sbjct: 485 PYPVLDDILECLVEKEMSTEEIVARGHE--EATVHRIEHLLYIAEYKRRQSAPGVKITRK 542

Query: 542 SFGRDRLYPISNKFRDH 558
           +FGRDR YPI+N+FRD 
Sbjct: 543 NFGRDRRYPITNRFRDR 559


>gi|218663273|ref|ZP_03519203.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli
           IE4771]
          Length = 557

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/551 (57%), Positives = 398/551 (72%), Gaps = 7/551 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            +IAI QLNP VGD+AGN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +FI+
Sbjct: 11  FRIAIGQLNPTVGDVAGNLAKAREARADAAREGAHLLVLTELFISGYPPEDLVLKPAFIR 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+++L +DT DGG G+V+GFPRQD+ G  NSV +LD G ++AVRDK++LPNY EF 
Sbjct: 71  ACWKAVESLAADTADGGPGVVIGFPRQDETGRYNSVAVLDGGKVVAVRDKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI ICEDIW    +C+ L + GAE L S N SPYY  K+
Sbjct: 131 EKRVFHQGAMPGPVNFRGVRLGIPICEDIWGELGVCETLAESGAEILLSPNGSPYYRGKV 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     +T 
Sbjct: 191 DIRHQVVLKQVIETGLPLIYAAQLGGQDELVFDGASFAFNADRSLAFQMSEFETALAVTT 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   +  S W+      A    IP ++EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 WKRGE--SGWHCAEGPMAR---IP-EDEEADYRACLLGFRDYVNKNGFKTVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI   V  F S
Sbjct: 305 SAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEQPVTGFSS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S   +   SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALSDLFEGTESGITEENLQSRARGVILMAISNKFGAMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ LA WRN +   S LGP  EVIP +I++K+PSAELRP Q DQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYALARWRNENVPPSALGPSGEVIPQNIIDKAPSAELRPDQKDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VE E +        +D  TV  VEHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNK 554
           GRDR YPI+N+
Sbjct: 545 GRDRRYPITNR 555


>gi|116252435|ref|YP_768273.1| NAD synthetase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257083|emb|CAK08177.1| putative glutamine-dependent nad(+) synthetase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 559

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/555 (56%), Positives = 399/555 (71%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            +IAI QLNP VGD+AGN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +FI+
Sbjct: 11  FRIAIGQLNPTVGDVAGNLAKAREARADAAREGAHLLVLTELFISGYPPEDLVLKPAFIR 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+++L ++T DGG G+++GFPRQD  G  NSV +LD G +IAVRDKI+LPNY EF 
Sbjct: 71  ACWKAVESLAAETADGGPGVIIGFPRQDDTGRYNSVAVLDGGKVIAVRDKIDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +R+GI ICEDIW +  +C+ L + GAE L S N SPYY  K+
Sbjct: 131 EKRVFDQGAMPGPVNFRGVRIGIPICEDIWGDLGVCETLAESGAEILLSPNGSPYYRGKV 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     +T 
Sbjct: 191 DIRHQVVLRQVIETGLPLIYAAQLGGQDELVFDGASFAFNADKSLAFQMSQFETALAVTT 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W      S W+      A   +IP + EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 WKRGD--SGWHCAEGPMA---HIP-ESEEADYRACLLGFRDYVNKNGFKTVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CA+ALGC+YD++PI   V  F S
Sbjct: 305 SAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCARALGCRYDIVPIEQPVTGFSS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++   +   SGI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALASLFEGTDSGITEENLQSRARGVILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ L+ WRN +     LGP  EVIP +I++K+PSAELRP Q DQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYALSRWRNENVPPGALGPSGEVIPQNIIDKAPSAELRPDQKDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VE E +        +D  TV  VEHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|222086207|ref|YP_002544739.1| NAD(+) synthase (glutamine-hydrolysing) protein [Agrobacterium
           radiobacter K84]
 gi|221723655|gb|ACM26811.1| NAD(+) synthase (glutamine-hydrolysing) protein [Agrobacterium
           radiobacter K84]
          Length = 559

 Score =  637 bits (1642), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 310/559 (55%), Positives = 403/559 (72%), Gaps = 7/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           + + ++IA+AQLNP VGD++GN+ KAR AR EA R+G  L+LFTELFISGYPPEDLV K 
Sbjct: 7   ITQTIRIAVAQLNPTVGDVSGNLVKAREARAEAAREGAQLVLFTELFISGYPPEDLVLKP 66

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +FI+AC  A+++L +DT DGG G+++GFPRQD+ G  NSV ++D G +I +RDK++LPNY
Sbjct: 67  AFIRACWKAVESLAADTADGGPGVIIGFPRQDETGRYNSVAVIDGGKVIFIRDKVDLPNY 126

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
            EF EKR F  G    P+ FR +R+GI ICE+IW +  IC+ L + GAE L   N SPYY
Sbjct: 127 GEFDEKRVFDEGTIAGPVNFRGVRIGIPICEEIWNDLGICETLAESGAEILLVPNGSPYY 186

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K+  R+++V  Q+    LP+++  QVGGQDE +FDGASF F+  + LAFQM  F    
Sbjct: 187 RGKVDVRYQVVLRQVIESGLPLVFAAQVGGQDEYVFDGASFAFNADKSLAFQMSQFETAL 246

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T W   +    W+      A   +IP + EEADY AC+L  RDYV KN F  V++GLS
Sbjct: 247 AVTTWK--KNGDGWHCSEGPMA---HIP-EGEEADYRACLLGFRDYVNKNGFKSVVLGLS 300

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI + V 
Sbjct: 301 GGIDSAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEEPVT 360

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F S ++   +   SGI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYG
Sbjct: 361 GFTSALADLFEGTESGITEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYG 420

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNP+KDLYK QV+ L+ WRN H     LGP  EVIP +I++K+PSAELRP+QTDQ
Sbjct: 421 DMNGGFNPIKDLYKMQVYALSRWRNLHVPPGALGPSGEVIPYNIIDKAPSAELRPNQTDQ 480

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPYP LDDI++ +VE E +        +D  TV  +EHLLY +EYKRRQ+  G +IT
Sbjct: 481 DSLPPYPALDDILECLVEKEMAVDEIVARGHDVATVHRIEHLLYLAEYKRRQSAPGVRIT 540

Query: 540 AKSFGRDRLYPISNKFRDH 558
            K+FGRDR YPI+N+FRD 
Sbjct: 541 TKNFGRDRRYPITNRFRDR 559


>gi|325293042|ref|YP_004278906.1| NH3-dependent NAD synthetase [Agrobacterium sp. H13-3]
 gi|325060895|gb|ADY64586.1| NH3-dependent NAD synthetase [Agrobacterium sp. H13-3]
          Length = 559

 Score =  634 bits (1634), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 313/555 (56%), Positives = 401/555 (72%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+ Q NP VGD+AGN+A+AR AR +A  QG DL+L TELFISGYPPEDLV K +F++
Sbjct: 11  LRIAVGQFNPTVGDVAGNLARAREARADAATQGADLLLLTELFISGYPPEDLVLKPAFLK 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A++ L ++T DGG G+V+GFPRQ + G  NSV +LD G IIA+RDKI+LPNY EF 
Sbjct: 71  ACLKAVEELAAETADGGPGVVIGFPRQGETGRHNSVALLDGGKIIALRDKIDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G  + P  FR +R+GI ICE+IW +  +C+ L + GAE L   N SPYY  KL
Sbjct: 131 EKRVFAEGSISGPYNFRGVRIGIPICEEIWNDMGVCETLAESGAEILLVPNGSPYYRGKL 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++   Q+    LP+++ NQ+GGQDEL+FDGASF F+  + LAFQM  F     +T+
Sbjct: 191 DVRHQVALKQVIESGLPLVFANQLGGQDELVFDGASFGFNADKTLAFQMSQFEATLAVTD 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   +    W     +S     IP + EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 WK--RTAEGWRC---ESGPFSKIP-EGEEADYRACMLGFRDYVNKNGFKSVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+AVDALG+E V+ IMLPY+YTS  SL+DAA CA+ALGC+YD++PI + V+ F S
Sbjct: 305 SAICAALAVDALGEERVRCIMLPYRYTSEDSLKDAADCARALGCRYDIVPIAEPVDGFLS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S+  +    GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALSEMFEGTEEGITEENLQSRTRGTILMAVSNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ ++SWRNSH     LGP  EVIP +I+ K+PSAELRP+QTDQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYAISSWRNSHVPPGALGPSGEVIPANIISKAPSAELRPNQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VE E S        +D  TV  +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVEKEMSVEEILARGHDIATVHRIEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|15888965|ref|NP_354646.1| NAD synthetase [Agrobacterium tumefaciens str. C58]
 gi|15156746|gb|AAK87431.1| NAD (+) synthetase [Agrobacterium tumefaciens str. C58]
          Length = 559

 Score =  634 bits (1634), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 314/555 (56%), Positives = 402/555 (72%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+ Q NP VGD+AGN+A+AR AR +A  QG DL+L TELFISGYPPEDLV K +F++
Sbjct: 11  LRIAVGQFNPTVGDVAGNLARAREARADAATQGADLLLLTELFISGYPPEDLVLKPAFLK 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A++ L ++T DGG G+V+GFPRQ + G  NSV +LD G IIA+RDKI+LPNY EF 
Sbjct: 71  ACLKAVEELAAETADGGPGVVIGFPRQGETGRHNSVALLDGGKIIALRDKIDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G  + P  FR +R+GI ICE+IW +  +C+ L + GAE L   N SPYY  KL
Sbjct: 131 EKRVFEEGSISGPYNFRGVRIGIPICEEIWNDMGVCETLAESGAEILLVPNGSPYYRGKL 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++   Q+    LP+++ NQ+GGQDEL+FDGASF F+  + LAFQM  F     +T+
Sbjct: 191 DVRHQVALRQVIESGLPLVFANQLGGQDELVFDGASFGFNADKTLAFQMSQFEATLAVTD 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   +    W+    DS     IP + EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 WK--RTADGWHC---DSGPFSKIP-EGEEADYRACMLGFRDYVNKNGFKSVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+AVDALG+E V+ IMLPY+YTS +SL+DAA CA+ALGC+YD++PI + V  F S
Sbjct: 305 SAICAALAVDALGEERVRCIMLPYRYTSEESLKDAADCARALGCRYDIVPIVEPVEGFLS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S+  +    GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALSELFEGTEEGITEENLQSRTRGTILMAVSNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ ++SWRN+H     LGP  EVIP +I+ K+PSAELRP+QTDQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYAISSWRNAHVPPGALGPSGEVIPANIIAKAPSAELRPNQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VE E S        +D  TV  VEHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVEKEMSVEEILARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|163759637|ref|ZP_02166722.1| putative glutamine-dependent NAD(+) synthetase [Hoeflea
           phototrophica DFL-43]
 gi|162283234|gb|EDQ33520.1| putative glutamine-dependent NAD(+) synthetase [Hoeflea
           phototrophica DFL-43]
          Length = 562

 Score =  631 bits (1627), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 300/557 (53%), Positives = 386/557 (69%), Gaps = 10/557 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP VGD+AGN+AKAR AR +A+R G D++LFTELFI GYPPEDLV K + I+
Sbjct: 13  LRIAVAQLNPTVGDVAGNLAKAREARADAHRHGADIVLFTELFIVGYPPEDLVLKPALIR 72

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           +C  A++ L +DT DGG  +++G+PR D     NSV +LD G ++  RDK++LPNY EF 
Sbjct: 73  SCLKAVNELAADTADGGPAVIIGYPRSDDGKRHNSVAVLDGGKLVTSRDKVDLPNYGEFD 132

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+  R +RLGI ICEDIW +  +C+ L + GAE L   N SPYY  K+
Sbjct: 133 EKRVFDVGEMPGPVAIRGVRLGIPICEDIWGDLGVCETLAESGAEILLVPNGSPYYRGKV 192

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++V  Q+    LP+++ NQVGGQDEL+FDGASF  +  + L FQM  F E   +  
Sbjct: 193 DVRHQVVLRQVIESGLPMVFANQVGGQDELVFDGASFAMNADKSLGFQMSQFEETVSIVT 252

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           +   Q    W          M +  + EEADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 253 FKR-QDDGTWRC----KPGPMSVVPEGEEADYRACMLGLRDYVNKNGFRNVVLGLSGGID 307

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SALCAA+AVDALG+E V+T+MLPY+YTS  S  DA ACA+ALGC YD + I + V  F S
Sbjct: 308 SALCAALAVDALGEERVRTVMLPYRYTSESSFTDAEACARALGCHYDTVAIEEPVQGFLS 367

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            + +  +    GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 368 ALGEMFEGTDEGITEENLQSRARGVILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 427

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ L+ WRN+H     LGP  EVIP +I+ K+PSAELRP QTDQ+SLP
Sbjct: 428 GFNPIKDLYKLQVYALSRWRNAHVPPGALGPSGEVIPVNIINKAPSAELRPDQTDQDSLP 487

Query: 485 PYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           PY +LDDI++ +VE+E   E  +    +    TV  +EHLLY +EYKRRQ+  G KIT K
Sbjct: 488 PYEVLDDILECLVEHEMGVEEIVARGHDI--ATVHRIEHLLYIAEYKRRQSAPGVKITRK 545

Query: 542 SFGRDRLYPISNKFRDH 558
           +FGRDR YPI+N++RD 
Sbjct: 546 NFGRDRRYPITNRYRDR 562


>gi|239831980|ref|ZP_04680309.1| NAD+ synthetase [Ochrobactrum intermedium LMG 3301]
 gi|239824247|gb|EEQ95815.1| NAD+ synthetase [Ochrobactrum intermedium LMG 3301]
          Length = 561

 Score =  625 bits (1611), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 310/558 (55%), Positives = 398/558 (71%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L  L+IA+AQLNPV+GDIAGN+AKAR AR EA R   DLILFTELFISGYPPEDLV K S
Sbjct: 10  LAMLRIAVAQLNPVMGDIAGNLAKARAARAEAARMQADLILFTELFISGYPPEDLVLKPS 69

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC  A+  L +DT DGG G+++G P   + G+ NS+ +LD G +IA R K++LPNY 
Sbjct: 70  FLAACEKAVRDLANDTADGGPGVIIGTPLSRESGLHNSIAVLDGGEVIAERFKVDLPNYG 129

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F SG    P+ FR +R+GI ICEDIW    + + L + GAE L   N SPY+ 
Sbjct: 130 EFDEKRVFQSGPMPGPVNFRGVRIGIPICEDIWGELGVAETLAESGAEILLVPNGSPYHR 189

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+ +RH++V  Q+    LP++Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  
Sbjct: 190 AKMDRRHQVVLKQVIETELPMVYANQVGGQDELVFDGGSFAFNADRSLCLQMPQFAEQIV 249

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +T WH +     W     + A    +P +  EADY+AC+L LRDYV KN F  V++GLSG
Sbjct: 250 LTVWHRNND--GWRCEEGEKAD---LP-EGLEADYSACMLGLRDYVNKNGFKDVVLGLSG 303

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+ VDALGK+ V+ IMLPY+YTS +SL+DAA CAKALG +YD++PI   V  
Sbjct: 304 GIDSAICAALGVDALGKDRVRCIMLPYRYTSDESLKDAADCAKALGVRYDIVPIAAPVEG 363

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F   +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 364 FLEALYPLFSGTESGVTEENLQSRARGTILMAVSNKFGSMVVTTGNKSEMSVGYATLYGD 423

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YK QV+ ++ WRN+H  T  LGP  EVIP +I+ K+PSAELR +QTDQ+
Sbjct: 424 MNGGFNPIKDVYKMQVYAMSEWRNNHVPTGALGPSGEVIPQNIISKAPSAELRENQTDQD 483

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VENE S      + ++ ETV+ +EHLLY +EYKRRQ+  G KIT 
Sbjct: 484 SLPPYPVLDDILECLVENEMSNTEIAARGHSLETVQRIEHLLYLAEYKRRQSAPGVKITK 543

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 544 KNFGRDRRYPITNRFRDR 561


>gi|260463957|ref|ZP_05812153.1| NAD+ synthetase [Mesorhizobium opportunistum WSM2075]
 gi|259030332|gb|EEW31612.1| NAD+ synthetase [Mesorhizobium opportunistum WSM2075]
          Length = 558

 Score =  624 bits (1609), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 311/563 (55%), Positives = 395/563 (70%), Gaps = 16/563 (2%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L  L+IAIAQLNP VGD+AGN+AKAR AR +A RQG DL+L+TELF++GYPPEDLV K +
Sbjct: 5   LDILRIAIAQLNPTVGDVAGNLAKAREARADAARQGADLVLYTELFLAGYPPEDLVLKPA 64

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++AC  A     +DT DGG G+++G P + + G  NS+V  D G IIA R K++LPNY 
Sbjct: 65  FLKACEKAAQDFAADTADGGPGVIIGTPLKRKSGTHNSIVFADGGKIIAERYKLDLPNYG 124

Query: 122 EFHEKRTFISGYS-NDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           EF EKR F +G     P+ FR +RLGI ICEDIW    IC+ L + GAE L   N SPYY
Sbjct: 125 EFDEKRVFQAGPEIQGPVNFRGVRLGIPICEDIWGEVGICETLAESGAEILLVPNGSPYY 184

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K+  RH++V  Q+    LPIIY NQ+GGQDELIFDGASF     + LAFQM  F +  
Sbjct: 185 RAKIDVRHQVVIRQVIECGLPIIYANQLGGQDELIFDGASFAIGADKTLAFQMSQFEDAV 244

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPL----QEEEADYNACVLSLRDYVQKNNFHKVI 296
            +T W            +DD  +    P+    + EEADY AC+L LRDYV KN F  V+
Sbjct: 245 DVTTWK----------RTDDGWACAEGPMSKIPEREEADYRACMLGLRDYVNKNGFKNVV 294

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSA+CAA+AVDALG+E ++ +M+PY+YTS  SL+DA  CA+ALGC+YD++PI 
Sbjct: 295 LGLSGGIDSAICAALAVDALGEERLRAVMMPYRYTSKDSLKDAEDCARALGCRYDIVPIF 354

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
           + V  F   ++Q  +    GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY 
Sbjct: 355 EPVEGFLHALTQLFEGTKEGITEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYA 414

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGFNP+KDLYK QV+ L+ WRNSH     LGP  EVIP +I++K+PSAELR +
Sbjct: 415 TLYGDMNGGFNPIKDLYKMQVYALSRWRNSHVPPGALGPSGEVIPKNIIDKAPSAELREN 474

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFINNDQEYNDE-TVRYVEHLLYGSEYKRRQAPVG 535
           QTDQ+SLPPYP+LDDI++ +VENE    +     +D  TV  +EHLLY +EYKRRQA  G
Sbjct: 475 QTDQDSLPPYPVLDDILECLVENEMGVDDIVARGHDRATVTRIEHLLYIAEYKRRQAAPG 534

Query: 536 TKITAKSFGRDRLYPISNKFRDH 558
            KIT K+FGRDR YPI+N+FRD 
Sbjct: 535 VKITRKNFGRDRRYPITNRFRDR 557


>gi|153009427|ref|YP_001370642.1| NAD synthetase [Ochrobactrum anthropi ATCC 49188]
 gi|151561315|gb|ABS14813.1| NAD+ synthetase [Ochrobactrum anthropi ATCC 49188]
          Length = 559

 Score =  622 bits (1605), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 307/558 (55%), Positives = 394/558 (70%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L  L+IA+AQLNP++GDIAGN+ KAR AR EA R   DLILFTELFISGYPPEDLV K S
Sbjct: 8   LAMLRIAVAQLNPIMGDIAGNLTKARAARAEAARMKADLILFTELFISGYPPEDLVLKPS 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC  A+  L SDT DGG G+++G P   + G+ NS+ +LD G IIA R K++LPNY 
Sbjct: 68  FLAACEKAVRALASDTADGGPGVIIGTPLSRESGLHNSIAVLDGGEIIAERFKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F +G    P+ FR +R+GI ICEDIW    + + L + GAE L   N SPY+ 
Sbjct: 128 EFDEKRVFQAGPMPGPVNFRGVRIGIPICEDIWGELGVAETLAESGAEILLVPNGSPYHR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+ +RH++V  Q+    LP++Y NQVGGQDEL+FDG SF F+  + L  Q+  F EQ  
Sbjct: 188 AKMDRRHQVVLKQVIETELPMVYANQVGGQDELVFDGGSFAFNTDRSLCLQLPQFEEQIT 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +T W  +     W     + A    I  +  EADY+AC+L LRDYV KN F  V++GLSG
Sbjct: 248 LTVWRREND--GWRCEEGEKA----ILPEGLEADYSACMLGLRDYVNKNGFKDVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+ VDALGK+ V+ IMLPY+YTS +SL+DAA CAKALG +YD++PI   V  
Sbjct: 302 GIDSAICAALGVDALGKDRVRCIMLPYRYTSDESLKDAADCAKALGVRYDIVPISAPVEG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F   +    +   SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 362 FLEALHPLFEGTESGVTEENLQSRARGTILMAVSNKFGSMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YK QV+ ++ WRNSH     LGP  EVIP +I+ K+PSAELR +QTDQ+
Sbjct: 422 MNGGFNPIKDVYKMQVYAMSEWRNSHVPNGALGPSGEVIPHNIISKAPSAELRENQTDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VENE S     ++ +  ETV+ +EHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVENEMSNTEIAERGHPLETVQRIEHLLYLAEYKRRQSAPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|319783805|ref|YP_004143281.1| NAD+ synthetase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169693|gb|ADV13231.1| NAD+ synthetase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 558

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 311/559 (55%), Positives = 398/559 (71%), Gaps = 8/559 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L  L+IA+AQLNP VGDI+GN+AKAR AR +A RQG DL+L+TELF++GYPPEDLV K +
Sbjct: 5   LDILRIAVAQLNPTVGDISGNLAKAREARADAARQGADLVLYTELFLAGYPPEDLVLKPA 64

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++AC  A     +DT DGG G+++G P + + G  NS++  D G IIA R K++LPNY 
Sbjct: 65  FLKACEKAAQDFAADTADGGPGVIIGTPLKRKSGTHNSIIFADGGKIIAERYKLDLPNYG 124

Query: 122 EFHEKRTFISGYS-NDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           EF EKR F +G     P+ FR +R+GI ICEDIW + +IC+ L + GAE L   N SPYY
Sbjct: 125 EFDEKRVFQAGPEIQGPVNFRGVRIGIPICEDIWGDVDICETLAESGAEILLVPNGSPYY 184

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K+  RH++V  Q+    LP+IY NQ+GGQDELIFDGASF     + LAFQM  F E  
Sbjct: 185 RAKIDVRHQVVIRQVIECGLPMIYANQLGGQDELIFDGASFAIGADKTLAFQMSQFEEAV 244

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T W   +Q   W   S+   S   IP   EEADY AC+L LRDYV KN F  V++GLS
Sbjct: 245 DVTTWK--RQGDHW-VCSEGPMSK--IP-DREEADYRACMLGLRDYVNKNGFKNVVLGLS 298

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+CAA+AVDALG+E ++ +M+PY+YTS  SL+DA  CA+ALGC+YD++PI + V 
Sbjct: 299 GGIDSAICAALAVDALGEERLRAVMMPYRYTSKDSLKDAEDCARALGCRYDIVPIFEPVE 358

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++Q  +    GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYG
Sbjct: 359 GFLHALTQMFEGTKEGITEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYG 418

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNP+KDLYK QV+ L+ WRNSH     LGP  EVIP +I++K+PSAELR +QTDQ
Sbjct: 419 DMNGGFNPIKDLYKMQVYALSRWRNSHVPPGALGPSGEVIPKNIIDKAPSAELRENQTDQ 478

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDE-TVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPYP+LDDI++ +VENE    +     +D  TV  +EHLLY +EYKRRQA  G KIT
Sbjct: 479 DSLPPYPVLDDILECLVENEMGVDDIVARGHDRATVTRIEHLLYIAEYKRRQAAPGVKIT 538

Query: 540 AKSFGRDRLYPISNKFRDH 558
            K+FGRDR YPI+N+FRD 
Sbjct: 539 KKNFGRDRRYPITNRFRDR 557


>gi|13470971|ref|NP_102540.1| NAD synthetase [Mesorhizobium loti MAFF303099]
 gi|14021714|dbj|BAB48326.1| NH3-dependent NAD synthetase [Mesorhizobium loti MAFF303099]
          Length = 558

 Score =  619 bits (1595), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 312/563 (55%), Positives = 398/563 (70%), Gaps = 11/563 (1%)

Query: 1   MLKK---LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           M KK   L+IAIAQLNP VGD+AGN+AKAR AR +A RQG DL+L+TELF++GYPPEDLV
Sbjct: 1   MTKKPDILRIAIAQLNPTVGDVAGNLAKAREARADAARQGADLVLYTELFLAGYPPEDLV 60

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
            K +F++AC  A     +DT DGG G+++G P + + G  NS+++ D G IIA R K++L
Sbjct: 61  LKPAFLKACEKAAQEFAADTSDGGPGVIIGTPLKRKSGTHNSIIVADGGKIIAERYKLDL 120

Query: 118 PNYSEFHEKRTFISGYS-NDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           PNY EF EKR F +G     P+ FR +R+GI ICEDIW +  IC+ L + GAE L   N 
Sbjct: 121 PNYGEFDEKRVFQAGPEIQGPVNFRGVRIGIPICEDIWGDVGICESLAESGAEILLVPNG 180

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPYY  K+  R+++V  QI    LPI Y NQ+GGQDELIFDGASF     + LAFQM  F
Sbjct: 181 SPYYRAKIDVRYQVVIRQIIECGLPITYANQLGGQDELIFDGASFAIGADKTLAFQMSQF 240

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E   +  W   +    W   S+   S   IP + EEADY AC+L LRDYV KN F  V+
Sbjct: 241 EEAVDVVTWKRGE--DGW-VCSEGPMSK--IP-EREEADYRACMLGLRDYVNKNGFKNVV 294

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSA+CAA+AVDALG+E ++ +M+PY+YTS  SL+DA  CA+ALGC+YD++PI 
Sbjct: 295 LGLSGGIDSAICAALAVDALGEERLRAVMMPYRYTSKDSLKDAEDCARALGCRYDIVPIF 354

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
           + V  F   ++Q  +    GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY 
Sbjct: 355 EPVEGFLHALTQLFEGTKEGITEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYA 414

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGFNP+KDLYK QV+ L+ WRNSH     LGP  EVIP +I++K+PSAELR +
Sbjct: 415 TLYGDMNGGFNPIKDLYKMQVYALSRWRNSHVPPGALGPSGEVIPKNIIDKAPSAELREN 474

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFINNDQEYNDE-TVRYVEHLLYGSEYKRRQAPVG 535
           QTDQ+SLPPYP+LDDI++ +VENE    +     +D  TV  +EHLLY +EYKRRQA  G
Sbjct: 475 QTDQDSLPPYPVLDDILECLVENEMGVDDIVARGHDRATVTRIEHLLYIAEYKRRQAAPG 534

Query: 536 TKITAKSFGRDRLYPISNKFRDH 558
            KIT K+FGRDR YPI+N+FRD 
Sbjct: 535 VKITRKNFGRDRRYPITNRFRDR 557


>gi|306843889|ref|ZP_07476484.1| NAD+ synthetase [Brucella sp. BO1]
 gi|306275644|gb|EFM57368.1| NAD+ synthetase [Brucella sp. BO1]
          Length = 559

 Score =  617 bits (1590), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 307/558 (55%), Positives = 391/558 (70%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L  L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +
Sbjct: 8   LTMLRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY 
Sbjct: 68  FVAACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+ 
Sbjct: 128 EFDEKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+ +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  
Sbjct: 188 AKMDRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +TEW  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSG
Sbjct: 248 LTEWQRDG--GGWRCGDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CA+ALG +YD++PI + V  
Sbjct: 302 GIDSAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCARALGVRYDIVPIAEPVEG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F + +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 362 FMNALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YK QV+ L+ WRN H     LGP  EVIP +I+ K+PSAELR +QTDQ+
Sbjct: 422 MNGGFNPIKDVYKMQVYALSQWRNHHLPQGALGPAGEVIPQNIISKAPSAELRENQTDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|261214001|ref|ZP_05928282.1| NAD+ synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|260915608|gb|EEX82469.1| NAD+ synthetase [Brucella abortus bv. 3 str. Tulya]
          Length = 559

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 307/558 (55%), Positives = 392/558 (70%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L  L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +
Sbjct: 8   LTMLRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY 
Sbjct: 68  FVAACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+ 
Sbjct: 128 EFDEKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+ +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM+ F+EQ  
Sbjct: 188 AKMDRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMQQFAEQIA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +TEW  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSG
Sbjct: 248 LTEWQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  
Sbjct: 302 GIDSAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F + +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 362 FMNALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+
Sbjct: 422 MNGGFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|261317648|ref|ZP_05956845.1| NAD+ synthetase [Brucella pinnipedialis B2/94]
 gi|265988683|ref|ZP_06101240.1| NAD+ synthetase [Brucella pinnipedialis M292/94/1]
 gi|261296871|gb|EEY00368.1| NAD+ synthetase [Brucella pinnipedialis B2/94]
 gi|264660880|gb|EEZ31141.1| NAD+ synthetase [Brucella pinnipedialis M292/94/1]
          Length = 559

 Score =  616 bits (1588), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 307/558 (55%), Positives = 392/558 (70%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L  L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +
Sbjct: 8   LTMLRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY 
Sbjct: 68  FVAACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+ FR +RLGI +CEDIW   ++ + L + GAE L   N SPY+ 
Sbjct: 128 EFDEKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELDVAETLAESGAEILLVPNGSPYHR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+ +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  
Sbjct: 188 AKMDRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +TEW  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSG
Sbjct: 248 LTEWQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  
Sbjct: 302 GIDSAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F + +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 362 FMNALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+
Sbjct: 422 MNGGFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|17987252|ref|NP_539886.1| NAD synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|225852520|ref|YP_002732753.1| NAD synthetase [Brucella melitensis ATCC 23457]
 gi|260564019|ref|ZP_05834505.1| NAD+ synthase [Brucella melitensis bv. 1 str. 16M]
 gi|265991097|ref|ZP_06103654.1| NAD+ synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265999470|ref|ZP_05466523.2| NAD(+) synthase [Brucella melitensis bv. 2 str. 63/9]
 gi|17982927|gb|AAL52150.1| glutamine-dependent nad(+) synthetase [Brucella melitensis bv. 1
           str. 16M]
 gi|225640885|gb|ACO00799.1| NAD+ synthetase [Brucella melitensis ATCC 23457]
 gi|260154035|gb|EEW89127.1| NAD+ synthase [Brucella melitensis bv. 1 str. 16M]
 gi|263001881|gb|EEZ14456.1| NAD+ synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094135|gb|EEZ18057.1| NAD(+) synthase [Brucella melitensis bv. 2 str. 63/9]
 gi|326538745|gb|ADZ86960.1| NAD+ synthetase [Brucella melitensis M5-90]
          Length = 559

 Score =  615 bits (1587), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 307/558 (55%), Positives = 391/558 (70%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L  L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +
Sbjct: 8   LTMLRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY 
Sbjct: 68  FVAACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+ 
Sbjct: 128 EFDEKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+ +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  
Sbjct: 188 AKMDRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +TEW  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSG
Sbjct: 248 LTEWQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  
Sbjct: 302 GIDSAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F + +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 362 FMNALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+
Sbjct: 422 MNGGFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|161618967|ref|YP_001592854.1| NAD synthetase [Brucella canis ATCC 23365]
 gi|163843283|ref|YP_001627687.1| NAD synthetase [Brucella suis ATCC 23445]
 gi|225627493|ref|ZP_03785530.1| NAD+ synthetase [Brucella ceti str. Cudo]
 gi|260566446|ref|ZP_05836916.1| NAD+ synthase [Brucella suis bv. 4 str. 40]
 gi|261218645|ref|ZP_05932926.1| NAD+ synthetase [Brucella ceti M13/05/1]
 gi|261222183|ref|ZP_05936464.1| NAD+ synthetase [Brucella ceti B1/94]
 gi|261314259|ref|ZP_05953456.1| NAD+ synthetase [Brucella pinnipedialis M163/99/10]
 gi|261321857|ref|ZP_05961054.1| NAD+ synthetase [Brucella ceti M644/93/1]
 gi|261752317|ref|ZP_05996026.1| NAD+ synthetase [Brucella suis bv. 5 str. 513]
 gi|261754975|ref|ZP_05998684.1| NAD+ synthetase [Brucella suis bv. 3 str. 686]
 gi|261758202|ref|ZP_06001911.1| NAD(+) synthase [Brucella sp. F5/99]
 gi|265998147|ref|ZP_06110704.1| NAD+ synthetase [Brucella ceti M490/95/1]
 gi|294852395|ref|ZP_06793068.1| NAD+ synthase [Brucella sp. NVSL 07-0026]
 gi|161335778|gb|ABX62083.1| NAD+ synthetase [Brucella canis ATCC 23365]
 gi|163674006|gb|ABY38117.1| NAD+ synthetase [Brucella suis ATCC 23445]
 gi|225617498|gb|EEH14543.1| NAD+ synthetase [Brucella ceti str. Cudo]
 gi|260155964|gb|EEW91044.1| NAD+ synthase [Brucella suis bv. 4 str. 40]
 gi|260920767|gb|EEX87420.1| NAD+ synthetase [Brucella ceti B1/94]
 gi|260923734|gb|EEX90302.1| NAD+ synthetase [Brucella ceti M13/05/1]
 gi|261294547|gb|EEX98043.1| NAD+ synthetase [Brucella ceti M644/93/1]
 gi|261303285|gb|EEY06782.1| NAD+ synthetase [Brucella pinnipedialis M163/99/10]
 gi|261738186|gb|EEY26182.1| NAD(+) synthase [Brucella sp. F5/99]
 gi|261742070|gb|EEY29996.1| NAD+ synthetase [Brucella suis bv. 5 str. 513]
 gi|261744728|gb|EEY32654.1| NAD+ synthetase [Brucella suis bv. 3 str. 686]
 gi|262552615|gb|EEZ08605.1| NAD+ synthetase [Brucella ceti M490/95/1]
 gi|294820984|gb|EFG37983.1| NAD+ synthase [Brucella sp. NVSL 07-0026]
          Length = 559

 Score =  615 bits (1587), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 307/558 (55%), Positives = 391/558 (70%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L  L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +
Sbjct: 8   LTMLRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY 
Sbjct: 68  FVAACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+ 
Sbjct: 128 EFDEKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+ +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  
Sbjct: 188 AKMDRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +TEW  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSG
Sbjct: 248 LTEWQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  
Sbjct: 302 GIDSAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F + +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 362 FMNALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+
Sbjct: 422 MNGGFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|254693729|ref|ZP_05155557.1| NAD synthetase [Brucella abortus bv. 3 str. Tulya]
          Length = 550

 Score =  615 bits (1586), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 306/555 (55%), Positives = 391/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM+ F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMQQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|254710099|ref|ZP_05171910.1| NAD synthetase [Brucella pinnipedialis B2/94]
 gi|256031595|ref|ZP_05445209.1| NAD synthetase [Brucella pinnipedialis M292/94/1]
          Length = 550

 Score =  615 bits (1586), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 306/555 (55%), Positives = 391/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW   ++ + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELDVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|265994934|ref|ZP_06107491.1| NAD+ synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|262766047|gb|EEZ11836.1| NAD+ synthetase [Brucella melitensis bv. 3 str. Ether]
          Length = 559

 Score =  615 bits (1585), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 307/558 (55%), Positives = 391/558 (70%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L  L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +
Sbjct: 8   LTMLRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY 
Sbjct: 68  FVAACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+ 
Sbjct: 128 EFDEKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+ +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  
Sbjct: 188 AKMDRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +TEW  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSG
Sbjct: 248 LTEWQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  
Sbjct: 302 GIDSAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F + +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 362 FMNALQPLFSGTDSGVTEENLQSRARGAILMAISNKFGSMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+
Sbjct: 422 MNGGFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|256044673|ref|ZP_05447577.1| NAD synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|326409035|gb|ADZ66100.1| NAD synthetase [Brucella melitensis M28]
          Length = 550

 Score =  615 bits (1585), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 306/555 (55%), Positives = 390/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|23501895|ref|NP_698022.1| NAD synthetase [Brucella suis 1330]
 gi|254701766|ref|ZP_05163594.1| NAD synthetase [Brucella suis bv. 5 str. 513]
 gi|254704307|ref|ZP_05166135.1| NAD synthetase [Brucella suis bv. 3 str. 686]
 gi|254706790|ref|ZP_05168618.1| NAD synthetase [Brucella pinnipedialis M163/99/10]
 gi|254714100|ref|ZP_05175911.1| NAD synthetase [Brucella ceti M644/93/1]
 gi|254716843|ref|ZP_05178654.1| NAD synthetase [Brucella ceti M13/05/1]
 gi|256159733|ref|ZP_05457480.1| NAD synthetase [Brucella ceti M490/95/1]
 gi|256254996|ref|ZP_05460532.1| NAD synthetase [Brucella ceti B1/94]
 gi|256369438|ref|YP_003106946.1| NAD(+) synthase [Brucella microti CCM 4915]
 gi|260168725|ref|ZP_05755536.1| NAD synthetase [Brucella sp. F5/99]
 gi|23347836|gb|AAN29937.1| NH(3)-dependent NAD+ synthetase [Brucella suis 1330]
 gi|255999598|gb|ACU47997.1| NAD(+) synthase [Brucella microti CCM 4915]
          Length = 550

 Score =  614 bits (1584), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 306/555 (55%), Positives = 390/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|189024180|ref|YP_001934948.1| NAD synthetase [Brucella abortus S19]
 gi|237815439|ref|ZP_04594437.1| NAD+ synthetase [Brucella abortus str. 2308 A]
 gi|260545314|ref|ZP_05821055.1| NAD+ synthetase [Brucella abortus NCTC 8038]
 gi|260754749|ref|ZP_05867097.1| NAD+ synthetase [Brucella abortus bv. 6 str. 870]
 gi|260757972|ref|ZP_05870320.1| NAD+ synthetase [Brucella abortus bv. 4 str. 292]
 gi|260761795|ref|ZP_05874138.1| NAD+ synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883770|ref|ZP_05895384.1| NAD+ synthetase [Brucella abortus bv. 9 str. C68]
 gi|297248338|ref|ZP_06932056.1| NAD+ synthase [Brucella abortus bv. 5 str. B3196]
 gi|189019752|gb|ACD72474.1| NAD(+) synthase [Brucella abortus S19]
 gi|237790276|gb|EEP64486.1| NAD+ synthetase [Brucella abortus str. 2308 A]
 gi|260096721|gb|EEW80596.1| NAD+ synthetase [Brucella abortus NCTC 8038]
 gi|260668290|gb|EEX55230.1| NAD+ synthetase [Brucella abortus bv. 4 str. 292]
 gi|260672227|gb|EEX59048.1| NAD+ synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674857|gb|EEX61678.1| NAD+ synthetase [Brucella abortus bv. 6 str. 870]
 gi|260873298|gb|EEX80367.1| NAD+ synthetase [Brucella abortus bv. 9 str. C68]
 gi|297175507|gb|EFH34854.1| NAD+ synthase [Brucella abortus bv. 5 str. B3196]
          Length = 559

 Score =  614 bits (1583), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 306/558 (54%), Positives = 391/558 (70%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L  L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +
Sbjct: 8   LTMLRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY 
Sbjct: 68  FVAACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+ 
Sbjct: 128 EFDEKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+ +RH++V  Q+    LPI+Y NQVGGQD+L+FDG SF F+  + L  QM  F+EQ  
Sbjct: 188 AKMDRRHQVVLKQVIETGLPIVYANQVGGQDDLVFDGGSFVFNADKSLCLQMPQFAEQIA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +TEW  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSG
Sbjct: 248 LTEWQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  
Sbjct: 302 GIDSAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F + +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 362 FMNALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+
Sbjct: 422 MNGGFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|265984081|ref|ZP_06096816.1| NAD+ synthetase [Brucella sp. 83/13]
 gi|306838375|ref|ZP_07471220.1| NAD+ synthetase [Brucella sp. NF 2653]
 gi|264662673|gb|EEZ32934.1| NAD+ synthetase [Brucella sp. 83/13]
 gi|306406515|gb|EFM62749.1| NAD+ synthetase [Brucella sp. NF 2653]
          Length = 559

 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 305/558 (54%), Positives = 390/558 (69%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L  L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +
Sbjct: 8   LTMLRIAVAQLNPTMGDIAGNLAKARAARSEAARMQADLILFTELFISGYPPEDMVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY 
Sbjct: 68  FVAACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+ 
Sbjct: 128 EFDEKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+ +RH++V  Q+    LPI+Y NQVGGQDEL+FDG +F F+  + L  QM  F+EQ  
Sbjct: 188 AKMDRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGTFVFNADKSLCLQMPQFAEQIA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +TEW  D     W       AS   +P +   ADY AC+L LRDYV KN F  V++GLSG
Sbjct: 248 LTEWQRDG--DGWRCGDGKKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CA+ALG +YD++PI + V  
Sbjct: 302 GIDSAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCARALGVRYDIVPIAEPVEG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F + +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 362 FMNALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+
Sbjct: 422 MNGGFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVENEMSNAEIVARGHTLETVQRIEHLLYLAEYKRRQSAPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|256113567|ref|ZP_05454387.1| NAD synthetase [Brucella melitensis bv. 3 str. Ether]
          Length = 550

 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 306/555 (55%), Positives = 390/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGAILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|148560440|ref|YP_001258955.1| NAD synthetase [Brucella ovis ATCC 25840]
 gi|148371697|gb|ABQ61676.1| NH(3)-dependent NAD+ synthetase [Brucella ovis ATCC 25840]
          Length = 550

 Score =  613 bits (1581), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 306/555 (55%), Positives = 390/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRHYPITNRFRDR 550


>gi|62289938|ref|YP_221731.1| NAD synthetase [Brucella abortus bv. 1 str. 9-941]
 gi|82699865|ref|YP_414439.1| NAD synthetase [Brucella melitensis biovar Abortus 2308]
 gi|254689244|ref|ZP_05152498.1| NAD synthetase [Brucella abortus bv. 6 str. 870]
 gi|254697379|ref|ZP_05159207.1| NAD synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730277|ref|ZP_05188855.1| NAD synthetase [Brucella abortus bv. 4 str. 292]
 gi|256257494|ref|ZP_05463030.1| NAD synthetase [Brucella abortus bv. 9 str. C68]
 gi|62196070|gb|AAX74370.1| NadE, NH(3)-dependent NAD+ synthetase [Brucella abortus bv. 1 str.
           9-941]
 gi|82615966|emb|CAJ10989.1| Nitrilase/cyanide hydratase and apolipoprotein
           N-acyltransferase:NAD+ synthase [Brucella melitensis
           biovar Abortus 2308]
          Length = 550

 Score =  613 bits (1580), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 305/555 (54%), Positives = 390/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQD+L+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDDLVFDGGSFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|254719091|ref|ZP_05180902.1| NAD synthetase [Brucella sp. 83/13]
          Length = 550

 Score =  612 bits (1578), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 304/555 (54%), Positives = 389/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARAARSEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG +F F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGTFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W       AS   +P +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDG--DGWRCGDGKKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CA+ALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCARALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHTLETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|261325107|ref|ZP_05964304.1| NAD+ synthetase [Brucella neotomae 5K33]
 gi|261301087|gb|EEY04584.1| NAD+ synthetase [Brucella neotomae 5K33]
          Length = 559

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 304/558 (54%), Positives = 390/558 (69%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L  L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +
Sbjct: 8   LTMLRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC  A+  L +DT DGG G+++G P     G  N+V +LD G +IA R K++LPNY 
Sbjct: 68  FVAACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEVIAERFKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G     + FR +RLGI +CEDIW    + + L + GAE L   N SPY+ 
Sbjct: 128 EFDEKRVFEPGPMPGQVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+ +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  
Sbjct: 188 AKMDRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +TEW  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSG
Sbjct: 248 LTEWQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  
Sbjct: 302 GIDSAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F + +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 362 FMNALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+
Sbjct: 422 MNGGFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ ++ENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLIENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|256061106|ref|ZP_05451260.1| NAD synthetase [Brucella neotomae 5K33]
          Length = 550

 Score =  609 bits (1571), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 303/555 (54%), Positives = 389/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G +IA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEVIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G     + FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGQVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS   +P +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDG--DGWRCRDGEKAS---LP-EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ ++ENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLIENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|49475433|ref|YP_033474.1| NAD synthetase [Bartonella henselae str. Houston-1]
 gi|49238239|emb|CAF27449.1| NH3-dependent NAD synthetase [Bartonella henselae str. Houston-1]
          Length = 559

 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 293/559 (52%), Positives = 390/559 (69%), Gaps = 8/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    ++A+AQLNP+VGDI GN + A  A ++A  +G +L+LFTELFIS YPPEDLV K 
Sbjct: 6   MKNDFRVAVAQLNPIVGDIEGNFSLAVMAHQKAKEEGANLVLFTELFISAYPPEDLVLKP 65

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F +AC  A+  L   T  GG GIV+G P +  + + N VV+LD G I+    K +LPNY
Sbjct: 66  AFTKACEDAVKKLAKLTK-GGPGIVIGLPLRHSDNIYNGVVLLDEGRIVTESLKFDLPNY 124

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           +EF EKR F SG   +PIV+  ++LGI+ICEDIW + ++C  L  +GAE +  LN SPY+
Sbjct: 125 AEFDEKRVFSSGPRPEPIVYHGLKLGIVICEDIWNDFSLCAELANKGAEIILVLNGSPYH 184

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK+ KR E+V  Q     L I+Y NQVGGQDEL+FDG SF  +GQ ++ FQMKHF  +N
Sbjct: 185 RNKILKRIEVVRAQALQSGLSIVYANQVGGQDELVFDGGSFALNGQGKMVFQMKHF--EN 242

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +   H+ ++ + W  +S  + +     L    ADY ACVL LRDYV KN F  VI+GLS
Sbjct: 243 HIALSHWQKKTAGWQCVSGPNETL----LNGLAADYQACVLGLRDYVNKNRFQNVILGLS 298

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSALC  +AVDALG E V+T+M+PY YTS +SL+DA  CA  LGC+Y+++PI   V 
Sbjct: 299 GGIDSALCTTMAVDALGAEKVRTVMMPYHYTSQESLKDAKECAHLLGCRYEIIPIVQPVE 358

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   M+      PS +  EN+QSR+RG ILMALSN   +M++TT NKSE++VGY TLYG
Sbjct: 359 VFLKTMAPVFLGLPSDVTEENLQSRVRGVILMALSNKFGSMVVTTGNKSEMAVGYATLYG 418

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNPLKD+YKTQV+ LA WRN + + +  GP   VIPP+I+ K+PSAELR +Q D+
Sbjct: 419 DMNGGFNPLKDVYKTQVYALAQWRNQNHLQNLKGPEGVVIPPNIIAKAPSAELRENQKDE 478

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPYPILDDI++ ++E++ S  +   + Y  ETV  +EHL+YG+EYKRRQ+  G KI+
Sbjct: 479 DSLPPYPILDDILQSLIEDDMSVCDIIKRGYLRETVEKIEHLIYGAEYKRRQSAPGVKIS 538

Query: 540 AKSFGRDRLYPISNKFRDH 558
            K+FGRDR YPI N+FR++
Sbjct: 539 YKNFGRDRRYPIVNRFRNN 557


>gi|110633816|ref|YP_674024.1| NAD synthetase [Mesorhizobium sp. BNC1]
 gi|110284800|gb|ABG62859.1| NH(3)-dependent NAD(+) synthetase [Chelativorans sp. BNC1]
          Length = 572

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 307/560 (54%), Positives = 398/560 (71%), Gaps = 6/560 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            +IA+AQLNP VGDI GN+AKAR AR +A R+G DL+LFTELFI+GYPPEDLV K +F+ 
Sbjct: 12  FRIAVAQLNPTVGDIPGNLAKAREARADAARKGADLVLFTELFIAGYPPEDLVLKPAFVA 71

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L ++T DGG G+++G P + + GV N+VV+LD G +IA R K++LPNY EF 
Sbjct: 72  ACEKAVLELAAETADGGPGVIIGTPLKRESGVHNAVVVLDDGKVIAERYKLDLPNYGEFD 131

Query: 125 EKRTFISGYS-NDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
           EKR F +  S   P+ FR +R+GI ICEDIW   ++C+ L + GAE L   N SPYY  K
Sbjct: 132 EKRVFDAAPSMPGPVNFRGVRIGIPICEDIWGKLDVCETLAESGAEILLVPNGSPYYRGK 191

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
           ++ R ++V  Q+    LPI+Y N +GGQDEL+FDGASF     + LAFQM  F E   +T
Sbjct: 192 VEVRQQVVIVQVIESGLPIVYANMLGGQDELVFDGASFAIQADKSLAFQMSQFEEAVAVT 251

Query: 244 EWHYDQQLSQWNYMSDD----SASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
            W   +  +      DD    +   M I  ++EEADY AC+L LRDYV KN F  V++GL
Sbjct: 252 TWRRGRDAAGAQRGKDDEWVCAEGPMAIIPEKEEADYRACMLGLRDYVNKNGFKNVVLGL 311

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGG+DSALCAA+AVDALG+E V+ +MLPY+YTS +SL DA ACA+ALGC+YD++PI++ V
Sbjct: 312 SGGVDSALCAALAVDALGEERVRAVMLPYRYTSKESLRDAEACARALGCRYDIVPINEPV 371

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F + + Q  +    GI  EN+QSR RG +LMA+SN   +M++TT NKSE+SVGY TLY
Sbjct: 372 EGFRNALGQLFEGTEEGITEENLQSRARGTLLMAISNKFGSMVVTTGNKSEMSVGYATLY 431

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGFNP+KDLYK QV+ L  WRN+H   + LGP  EVIP SI++K+PSAELR +QTD
Sbjct: 432 GDMNGGFNPIKDLYKMQVYALCRWRNAHVPPTALGPSGEVIPASIIDKAPSAELRENQTD 491

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLPPY +LDDI++ +VENE          +D + V  +EHLLY +EYKRRQA  G KI
Sbjct: 492 QDSLPPYAVLDDILECLVENELGVDEIVARGHDRDLVHRIEHLLYVAEYKRRQAAPGVKI 551

Query: 539 TAKSFGRDRLYPISNKFRDH 558
           T K+FGRDR YPI+NKFRD 
Sbjct: 552 TKKNFGRDRRYPITNKFRDR 571


>gi|319407350|emb|CBI80995.1| NH3-dependent NAD synthetase [Bartonella sp. 1-1C]
          Length = 558

 Score =  602 bits (1552), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 296/554 (53%), Positives = 388/554 (70%), Gaps = 8/554 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            +I IAQLNPV+GDI GN   A+ A ++A  QG DL+L TELFIS YPPEDLV K SF +
Sbjct: 10  FRIVIAQLNPVIGDIGGNFTLAKMAYQKAYEQGADLVLLTELFISAYPPEDLVLKSSFTE 69

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L   T +G  GI++G P +    + N ++ILD G +IA   K +LPNY EF 
Sbjct: 70  ACEDAVRKLAQLTKEG-PGIIIGVPLKRNNNLYNGIMILDDGQVIAECFKYDLPNYCEFD 128

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F SG   +PIV+R I LG+LICEDIW + +IC +L  +GAE +   N SPY+ NK 
Sbjct: 129 EKRVFASGPRPEPIVYRGITLGVLICEDIWNDPSICANLSHKGAEIILVSNGSPYHRNKT 188

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           +KR +IV  +     +PIIY NQVGGQDEL+FDG SF  D   Q+AFQMKHF  Q  +T 
Sbjct: 189 QKRLDIVRSRAVQSCVPIIYANQVGGQDELVFDGGSFALDEHGQIAFQMKHFESQ--ITL 246

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
            H+ ++   W  +S          L    ADY+ACVL L+DYV KN F  V++G SGGID
Sbjct: 247 SHWQRKSIGWQCISGPDEKL----LDGVAADYHACVLGLKDYVNKNRFKDVLLGFSGGID 302

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SALCAAIAVDALG E V  +M+PY YTS +SL+DA  CA+ LGC+Y+++PI  LV  F S
Sbjct: 303 SALCAAIAVDALGAERVCAVMMPYYYTSQESLKDAKDCARLLGCRYEIIPIFKLVESFLS 362

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
           +M+       + +  EN+QSRIRG++LMALSN   +M++TT NKSE++VGY TLYGDM+G
Sbjct: 363 IMAPIFSGLKTDVTEENLQSRIRGSVLMALSNKFDSMVITTGNKSEMAVGYATLYGDMNG 422

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YKTQV++LA WRN + + + LGP   VIP +I+ K+PSAELR +Q D++SLP
Sbjct: 423 GFNPIKDIYKTQVYKLAEWRNKNYLQNLLGPKRIVIPNNIITKAPSAELRDNQKDEDSLP 482

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYPILDDI++ +VE++ S  +   + ++ +TV  VEHLLY +EYKRRQ+ +G KI+ K+F
Sbjct: 483 PYPILDDILQSLVEDDMSVCDILKRGHSRQTVEKVEHLLYLAEYKRRQSALGVKISYKNF 542

Query: 544 GRDRLYPISNKFRD 557
           GRDR YPI+N FRD
Sbjct: 543 GRDRRYPITNHFRD 556


>gi|319404346|emb|CBI77943.1| NH3-dependent NAD synthetase [Bartonella rochalimae ATCC BAA-1498]
          Length = 558

 Score =  600 bits (1548), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 293/554 (52%), Positives = 386/554 (69%), Gaps = 8/554 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+I IAQLNP++GDI GN + A+ A ++A  Q  DL+L TELFIS YPPEDLV K SF +
Sbjct: 10  LRIVIAQLNPIIGDIKGNFSLAKMAYQKAYEQNADLVLLTELFISAYPPEDLVLKSSFTK 69

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L   T +G  GI++G P +    + N +++LD G +I  R K +LPNY EF 
Sbjct: 70  ACEDAVRKLAQLTKEG-PGIIIGVPLKRDNSLYNGIMLLDDGQVITERFKCDLPNYCEFD 128

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F SG   +PIV+R I LG++ICEDIW + +IC  L  +GAE +   N SPYY NK+
Sbjct: 129 EKRVFSSGPRPEPIVYRGITLGVVICEDIWNDPSICAELSHKGAEIILVSNGSPYYRNKM 188

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           +KR EIV  Q     +PIIY NQVGGQDEL+FDG SF  D   Q+ FQMKHF  Q  ++ 
Sbjct: 189 QKRLEIVRAQAIQSCVPIIYANQVGGQDELVFDGGSFALDEHGQIVFQMKHFESQIALSH 248

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   ++  +W  +S  +       L    ADY+ACVL L+DYV KN F  V++G SGGID
Sbjct: 249 WQ--RKSIRWQCISGPNEEL----LDGIAADYHACVLGLKDYVNKNRFKDVLLGFSGGID 302

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SALCAAIAVDALG E V  +M+PY YTS +SL+DA  CA  LGC+Y+++PI  LV  F S
Sbjct: 303 SALCAAIAVDALGAERVHAVMMPYYYTSQESLKDAKDCAHLLGCRYEIIPIFKLVESFLS 362

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
           +M+       + +  EN+QSR+RG+ILMALSN   +M++TT NKSE++VGY TLYGDM+G
Sbjct: 363 IMAPIFSGLKADVTEENLQSRVRGSILMALSNKFDSMVITTGNKSEMAVGYATLYGDMNG 422

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YKTQV++LA WRN + + + LGP   VIP +I  K+PSAELR +Q D++SLP
Sbjct: 423 GFNPIKDIYKTQVYKLAEWRNKNYLQNLLGPKGIVIPSNITTKAPSAELRDNQKDEDSLP 482

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VE++ S  +   + ++ +TV  VEHLLY +EYKRRQ+  G KI+ K+F
Sbjct: 483 PYPVLDDILQFLVEDDMSVCDILKRGHSRQTVEKVEHLLYLAEYKRRQSAPGVKISYKNF 542

Query: 544 GRDRLYPISNKFRD 557
           GRDR YPI+N FRD
Sbjct: 543 GRDRRYPITNYFRD 556


>gi|163868125|ref|YP_001609329.1| NAD synthetase [Bartonella tribocorum CIP 105476]
 gi|161017776|emb|CAK01334.1| NH3-dependent NAD synthetase [Bartonella tribocorum CIP 105476]
          Length = 553

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 294/558 (52%), Positives = 389/558 (69%), Gaps = 8/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    ++A+AQLNP+VGDI GN + A  A ++A  +G DL+LFTELFIS YPPEDLV K 
Sbjct: 1   MKNNFRVAVAQLNPIVGDIGGNFSLAVMAHQKAKEEGADLVLFTELFISAYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F +AC  +++ L   T  GG GI++G P +    + N +++LD G +I    K +LPNY
Sbjct: 61  AFTKACEESVEKLAKITV-GGPGIIIGLPLRRNGNIYNGLMLLDEGRVITESLKFDLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           +EF EKR F  G   +PI +  I+LGI+ICEDIW +S++C  L  +GAE +  LN SPYY
Sbjct: 120 AEFDEKRLFSPGPRPEPIDYHGIKLGIVICEDIWNDSSLCAELCNKGAEMILVLNGSPYY 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK  KR E+V        +PIIY NQVGGQDEL+FDG SF  +GQ ++ FQMKHF  ++
Sbjct: 180 RNKTLKRIEVVRAHALQFGVPIIYANQVGGQDELVFDGGSFALNGQGKMVFQMKHF--ES 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            ++  H+ ++ + W+Y+S  + +     L +  ADY ACVL L+DYV KN F  VI+GLS
Sbjct: 238 HISVSHWQRKTTGWHYVSGPNENL----LTDLAADYQACVLGLKDYVNKNGFKDVILGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSALCAA+AVDALG E V+TIM+PY YTS +SL+DA  CA  LGC+Y+++PI   V 
Sbjct: 294 GGIDSALCAAMAVDALGAERVRTIMMPYHYTSQESLKDAKECADLLGCRYEIIPIAQPVE 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + M+       S +  EN+QSRIRG +LMALSN   +M++TT NKSE++VGY TLYG
Sbjct: 354 AFLNTMAPVFLGLSSDVTEENLQSRIRGTLLMALSNKFGSMVVTTGNKSEMAVGYATLYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNPLKD+YK QV+ LA WRN + +    GP   VIP +I++K+PSAELR +Q D+
Sbjct: 414 DMNGGFNPLKDIYKMQVYALADWRNKNYLHHLKGPEGIVIPSNIIKKAPSAELRENQKDE 473

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPYPILDDI++ +VEN+ S  +  Q  Y  ETV  +EHLLY +EYKRRQ+  G KI+
Sbjct: 474 DSLPPYPILDDILQSLVENDMSIGDIVQRGYLRETVEKIEHLLYAAEYKRRQSAPGVKIS 533

Query: 540 AKSFGRDRLYPISNKFRD 557
            K+FGRDR YPI N FRD
Sbjct: 534 YKNFGRDRRYPIVNHFRD 551


>gi|240850328|ref|YP_002971721.1| NH3-dependent NAD synthetase [Bartonella grahamii as4aup]
 gi|240267451|gb|ACS51039.1| NH3-dependent NAD synthetase [Bartonella grahamii as4aup]
          Length = 558

 Score =  599 bits (1544), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 295/558 (52%), Positives = 385/558 (68%), Gaps = 8/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    +++IAQLNP+VGDI GN + A  A ++A  +G DL+LFTELFIS YPPEDLV K 
Sbjct: 6   MKNDFRVSIAQLNPIVGDIEGNFSLAAMAHQKAKEEGADLVLFTELFISAYPPEDLVLKP 65

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F + C   +  L   T  GG GIV+G P +    + N V++LD G +IA   K +LPNY
Sbjct: 66  AFTKTCEETVKKLAKITV-GGPGIVIGLPLRRNGNIYNGVMLLDEGRVIAESLKFDLPNY 124

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           +EF EKR F SG   +P+++R + LGI+ICEDIW +S++C  L  +GAE +  LN SPY 
Sbjct: 125 AEFDEKRLFSSGPRPEPLIYRGVGLGIVICEDIWNDSSLCAELGNKGAEIILVLNGSPYD 184

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK  KR ++V  Q     +PIIY NQVGGQDEL+FDG SF  +G+ +  FQMKHF    
Sbjct: 185 RNKTLKRIDVVHTQALRSGVPIIYANQVGGQDELVFDGGSFALNGEGKKIFQMKHFDSHI 244

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            ++ W   +  + W+ +S  + S     L    ADY ACVL LRDYV KN F  VI+GLS
Sbjct: 245 ALSHWQ--KITTGWHCISGPNESL----LNGLAADYQACVLGLRDYVNKNRFKDVILGLS 298

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSALCAA+AVDALG E V+TIM+PY YTS +SL+DA  CA+ LGC Y+++PI   V 
Sbjct: 299 GGVDSALCAAMAVDALGSERVRTIMMPYHYTSQESLKDAKECAQLLGCHYEIIPIEQPVE 358

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + M+      PS +  EN+QSR+RG ILMALSN   +M++TT NKSE++VGY TLYG
Sbjct: 359 AFLNAMAPVFLGLPSDVTEENLQSRVRGTILMALSNKFGSMVVTTGNKSEMAVGYATLYG 418

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNPLKD+YK QV+ LA WRN + + +  GP   VIP +I+EK+PSAELR +Q D+
Sbjct: 419 DMNGGFNPLKDIYKMQVYALAEWRNKNHLHNLKGPEGIVIPSNIIEKAPSAELRENQKDE 478

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPYPILDDI++ ++EN+ S  +   + Y+ ETV  VE LLYG+EYKRRQ+  G KI+
Sbjct: 479 DSLPPYPILDDILQSLIENDMSICDIIKRGYSRETVEKVEQLLYGAEYKRRQSAPGVKIS 538

Query: 540 AKSFGRDRLYPISNKFRD 557
            K+FGRDR YPI N FRD
Sbjct: 539 YKNFGRDRRYPIVNHFRD 556


>gi|121601772|ref|YP_988914.1| NAD synthetase [Bartonella bacilliformis KC583]
 gi|120613949|gb|ABM44550.1| glutamine-dependent NAD(+) synthetase [Bartonella bacilliformis
           KC583]
          Length = 560

 Score =  598 bits (1542), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 298/557 (53%), Positives = 387/557 (69%), Gaps = 14/557 (2%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            +IA+AQLNP+VGDI GN   A+ A ++A +QG DL+L TELFIS YPPEDLV K +F +
Sbjct: 12  FRIAVAQLNPIVGDIEGNFVLAKMAHQKAQQQGADLVLLTELFISAYPPEDLVLKPAFTK 71

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC +AI  L   T +G  GI++G P +  + + N VV+LD G +IA   K +LPNY EF 
Sbjct: 72  ACENAIKKLAKVTKEG-PGIIIGAPIKRGDAIYNGVVLLDNGQVIAEYLKFDLPNYLEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G S +PIV+R I LGI++CEDIW +S+IC   + +GAEF+   N SPY HNK+
Sbjct: 131 EKRVFSPGPSPEPIVYRGITLGIVVCEDIWNDSSICTEFRNKGAEFILVSNGSPYCHNKI 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            KR  IV  +     +P+IY NQVGGQDELIFDG SF  + Q  +AFQMKHF     ++ 
Sbjct: 191 LKRMSIVRARAIQAGVPVIYANQVGGQDELIFDGGSFALNEQGTVAFQMKHFESHIAVSH 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   ++   W  +S  +       L    ADY+ACVL LRDYV KN F  VI+GLSGGID
Sbjct: 251 WQ--RKSIGWQCVSGPNEKL----LGGLAADYHACVLGLRDYVNKNGFKDVILGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SALCAAIA DALG E V+ IM+PY YTS +SL+DA  CA  L C Y+++PI   V +F S
Sbjct: 305 SALCAAIATDALGAERVRAIMMPYHYTSEESLKDAKDCAHFLNCHYEIIPIVQPVENFLS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
           +++      PS +  EN+QSR+RG ILMALSN   +M++TT NKSE++VGY TLYGDM+G
Sbjct: 365 IIAPIFSGLPSDVTEENLQSRVRGTILMALSNKFGSMVITTGNKSEMAVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ LA WRN + + + LG    VIPP+I++K+PSAELR +Q D++SLP
Sbjct: 425 GFNPIKDIYKMQVYALAEWRNKNHLLNFLGAEGVVIPPNIIKKAPSAELRENQKDEDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINNDQ----EYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           PYPILDDI++ +VEN+ S    D+     +  ETV  VEHLLY +E+KRRQ+  G KI++
Sbjct: 485 PYPILDDILQSLVENDMSV---DEIVKCGHLRETVEKVEHLLYVAEHKRRQSAPGIKISS 541

Query: 541 KSFGRDRLYPISNKFRD 557
           K+FGRDR YPI+N FRD
Sbjct: 542 KNFGRDRRYPITNYFRD 558


>gi|49474273|ref|YP_032315.1| NAD synthetase [Bartonella quintana str. Toulouse]
 gi|49239777|emb|CAF26167.1| NH3-dependent NAD synthetase [Bartonella quintana str. Toulouse]
          Length = 558

 Score =  593 bits (1528), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 292/558 (52%), Positives = 381/558 (68%), Gaps = 8/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    ++A+AQLNPVVGDI GN + A  A ++A  +G DL+LFTELFIS YPPEDLV K 
Sbjct: 6   MKNDFRVAVAQLNPVVGDIEGNFSLAVMAYQKAREEGADLVLFTELFISAYPPEDLVLKP 65

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +FI+ C  A+  L   T  GG GIV+G P +  + + N V++LD G II+   K +LPNY
Sbjct: 66  AFIKTCEGAVKELAKLT-TGGPGIVIGLPLRYNDKIFNGVMLLDEGRIISESLKFDLPNY 124

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           +EF E+R F SG   +PIV+  IRLGI+ICEDIW + + C  L+ +GAE +  LN SPY+
Sbjct: 125 AEFDERRLFSSGPRPEPIVYHGIRLGIVICEDIWNDFSFCAELRNKGAEIILVLNGSPYH 184

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK  KR E+V  Q     LPIIY NQVGGQDEL+FDG SF  +GQ ++ FQMKHF    
Sbjct: 185 RNKTLKRIEVVRAQALQSGLPIIYANQVGGQDELVFDGGSFALNGQGKMVFQMKHFESHI 244

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            ++ W   ++++ W  +S  + +          ADY ACVL L DYV KN F  VI+GLS
Sbjct: 245 ALSHWQ--KKMTGWQCISGPNENL----FNGLAADYQACVLGLGDYVNKNGFKDVILGLS 298

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSALC A+AVDALG + V+T+M+PY YTS +SL+DA  CA  LGC Y ++PI   V 
Sbjct: 299 GGIDSALCTAMAVDALGAKRVRTVMMPYHYTSQESLKDAKECAHLLGCDYQIIPIIKPVE 358

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F S ++         +  EN+QSR+RG +LMALSN   +M++TT NKSE++VGY TLYG
Sbjct: 359 VFLSTLAPVFLGLTPDVTEENLQSRVRGTLLMALSNKFGSMVVTTGNKSEMAVGYATLYG 418

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNPLKD+YKTQV+ LA WRN + + +  G    VIPP+I+ K+PSAEL  +Q D+
Sbjct: 419 DMNGGFNPLKDIYKTQVYALAEWRNKNHLQNWEGSEGVVIPPNIIAKAPSAELSENQKDE 478

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPYPILDDI++ ++EN+ S  +   + Y  ETV  +EHLLY +EYKRRQ+  G KI+
Sbjct: 479 DSLPPYPILDDILQSLIENDMSVCDIVKRGYLRETVEKIEHLLYVAEYKRRQSAPGVKIS 538

Query: 540 AKSFGRDRLYPISNKFRD 557
            K+FGRDR YPI N FRD
Sbjct: 539 YKNFGRDRRYPIVNHFRD 556


>gi|319408420|emb|CBI82075.1| NH3-dependent NAD synthetase [Bartonella schoenbuchensis R1]
          Length = 558

 Score =  591 bits (1524), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 297/554 (53%), Positives = 382/554 (68%), Gaps = 8/554 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            +IA+AQLNPV+GDI GN A A  A ++A  QG DL+L TELFIS YPPEDLV K +FI+
Sbjct: 10  FRIAVAQLNPVIGDIEGNFALAIMAHQKAQEQGADLVLLTELFISAYPPEDLVLKPAFIK 69

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC +A+  L   T +G  GIV+G P +  + + N V++L+ G I+A R K +LPNY+EF 
Sbjct: 70  ACENAVQRLAKVTKNG-PGIVIGVPLRRDDAIYNGVMLLNDGQIVAERLKFDLPNYAEFD 128

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F S    +PIV+R I LGI+ICEDIW +S+IC  L  +GAE +   N SPY  +K 
Sbjct: 129 EKRVFSSDPFLEPIVYRGITLGIVICEDIWSDSSICAQLSNKGAEIILVPNGSPYTRHKT 188

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            KR +IV  Q     +PIIY NQVGGQDEL+FDG SF  +GQ ++AFQMKHF     ++ 
Sbjct: 189 LKRLDIVRAQAIQSGVPIIYANQVGGQDELVFDGGSFALNGQGKMAFQMKHFESHIALSH 248

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   +Q   W  +S  +       L    ADY ACVL LRDYV KN F  VI+GLSGGID
Sbjct: 249 WQ--RQSIGWQCISGPNEEL----LSGLAADYQACVLGLRDYVNKNCFQDVILGLSGGID 302

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SALCA +AVDALG E V+T+M+PY YTS +SL DA  CA+ LGC Y+V+PI   V  F +
Sbjct: 303 SALCATMAVDALGAERVRTVMMPYHYTSQESLRDAEDCARFLGCHYEVIPIIQPVEGFLN 362

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++    +    +  EN+QSR RG ILMALSN   +M++TT NKSE++VGY TLYGDM+G
Sbjct: 363 ALAPAFSQLKPDLTEENLQSRTRGTILMALSNKFGSMVITTGNKSEMAVGYATLYGDMNG 422

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ LA WRN + + + LG    VIP +I+ K+PSAELR +Q D++SLP
Sbjct: 423 GFNPIKDIYKMQVYALAKWRNKNHLQNLLGAKGVVIPSNIIMKAPSAELRENQKDEDSLP 482

Query: 485 PYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYPILDDI++ +VE++ S     Q  +  ETV  +EHLLY +EYKRRQ+  G KI++KSF
Sbjct: 483 PYPILDDILQSLVEDDMSVGEIVQCGHLRETVEKIEHLLYLAEYKRRQSAPGVKISSKSF 542

Query: 544 GRDRLYPISNKFRD 557
           GRDR YPI N+FRD
Sbjct: 543 GRDRRYPIINRFRD 556


>gi|304391830|ref|ZP_07373772.1| NAD(+) synthase (glutamine-hydrolyzing) [Ahrensia sp. R2A130]
 gi|303296059|gb|EFL90417.1| NAD(+) synthase (glutamine-hydrolyzing) [Ahrensia sp. R2A130]
          Length = 556

 Score =  591 bits (1523), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 283/556 (50%), Positives = 380/556 (68%), Gaps = 9/556 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IAIAQ+NP VGD++GN    R AR +A RQG DL++FTELFISGY PEDLV K +FI+
Sbjct: 8   LRIAIAQMNPTVGDVSGNTDLVREARSDAARQGADLVVFTELFISGYSPEDLVLKPAFIK 67

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
            C  A++ L  +T DGG  ++VG P Q + G+ NSV +LD G  I +R K++LPNY  F 
Sbjct: 68  RCREAVEALAEETKDGGPAVLVGVPWQAETGLHNSVALLDGG-AIKLRHKVDLPNYGVFD 126

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLG+ ICEDIW + ++C+ L + G+E L   N SPYY  K+
Sbjct: 127 EKRVFAQGPMPGPLNFRGVRLGVPICEDIWGDLDVCETLAESGSEILIVPNGSPYYRQKV 186

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R+++V  Q+    LP+++ NQ+GGQDEL+FDG SF  +  + +  QM  F     +T 
Sbjct: 187 DVRYQVVMRQVIVTELPMLFANQLGGQDELVFDGGSFVMNADKSIPVQMNQFESSVALTT 246

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W          +  D    T    +QE   D+ ACVL LRDYV+KN F  V++GLSGGID
Sbjct: 247 WRRGSD----GWACDRGVQTRLPDVQE--CDWRACVLGLRDYVEKNGFKNVVLGLSGGID 300

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+ AA++VDALG+E V+ +MLPY+YTS +SL+DA  CA ALG +Y+ +PI   V  F  
Sbjct: 301 SAIVAAMSVDALGEERVRCVMLPYRYTSDESLKDAQDCANALGVRYETIPIEPPVQGFLD 360

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S   ++   G+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 361 TLSDVFEDTAEGVTEENLQSRARGVILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 420

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ L+ WRN H     LGP  EVIP +I++K+P+AELR +QTDQ+SLP
Sbjct: 421 GFNPIKDLYKMQVYGLSDWRNKHMPPDCLGPSGEVIPQNIIDKAPTAELRENQTDQDSLP 480

Query: 485 PYPILDDIIKRIVENEESFINNDQEYNDE--TVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
            YP+LD I++ +VENE S  +  +++  E  TV  +EHLLY +EYKRRQA  G KIT ++
Sbjct: 481 EYPVLDAILESLVENEMSVDDIVEKFGFERATVERMEHLLYIAEYKRRQAAPGVKITRRA 540

Query: 543 FGRDRLYPISNKFRDH 558
           FGR+R YPI+N+FRD 
Sbjct: 541 FGRERRYPITNRFRDR 556


>gi|306840502|ref|ZP_07473261.1| NAD+ synthetase [Brucella sp. BO2]
 gi|306289517|gb|EFM60735.1| NAD+ synthetase [Brucella sp. BO2]
          Length = 518

 Score =  590 bits (1520), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 283/521 (54%), Positives = 363/521 (69%), Gaps = 7/521 (1%)

Query: 39  DLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLN 98
           DLILFTELFISGYPPED+V K +F+ AC  A+  L +DT DGG G+++G P     G  N
Sbjct: 4   DLILFTELFISGYPPEDMVLKPAFVAACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHN 63

Query: 99  SVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSN 158
           +V +LD G IIA R K++LPNY EF EKR F  G    P+ FR +RLGI +CEDIW    
Sbjct: 64  AVAVLDGGEIIAERFKVDLPNYGEFDEKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELG 123

Query: 159 ICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDG 218
           + + L + GAE L   N SPY+  K+ +RH++V  Q+    LPI+Y NQVGGQDEL+FDG
Sbjct: 124 VAETLAESGAEILLVPNGSPYHRAKMDRRHQVVLKQVIETGLPIVYANQVGGQDELVFDG 183

Query: 219 ASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNA 278
            SF F+  + L  QM  F+EQ  +TEW  D     W     + AS   +P +   ADY A
Sbjct: 184 GSFVFNADKSLCLQMPQFAEQIALTEWQRDG--DGWRCGDGEKAS---LP-EGLAADYAA 237

Query: 279 CVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLED 338
           C+L LRDYV KN F  V++GLSGGIDSA+CAA+ VDALGK+ V+ +MLPY+YTS +SL D
Sbjct: 238 CMLGLRDYVNKNGFKDVVLGLSGGIDSAICAALGVDALGKDRVRCVMLPYRYTSEESLAD 297

Query: 339 AAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHS 398
           AA CA+ALG +YD++PI + V  F + +        SG+  EN+QSR RG ILMA+SN  
Sbjct: 298 AADCARALGVRYDIVPIAEPVEGFMNALQPLFSGTDSGVTEENLQSRARGTILMAISNKF 357

Query: 399 KAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTE 458
            +M++TT NKSE+SVGY TLYGDM+GGFNP+KD+YK QV+ L+ WRN H     LGP  E
Sbjct: 358 GSMVVTTGNKSEMSVGYATLYGDMNGGFNPIKDVYKMQVYALSQWRNHHLPQGALGPAGE 417

Query: 459 VIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRY 517
           VIP +I+ K+PSAELR +QTDQ+SLPPYP+LDDI++ +VENE S      + +  ETV+ 
Sbjct: 418 VIPQNIISKAPSAELRENQTDQDSLPPYPVLDDILECLVENEMSNAEIVARGHALETVQR 477

Query: 518 VEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
           +EHLLY +EYKRRQ+  G KIT K+FGRDR YPI+N+FRD 
Sbjct: 478 IEHLLYLAEYKRRQSAPGVKITKKNFGRDRRYPITNRFRDR 518


>gi|319405818|emb|CBI79448.1| NH3-dependent NAD synthetase [Bartonella sp. AR 15-3]
          Length = 558

 Score =  585 bits (1508), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 287/554 (51%), Positives = 384/554 (69%), Gaps = 8/554 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+I IAQLNP++GDI GN+A A    ++A  Q  DL+L TELFIS YPPEDLV K +F +
Sbjct: 10  LRIVIAQLNPIIGDIEGNLALAEMTYQKAYEQDADLVLLTELFISAYPPEDLVLKYAFTK 69

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L   T +G  GI++G P +    + N +++LD G +IA R K +LPNY EF 
Sbjct: 70  ACEDAVKKLAQLTKEG-PGIIIGIPLKRDNDLYNGIMLLDDGQVIAERFKCDLPNYCEFD 128

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G   +P+V+R + LG++ICEDIW + +IC  L  +GAE +   N SPY  NK 
Sbjct: 129 EKRVFSPGPRPEPVVYRGMTLGVVICEDIWNDPSICAELSHKGAEIILVPNGSPYQRNKT 188

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           +KR +IV  Q    ++PIIY NQVGGQDEL+FDG SF  D   Q+ FQMKHF  +N ++ 
Sbjct: 189 QKRLDIVRAQAVQSYVPIIYANQVGGQDELVFDGGSFAVDEHGQIVFQMKHF--ENHISL 246

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
            H+ ++   W  +S  +       L    ADY+ACVL L+DYV KN F  V++G SGGID
Sbjct: 247 SHWQRKSIGWQCISGPNEEL----LDGIAADYHACVLGLKDYVNKNRFKDVLLGFSGGID 302

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SALCAAIAVDALG E V+ +M+PY YTS +SL+DA  CA  LGC+Y+V+PI   V  F S
Sbjct: 303 SALCAAIAVDALGAERVRAVMMPYCYTSQESLKDAKHCAHLLGCRYEVIPIFKPVESFLS 362

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
           +M+       + +  EN+QSRIRG++LMALSN   +M++TT NKSE++VGY TLYGDM+G
Sbjct: 363 IMAPIFAGLQTDVTEENLQSRIRGSVLMALSNKFDSMVITTGNKSEMAVGYATLYGDMNG 422

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV++LA WRN + + + LGP   +IP +I+EK+PSAELR +Q D++ LP
Sbjct: 423 GFNPIKDIYKMQVYKLAEWRNKNYLQNLLGPKGIIIPSNIIEKAPSAELRENQKDEDFLP 482

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYPILDDI++ +VE++ S  +   + +  +TV  VEHLLY +EYKRRQ+  G KI+ K+F
Sbjct: 483 PYPILDDILQSLVEDDMSVCDIVKRGHLRQTVEKVEHLLYLAEYKRRQSAPGVKISYKNF 542

Query: 544 GRDRLYPISNKFRD 557
           GRDR YPI+N FRD
Sbjct: 543 GRDRRYPITNHFRD 556


>gi|319899020|ref|YP_004159113.1| NH3-dependent NAD synthetase [Bartonella clarridgeiae 73]
 gi|319402984|emb|CBI76537.1| NH3-dependent NAD synthetase [Bartonella clarridgeiae 73]
          Length = 558

 Score =  583 bits (1504), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 287/554 (51%), Positives = 379/554 (68%), Gaps = 8/554 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+I IAQLNP++GDI GN   A    ++A  QG DLIL TELFIS YPPEDLV K +F +
Sbjct: 10  LRIVIAQLNPIIGDIEGNFTLAEITYQKACEQGADLILLTELFISAYPPEDLVLKSAFTK 69

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L   T +G  GI++G P +    + N +++L+ G +IA R K +LPNY EF 
Sbjct: 70  ACEDAVKKLAQLTKEG-PGIIIGVPLKRDNSIYNGIMLLNDGQVIAERFKCDLPNYCEFD 128

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G   +PIV+R + LG++ICEDIW + +IC  L  +GAE +   N SPY+ NK 
Sbjct: 129 EKRVFSPGPRPEPIVYRGMTLGVVICEDIWNDPSICAELSHKGAEIILVPNGSPYHRNKT 188

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           +KR +IV  Q     +PIIY NQVGGQDEL+FDG SF  D Q Q+AFQMKHF     ++ 
Sbjct: 189 QKRLDIVRAQAVQSCVPIIYANQVGGQDELVFDGGSFALDEQGQIAFQMKHFESHIALSH 248

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   ++   W  +S  +       L    ADY ACVL L+DYV KN F  VI+G SGGID
Sbjct: 249 WR--RKSIGWQCISGPNEEL----LDGLAADYYACVLGLKDYVNKNRFKDVILGFSGGID 302

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SALCAAIAVDALG E V  +M+PY YTS +SL+DA  CA  LGC+Y+++PI   V  F S
Sbjct: 303 SALCAAIAVDALGAERVCAVMMPYYYTSQESLKDAKDCAHLLGCRYEMIPILKPVESFLS 362

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
           +M+       + +  EN+QSRIRG++LM LSN   +M++TT NKSE++VGY TLYGDM+G
Sbjct: 363 VMAPIFSGLQTDVTEENLQSRIRGSVLMTLSNKFGSMVITTGNKSEMAVGYATLYGDMNG 422

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV++LA WRN + + + LGP   +IP +I+EK PSAELR +Q D++ LP
Sbjct: 423 GFNPIKDIYKMQVYKLAEWRNKNHLQNLLGPKGIIIPSNIIEKEPSAELRENQKDEDFLP 482

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYPILDDI++ ++E++ S  +   + ++ +TV  VEHLLY +EYKRRQ+  G KI+ K+F
Sbjct: 483 PYPILDDILQSLIEDDMSVSDIVKRGHSRQTVEKVEHLLYLAEYKRRQSAPGVKISYKNF 542

Query: 544 GRDRLYPISNKFRD 557
           GRDR YPI+N FRD
Sbjct: 543 GRDRRYPITNHFRD 556


>gi|118588086|ref|ZP_01545496.1| NAD synthetase [Stappia aggregata IAM 12614]
 gi|118439708|gb|EAV46339.1| NAD synthetase [Stappia aggregata IAM 12614]
          Length = 555

 Score =  578 bits (1490), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 283/557 (50%), Positives = 385/557 (69%), Gaps = 9/557 (1%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           + ++A+AQLNP VGD+AGN    R+AR +A  QG DL+L +EL ++GY PEDLV K +F+
Sbjct: 5   RFRLAVAQLNPTVGDVAGNADLVRKARLDAASQGADLVLTSELVLAGYLPEDLVLKPAFV 64

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNYSE 122
           + C  A +TL  +T DGG G+++G P + +EG V N+ ++LD G I AVR K +LPNYS 
Sbjct: 65  RRCMEAAETLAGETADGGPGLILGSPWRSEEGKVYNAALLLDQGEIKAVRYKYDLPNYSV 124

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F +G    P+ FR +R+G+ ICEDIW N  +C+ L++ GAE L   N SPY+ +
Sbjct: 125 FDEKRVFAAGPLPGPVDFRGVRIGLPICEDIW-NDEVCECLEETGAELLLVPNGSPYWEH 183

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           + + R ++V  ++    LP++Y NQ+GGQDEL+FDG SF     + LAFQM  F     +
Sbjct: 184 RAEHRLQVVVSRVVQTGLPLVYCNQLGGQDELVFDGGSFALHADRSLAFQMPQFETALGI 243

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
           ++W  D     W     ++ S   +P   +EA++ ACV+ L DYV KN F  V++GLSGG
Sbjct: 244 SDWKRDGD--TWLC---ENGSVAKLP-DLDEANWRACVMGLGDYVTKNGFPGVVLGLSGG 297

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSA+CAA+AVDALG + V  IMLPY+YTS +S+ DAAACAKALG +YD +PI + V  F
Sbjct: 298 IDSAICAAMAVDALGADKVHAIMLPYRYTSEESITDAAACAKALGIRYDTVPISEPVEGF 357

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            S +S            EN+QSR RG ILMA+SN    M++TT NKSE+SVGY TLYGDM
Sbjct: 358 RSALSNLFAGTKEDTTEENLQSRARGVILMAVSNKFGHMVMTTGNKSEMSVGYATLYGDM 417

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GG+NP+KDLYKTQV+ LA WRN++     LGP  EVIP +I+ K P+AELR +QTDQ+S
Sbjct: 418 NGGYNPIKDLYKTQVYHLAEWRNNNRPEGLLGPGREVIPSNIITKVPTAELRENQTDQDS 477

Query: 483 LPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY +LDDI++ +VE+E S  + ++  +D   +  +EHLLY +EYKRRQAP G KIT +
Sbjct: 478 LPPYDVLDDILECLVEDEMSVGDIEKRGHDRALIHRIEHLLYIAEYKRRQAPPGVKITER 537

Query: 542 SFGRDRLYPISNKFRDH 558
           +FG+DR YPI+N+FRD 
Sbjct: 538 NFGKDRRYPITNRFRDR 554


>gi|307946670|ref|ZP_07662005.1| NAD(+) synthase (glutamine-hydrolyzing) [Roseibium sp. TrichSKD4]
 gi|307770334|gb|EFO29560.1| NAD(+) synthase (glutamine-hydrolyzing) [Roseibium sp. TrichSKD4]
          Length = 555

 Score =  575 bits (1482), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 283/556 (50%), Positives = 379/556 (68%), Gaps = 7/556 (1%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           +++IA+AQLNP VGD+ GN  K R+AR+EA + G DL+L  EL +SGYPPEDLV K +F+
Sbjct: 5   RIRIAVAQLNPTVGDLTGNADKVRKARDEAAQLGADLVLCPELTLSGYPPEDLVLKPAFV 64

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           Q C   +  L S+T   G G+++G P  +   + N+V ++D G I ++R K +LPNYS F
Sbjct: 65  QRCMDLVSELASETKGEGPGLLIGSPWAEDGQLYNAVALVDDGEIKSIRYKYDLPNYSVF 124

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            EKR F +G    P+ FR +RLG+ ICEDIW N  +C+ L + GAE L   N SPY+HN+
Sbjct: 125 DEKRVFAAGPLPGPMDFRGVRLGVPICEDIW-NDEVCECLAETGAELLLVPNGSPYWHNR 183

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
            ++R ++V  ++    LP+IY NQ+GGQDEL+FDG SF     + LAFQM  F+    +T
Sbjct: 184 AEERLQVVVSRVVESDLPLIYCNQIGGQDELVFDGGSFGLQANRTLAFQMSQFTSDLAVT 243

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
           EW   +    W   S   A+   +    + A++ ACV  LRDYV KN F  V++GLSGGI
Sbjct: 244 EWVKGED-EIWVCESGPKAALPDL----DTANWQACVRGLRDYVTKNGFPGVVLGLSGGI 298

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSA+CAA+AVDALG + V  IMLPY+YTS +S++DAA CA ALG +YD +PI + V  F 
Sbjct: 299 DSAICAAMAVDALGADKVHAIMLPYRYTSEESIKDAAECAAALGIRYDTVPIEEPVLGFT 358

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           +++S       S    EN+QSR RG ILMA+SN    M++TT NKSE+SVGY TLYGDM+
Sbjct: 359 NVLSDLFAGTKSDTTEENLQSRARGVILMAVSNKFGHMVVTTGNKSEMSVGYATLYGDMN 418

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GG+NP+KDLYKTQV+ LA WRN +     LGP  EVIP +I+ K P+AELR +QTDQ+SL
Sbjct: 419 GGYNPIKDLYKTQVYHLADWRNHNRPDGMLGPEGEVIPTNIITKVPTAELRENQTDQDSL 478

Query: 484 PPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           PPY +LDDI+  +VE E S    +   +D+  +  VEHLLY +EYKRRQAP G KIT+++
Sbjct: 479 PPYDVLDDILNCLVEEEMSVNEIEARGHDKALIHKVEHLLYIAEYKRRQAPPGVKITSRN 538

Query: 543 FGRDRLYPISNKFRDH 558
           FG+DR YPI+N+FRD 
Sbjct: 539 FGKDRRYPITNRFRDR 554


>gi|254473458|ref|ZP_05086855.1| glutamine-dependent NAD(+) synthetase [Pseudovibrio sp. JE062]
 gi|211957574|gb|EEA92777.1| glutamine-dependent NAD(+) synthetase [Pseudovibrio sp. JE062]
          Length = 555

 Score =  574 bits (1480), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 287/560 (51%), Positives = 387/560 (69%), Gaps = 8/560 (1%)

Query: 1   MLK-KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFK 59
           M+K + ++A+ Q NP VGDI+GN  K R  R+ A  QG DL+L++ELF++GYP EDLV K
Sbjct: 1   MIKDQFRLAVVQANPCVGDISGNAEKVRHHRKLAAEQGADLVLYSELFLAGYPLEDLVRK 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
            SF+ AC   ++ L  +T DGG G++VG P  + E + N+V +LD G +  +R K++LPN
Sbjct: 61  PSFVAACKRELEALAKETADGGPGLLVGLPWAEGEKLYNAVALLDNGKVEGLRFKVDLPN 120

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           Y  F EKR F +G +  PI FR +RLG+ ICED W +  +C+ L++ GAE L   NASPY
Sbjct: 121 YGVFDEKRVFDAGPNPGPISFRGVRLGVPICEDTWTDE-VCECLEETGAEILVVPNASPY 179

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
              K ++R +++  ++    LP +Y NQVGGQDEL+FDGASF  +  + LA Q+  F+E+
Sbjct: 180 NREKTEERMQLMISRVVETGLPFVYCNQVGGQDELVFDGASFALNHDRSLAMQLGQFTEE 239

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
                +  D   +  N++ +  A  + +P   +EAD+ ACVL L+DYV KN F  V++GL
Sbjct: 240 TGYLNFKKD---ADENWLIE-PARVVPMP-DTQEADWLACVLGLKDYVNKNGFPGVVLGL 294

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSA+CAA+AVDALG E V  IMLPY+YTS +S++DA ACA ALG KYD +PI + V
Sbjct: 295 SGGIDSAICAAMAVDALGAERVHCIMLPYRYTSEESIKDAKACADALGVKYDTIPIAEPV 354

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F   +S       SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLY
Sbjct: 355 EGFQKTLSGVFAGTESGITEENLQSRSRGVILMAVSNKFGAMVVTTGNKSEMSVGYATLY 414

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGFNP+KDLYKT+V++L+ WRN H     +GP  EVIP +I+ K+P+AELR +QTD
Sbjct: 415 GDMNGGFNPIKDLYKTEVYRLSDWRNKHHPAGVMGPAGEVIPNNIIVKAPTAELRENQTD 474

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLP Y +LDDI+  +VE E S    ++  ++ ET+  VEHLLY +EYKRRQA  G KI
Sbjct: 475 QDSLPEYDVLDDILHCLVEQELSLDEIEKRGHSVETIHRVEHLLYIAEYKRRQAAPGVKI 534

Query: 539 TAKSFGRDRLYPISNKFRDH 558
           T K+FGRDR YPI+N+FRD 
Sbjct: 535 TLKNFGRDRRYPITNRFRDR 554


>gi|254503440|ref|ZP_05115591.1| NAD synthase family [Labrenzia alexandrii DFL-11]
 gi|222439511|gb|EEE46190.1| NAD synthase family [Labrenzia alexandrii DFL-11]
          Length = 555

 Score =  568 bits (1465), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 275/559 (49%), Positives = 381/559 (68%), Gaps = 9/559 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +   ++A+AQLNP VGD+AGN    R+AR +A  Q  DL+L +EL ++GYPPEDLV K +
Sbjct: 3   INSFRLAVAQLNPTVGDVAGNAELVRQARADAKAQQSDLVLTSELMLAGYPPEDLVLKPA 62

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVL-NSVVILDAGNIIAVRDKINLPNY 120
           F++ C      L  +T DGG  +++G P     G L N+V+++D G + AVR K +LPNY
Sbjct: 63  FVRECMETARALAEETGDGGPAVILGTPWYSDAGDLHNAVLLIDQGEVKAVRYKSDLPNY 122

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G    P+ FR +R+G+ ICEDIW N  +C+ L++ GAE L   N SPY+
Sbjct: 123 GVFDEKRVFKAGPLPGPVDFRGVRIGLPICEDIW-NDEVCECLEETGAEILLVPNGSPYW 181

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            N+ ++R ++V  ++    LP++Y NQ+GGQDEL+FDG SF     + LAFQM  F    
Sbjct: 182 ENRAEERLQVVVARVVQTDLPLVYCNQLGGQDELVFDGGSFALQADRSLAFQMPQFETAL 241

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +++W  D +   W   S    S   +P   +EA++ ACVL L DYV KN F  V++GLS
Sbjct: 242 GISDWKRDGE--AWTCTS---GSVAKLP-DLDEANWRACVLGLGDYVTKNGFPGVVLGLS 295

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+CAA+AVDALG + V +IMLP++YTS +S++DAA CAKALG +YD +PI + V 
Sbjct: 296 GGIDSAVCAAMAVDALGADKVHSIMLPFRYTSEESIKDAADCAKALGLRYDTVPIAEPVE 355

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +        +G+  EN+QSR RG ILMA+SN    M++TT NKSE+SVGY TLYG
Sbjct: 356 GFTKALDGLFAGTEAGVTEENLQSRTRGVILMAVSNKFGHMVMTTGNKSEMSVGYATLYG 415

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKTQV+ L++WRN++     LGP  EVIP +I+ K P+AELR +QTDQ
Sbjct: 416 DMNGGYNPIKDLYKTQVYHLSAWRNANKPAGLLGPDGEVIPSNIITKVPTAELRENQTDQ 475

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LDDI++ +VE E S  + ++  ++ + +  +EHLLY +EYKRRQAP G KIT
Sbjct: 476 DSLPAYDVLDDILECLVEKEMSVGDIEKRGHSRDLIHRIEHLLYIAEYKRRQAPPGVKIT 535

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++FGRDR YPI+N+FRD 
Sbjct: 536 ERNFGRDRRYPITNRFRDR 554


>gi|217976322|ref|YP_002360469.1| NAD synthetase [Methylocella silvestris BL2]
 gi|217501698|gb|ACK49107.1| NAD+ synthetase [Methylocella silvestris BL2]
          Length = 576

 Score =  568 bits (1464), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 286/559 (51%), Positives = 368/559 (65%), Gaps = 8/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L I +AQ++  VGDIAGN+A+ R AR EA   G D+++F+ELFI+GYPPEDLV K 
Sbjct: 1   MTDTLVIGLAQIDSTVGDIAGNVARVRAARTEAAGFGADVVMFSELFIAGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++AC +A+D L  DT DGG  I+VG P  +     N+  +LD G + AVR K++LPNY
Sbjct: 61  AFLEACRAALDDLARDTADGGPAILVGVPLVENGLAYNAYALLDGGRVEAVRYKVDLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G    P+  R +R+G+ ICEDIW    + + + + G E L   N SPY+
Sbjct: 121 GVFDEKRVFAPGPMPGPLTLRGVRIGVPICEDIWGPDPV-ECIAETGGEILLVPNGSPYW 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R  IV  ++    LP+IY+NQVGGQDEL+FDGASF  +  + LAFQ+  F+   
Sbjct: 180 RGKADERLAIVAARVVESGLPLIYLNQVGGQDELVFDGASFGLNADRTLAFQLPAFTSVV 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
             T W      + +  +    A+      Q EEADY+ACV+ LRDYV+KN F  V++GLS
Sbjct: 240 ARTVWRRGD--NGFVCVEGPKAAIE----QGEEADYSACVVGLRDYVEKNGFPGVVLGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSALCAA+AVDALG   V  +MLPY+YTS +SL DA  CAKALG +YD+LPI  +V+
Sbjct: 294 GGIDSALCAAMAVDALGAARVHCVMLPYRYTSNESLFDAEGCAKALGVRYDILPIEPIVS 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + +       P G+  ENIQSR+RG  LMA+SN   AML+TT NKSE+SVGY T+YG
Sbjct: 354 GFETTLRPLFAGTPPGLTEENIQSRVRGATLMAISNKFGAMLVTTGNKSELSVGYATIYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNPLKDLYK +VF+L   RN       LGP   VIP +IL K PSAELR +Q DQ
Sbjct: 414 DMNGGFNPLKDLYKMEVFRLCRLRNRWKPKGALGPDGVVIPENILVKPPSAELRENQKDQ 473

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY  LD I++ +VE E    +     +  ETV+ VE LLY +EYKRRQ+  G K+T
Sbjct: 474 DSLPPYEELDAILEGLVEKEMRVSDLIAAGFTAETVKKVERLLYLAEYKRRQSAPGVKVT 533

Query: 540 AKSFGRDRLYPISNKFRDH 558
            K+FGRDR YPI NKFRD 
Sbjct: 534 KKNFGRDRRYPILNKFRDS 552


>gi|328544366|ref|YP_004304475.1| NAD synthase family [polymorphum gilvum SL003B-26A1]
 gi|326414108|gb|ADZ71171.1| NAD synthase family [Polymorphum gilvum SL003B-26A1]
          Length = 562

 Score =  565 bits (1457), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 280/556 (50%), Positives = 377/556 (67%), Gaps = 7/556 (1%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           + ++A+AQLNPVVGD+AGN    R+AR  A  +G  L+L +EL ++GYPPEDLV K +F+
Sbjct: 12  RFRLAVAQLNPVVGDVAGNAELVRQARARAAAEGAHLVLCSELVLAGYPPEDLVLKPAFL 71

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +AC +A + L  +T DGG  ++VG P  D   + N+V++LDAG I AVR K++LPNY  F
Sbjct: 72  RACRAAAEDLARETADGGPALIVGTPWIDDGKLHNAVLLLDAGRIQAVRYKVDLPNYGVF 131

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            EKR F  G    P+ FR +RLG+ ICED W +  +C+ L + GAE L   N SPY+ NK
Sbjct: 132 DEKRVFAPGPMPGPVDFRGVRLGLPICEDAWTD-EVCECLAETGAEILLVPNGSPYWANK 190

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
            ++R +++  ++    LP++Y NQ+GGQDEL+FDG SF     ++LAFQM  F     +T
Sbjct: 191 AEERLQVMVARVVESGLPLVYCNQLGGQDELVFDGGSFALQADRRLAFQMPQFRTDLAVT 250

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
           +W  D    +W       A    I    +EA++ ACV+ LRDYV K+ F  VI+GLSGGI
Sbjct: 251 DWQRDAD-GKWVCAGGPLARLPEI----DEANWLACVVGLRDYVDKSRFPGVILGLSGGI 305

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSA+CAA+AVDALG E V  +M+PY+YTS  S+ DA ACA+ L  +YD +PI   V  F 
Sbjct: 306 DSAVCAAMAVDALGPERVHGVMMPYRYTSRASIVDAEACARKLAIRYDTVPIEIPVAGFT 365

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
            ++       P+    EN+QSR RG +LMA+SN    M++TT NKSE+SVGY TLYGDM+
Sbjct: 366 EVLGPLFHGRPADTTEENLQSRSRGVVLMAISNKFGYMVVTTGNKSEMSVGYATLYGDMN 425

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GG+NP+KDLYKTQV+QLA+WRN++     LGP  EVIP +I+ K PSAELR +QTDQ+SL
Sbjct: 426 GGYNPVKDLYKTQVYQLAAWRNANRPEGVLGPAGEVIPHNIIAKVPSAELRENQTDQDSL 485

Query: 484 PPYPILDDIIKRIVENEESFINNDQEYNDE-TVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           P Y +LDDI+  +VENE +    +   +D  T+  VE+LLY +EYKRRQAP G KIT ++
Sbjct: 486 PSYDVLDDILACLVENEMAVSEIEARGHDRATIHRVENLLYVAEYKRRQAPPGVKITRRN 545

Query: 543 FGRDRLYPISNKFRDH 558
           FGRDR YPI+N+FRD 
Sbjct: 546 FGRDRRYPITNRFRDR 561


>gi|92117038|ref|YP_576767.1| NAD synthetase [Nitrobacter hamburgensis X14]
 gi|91799932|gb|ABE62307.1| NH(3)-dependent NAD(+) synthetase [Nitrobacter hamburgensis X14]
          Length = 583

 Score =  561 bits (1446), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 275/560 (49%), Positives = 369/560 (65%), Gaps = 13/560 (2%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            KI + QLNP VGDIAGN AKAR AR +A   G  L+   ELFI+GYPPEDLV K +F  
Sbjct: 6   FKITLGQLNPTVGDIAGNAAKARVARAQAKADGAALVALPELFIAGYPPEDLVLKPAFQA 65

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A++TL  +T DGG  +++G P  D   + N+  +LD G + A+R K+NLPNY  F 
Sbjct: 66  ACREAVETLARETSDGGPAVLIGTPWVDDGKLYNAYALLDGGRVAAIRFKVNLPNYGVFD 125

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIW-----KNSNICKHLKKQGAEFLFSLNASPY 179
           EKR F  G    P+  R +R+G+ ICED W     +  N+ + L + GAE L   N SPY
Sbjct: 126 EKRVFARGPVGGPLKIRGVRIGVPICEDTWVEESAEYENVVECLAETGAEILLVPNGSPY 185

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
              K   R  I   +++   LP++Y+NQVGGQDEL+FDGASF  +  + LA Q+  F E 
Sbjct: 186 AKGKSDIRLSISVARVTESDLPLVYLNQVGGQDELVFDGASFVLNADRSLAAQLPAFRES 245

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
               +W   +  + W       A  +   +  ++ADY ACVL LRDYV KN F  V++G+
Sbjct: 246 LVTLQWT--KSAAGWR-----CAGPVAPQIDGDKADYAACVLGLRDYVHKNGFPGVLLGV 298

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSALCAAIAVDALG E V+ +MLP+++T+  SL+DAA  AKALG +Y+VLPI   V
Sbjct: 299 SGGIDSALCAAIAVDALGAERVRGVMLPFRFTAQVSLDDAATLAKALGIRYEVLPIAPAV 358

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F  ++S      P  I  EN+Q+R RG +LMA+SN   AM++TT NKSE+SVGY TLY
Sbjct: 359 NGFEEVLSGTFAGLPRDITEENLQARARGTLLMAISNKLGAMVVTTGNKSEMSVGYATLY 418

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGFNP+KD+YKT+VF+L++ RN+      LGP  EVIP +I+ + P+AELR +QTD
Sbjct: 419 GDMNGGFNPIKDIYKTEVFRLSNLRNAWKPDGALGPSGEVIPVNIITRPPTAELRENQTD 478

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLPPY +LD I++R++E EE   +   E ++ + V  ++ LL  +EYKRRQA  G K+
Sbjct: 479 QDSLPPYDVLDAILERLIEREEPLASIVAEGFDRDMVARIDRLLNVAEYKRRQAAPGVKV 538

Query: 539 TAKSFGRDRLYPISNKFRDH 558
           T ++FGRDR YPI+N+FRD 
Sbjct: 539 TRRNFGRDRRYPITNRFRDS 558


>gi|154251557|ref|YP_001412381.1| NAD+ synthetase [Parvibaculum lavamentivorans DS-1]
 gi|154155507|gb|ABS62724.1| NAD+ synthetase [Parvibaculum lavamentivorans DS-1]
          Length = 554

 Score =  555 bits (1431), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 283/561 (50%), Positives = 372/561 (66%), Gaps = 12/561 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  KL+IA+AQLNPVVGDIAGN+ KA  AR  A+  G +LI+FTELF++GYPPEDLV K 
Sbjct: 1   MTDKLRIALAQLNPVVGDIAGNLQKAVEARRAASVAGAELIVFTELFLTGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F +   +A++ L   T DGG  +++G P  ++  + N+V+ LD G I   R K++LPNY
Sbjct: 61  AFQRVAKAAVEDLARQTADGGPAVLIGAPWAEEGKLYNAVLHLDRGEIKGRRYKVHLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F E R F SG    P   R +R+G  ICEDIW   ++ + L++ GAE L   N SPY 
Sbjct: 121 SVFDEPRVFASGPMPGPFSIRGVRIGAPICEDIW-YPDVVECLEESGAELLLVPNGSPYE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK   R ++   +I    LP+ YVNQ+GGQDEL+FDG SF  +    LA QM  + E+ 
Sbjct: 180 FNKPDARLQLALSRIRESGLPLAYVNQLGGQDELVFDGGSFVLNADFSLALQMPAWEEKI 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE--EADYNACVLSLRDYVQKNNFHKVIIG 298
             T+W   ++   W     + A      L EE  E+ Y A V  LRDYV+KN F  V++G
Sbjct: 240 TCTDWTRGEK--GWVCAPGEKA------LVEEGDESLYLAVVQGLRDYVKKNRFPGVVLG 291

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL AAIAVDALG + V  +MLPY+YTS +SL DA ACAK LG +YDV+PI + 
Sbjct: 292 LSGGIDSALVAAIAVDALGADKVHCVMLPYRYTSSESLTDAEACAKLLGVRYDVVPIEEP 351

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V  F S + +  +   SG+  EN+QSR RG +LMA+SN   +MLLTT NKSE+S GY T+
Sbjct: 352 VAGFTSALEKMFEGTQSGVTEENLQSRTRGVVLMAISNKFGSMLLTTGNKSEVSAGYATI 411

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGFNP+KDLYK++VF+L++WRN+H     LGP   VIP  I+ + PSAELRP Q 
Sbjct: 412 YGDMNGGFNPIKDLYKSRVFKLSNWRNTHMPKGCLGPEGRVIPERIITRPPSAELRPDQK 471

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTK 537
           D++SLPPY ++DDI+  ++E E S  +     +D + V+ +EHLLY SEYKRRQA  G K
Sbjct: 472 DEDSLPPYEVMDDILHCLIEEEMSVTDIVARGHDRDLVKRIEHLLYISEYKRRQAAPGVK 531

Query: 538 ITAKSFGRDRLYPISNKFRDH 558
           +T ++FGRDR YPI N FRD 
Sbjct: 532 VTKRNFGRDRRYPIVNGFRDQ 552


>gi|182677746|ref|YP_001831892.1| NAD synthetase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633629|gb|ACB94403.1| NAD+ synthetase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 557

 Score =  555 bits (1429), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 277/558 (49%), Positives = 371/558 (66%), Gaps = 8/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L IA+AQ+N  VGDI GN+A+ R AR +A+  G DL++F+ELFISGYPPEDLV K S
Sbjct: 7   VDRLVIALAQINSTVGDIDGNLARIREARAKAHGFGADLVMFSELFISGYPPEDLVLKPS 66

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F  AC  A + L  +T DGG  I+VG P  +     N+  +L  G I A+R K++LPNY 
Sbjct: 67  FQDACRVACENLARETADGGPAILVGLPWGELGACYNAYALLAHGRIEAMRFKVDLPNYG 126

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F EKR F +G    PI+F+ +R+GI ICEDIW    + + + + G E L   N SPY+ 
Sbjct: 127 VFDEKRVFRAGPLQGPIIFKGVRIGIPICEDIWGPDPV-ECIAETGGEILLVPNGSPYWE 185

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
           +K  +R  +V  +IS  HLP+IY+NQ+GGQDEL+FDGA+F  +    LA Q+  F     
Sbjct: 186 SKSSERLSVVKARISETHLPLIYLNQLGGQDELVFDGATFALNADGTLACQLPAFEAIIA 245

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
            T W          ++  ++  T  I  + ++ADY AC+L LRDYV+K  F  V++GLSG
Sbjct: 246 KTVWERRGD----TFVCVEAPKTQVI--EGDDADYTACMLGLRDYVEKIGFPGVVLGLSG 299

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           G+DSALCAA+AVDALG+E V  +MLPY+YTS +SL DA ACA ALG +YD++PI   V  
Sbjct: 300 GVDSALCAALAVDALGREKVHAVMLPYRYTSQESLIDAKACATALGLRYDIVPIAPAVEG 359

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F +L++        G+  EN+QSR RG +LM++SN   +ML+TT NKSE+SVGY T+YGD
Sbjct: 360 FETLLAPMFAGTAPGLTEENLQSRTRGTVLMSISNKFGSMLVTTGNKSEMSVGYATIYGD 419

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YKTQVF+L   RN       LGP  EVIP +I+ K PSAELR +Q DQ+
Sbjct: 420 MNGGFNPIKDIYKTQVFRLCHLRNRWKPKGALGPDGEVIPYNIIVKPPSAELRENQKDQD 479

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPY ILD I++ +VE ++   +     Y + T+R VE LLY +EYKRRQ+  G K+T 
Sbjct: 480 SLPPYDILDGILEGLVEKDQGVADLVAAGYEEPTIRRVERLLYLAEYKRRQSAPGVKVTR 539

Query: 541 KSFGRDRLYPISNKFRDH 558
           ++FGRDR YPI N FRD 
Sbjct: 540 RNFGRDRRYPIVNGFRDR 557


>gi|90423585|ref|YP_531955.1| NAD synthetase [Rhodopseudomonas palustris BisB18]
 gi|90105599|gb|ABD87636.1| NH(3)-dependent NAD(+) synthetase [Rhodopseudomonas palustris
           BisB18]
          Length = 587

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 285/560 (50%), Positives = 371/560 (66%), Gaps = 13/560 (2%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            KI +AQLNP VGDIAGN   AR AR  A   G  LI+F ELFISGYPPEDLV K +F  
Sbjct: 10  FKITLAQLNPTVGDIAGNAGLARAARARAAADGAQLIVFPELFISGYPPEDLVLKPAFQA 69

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC +A++ L  DT DGG  ++VG P  D   + N+  +LDAG I A+R K+NLPNY  F 
Sbjct: 70  ACRAAVEDLARDTADGGPAMLVGSPWVDGGKLYNACALLDAGAIAAIRFKVNLPNYGVFD 129

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNS-----NICKHLKKQGAEFLFSLNASPY 179
           EKR F  G  + P+  R +R+G+ ICED W        N+ + L + GAE L   N SPY
Sbjct: 130 EKRVFCRGPVSGPVTIRGVRVGVPICEDTWMEESADYENVVECLAETGAEILIVPNGSPY 189

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
              K   R  +   +++   LP+IYVNQVGGQDEL+FDGASF  +  + LA Q+  F + 
Sbjct: 190 ARGKADLRLSVQVARVTESDLPLIYVNQVGGQDELVFDGASFALNADRTLAAQLPAFEQS 249

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
             +T   +    S W     D A    I  +++EADY ACVL LRDYV KN F  V++G+
Sbjct: 250 --LTTLRWVNGDSGWRC---DGAIAPVI--EDDEADYAACVLGLRDYVNKNGFPGVLLGI 302

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSALCAAIAVDALG E V+ +MLP+++T+  SL+DAA  A ALG KY+VLPI   V
Sbjct: 303 SGGIDSALCAAIAVDALGVERVRGVMLPFRFTAQVSLDDAAKLAGALGFKYEVLPIAQAV 362

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F  +++   +  P  I  EN+Q+R RG +LMA+SN + AM++TT NKSE+SVGY TLY
Sbjct: 363 NGFEEILAGTFRGLPRDITEENLQARTRGTLLMAISNKTGAMVVTTGNKSEMSVGYATLY 422

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGFNP+KD+YKT+VF+L + RN+      LGP  EVIP +I+ + P+AELR +QTD
Sbjct: 423 GDMNGGFNPIKDIYKTEVFRLCTLRNAWKPDGALGPSGEVIPVNIITRPPTAELRENQTD 482

Query: 480 QESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLPPY ILD I++R+VE E+         ++ +TV  ++ LL  +EYKRRQA  G K+
Sbjct: 483 QDSLPPYDILDGILERLVEREQPLAEIVAAGFDRDTVVRIDRLLNIAEYKRRQAAPGVKV 542

Query: 539 TAKSFGRDRLYPISNKFRDH 558
           T K+FGRDR YPI+N+FRD 
Sbjct: 543 TRKNFGRDRRYPITNRFRDS 562


>gi|298290916|ref|YP_003692855.1| NAD+ synthetase [Starkeya novella DSM 506]
 gi|296927427|gb|ADH88236.1| NAD+ synthetase [Starkeya novella DSM 506]
          Length = 557

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 276/557 (49%), Positives = 376/557 (67%), Gaps = 12/557 (2%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           +L IA AQLNPVVGDIAGN+ KAR AR +A  QG +L+LFTELFI+GYP EDLV K +F 
Sbjct: 8   QLLIAFAQLNPVVGDIAGNLIKAREARAQAAEQGAELVLFTELFIAGYPLEDLVLKPAFQ 67

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
            AC +A++ L  DT DGG  +++G P  D + + N+V++LD G ++  R K++LPNY  F
Sbjct: 68  AACRAAVEELAKDTADGGPAVLIGSPWADGDKLYNAVLLLDGGKVVTARYKVDLPNYGVF 127

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            EKR F  G    PI F+ +R+G+ +CEDIW + ++ + L + G+E L   N SPY    
Sbjct: 128 DEKRVFAPGPMPGPIPFKGVRIGVPVCEDIW-SQDVIECLAETGSELLLIPNGSPYRRTV 186

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
             +R  +   ++    LP+ YVNQVGGQDEL+FDGASF  +  + LA QM +F E+  +T
Sbjct: 187 YDERMNVAVARVVESGLPLAYVNQVGGQDELVFDGASFVLNADRSLAVQMPNFQERIRLT 246

Query: 244 EWHYDQQLSQW--NYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
            W       +W   +  ++ A +    L ++EADY ACV+ LRDYV+KN F  V++GLSG
Sbjct: 247 RWE------RWAEGWRCEEGARSPL--LLDDEADYAACVMGLRDYVEKNRFPGVVLGLSG 298

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           G+DSAL AA+AVDALG E V  +MLPY+YTS +SL DAAA A+ALG +YD++PI + V  
Sbjct: 299 GVDSALVAAMAVDALGAERVHCVMLPYRYTSNESLSDAAAVAEALGVRYDIVPIAESVEA 358

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
              +++      P  +  EN+QSR+RG +LM++SN   +M++TT NKSE+S GY TLYGD
Sbjct: 359 LEKVLAPMFDGRPRDVTEENLQSRVRGTLLMSISNKFGSMVVTTGNKSEMSTGYATLYGD 418

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GG+NPLKDLYKTQVF+L   RN       LGP   V+P +++ K P+AELR +Q DQ+
Sbjct: 419 MNGGYNPLKDLYKTQVFRLCHLRNRWKPAYALGPSGAVMPENVIVKPPTAELRENQKDQD 478

Query: 482 SLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPY +LD I+ R+VE E    +   E  D T V  VE +L  +EYKRRQA  G K+TA
Sbjct: 479 SLPPYDVLDAILLRLVEREMPVADIVAEGYDATLVARVERMLNIAEYKRRQAAPGVKVTA 538

Query: 541 KSFGRDRLYPISNKFRD 557
           ++FGRDR YPI+N+FR+
Sbjct: 539 RNFGRDRRYPITNRFRE 555


>gi|27378891|ref|NP_770420.1| NAD synthetase [Bradyrhizobium japonicum USDA 110]
 gi|27352040|dbj|BAC49045.1| NAD synthetase [Bradyrhizobium japonicum USDA 110]
          Length = 585

 Score =  548 bits (1412), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 278/566 (49%), Positives = 370/566 (65%), Gaps = 19/566 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L    + +AQLNP VGD+ GN A+AR AR  A   G DL+LF ELFI+GYPPEDLV K +
Sbjct: 5   LNAFAVTLAQLNPTVGDVEGNAARARAARVRAAADGADLVLFPELFIAGYPPEDLVQKPA 64

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F  AC +AI+ L  +T DGG  ++VG P  +   + N+  +LD G I  +R K NLPNY 
Sbjct: 65  FQAACRAAIEGLARETADGGPAMLVGTPWVEDGKLYNACALLDGGRIAGLRFKCNLPNYG 124

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNS-----NICKHLKKQGAEFLFSLNA 176
            F EKR F  G +  P+  R +R+G+ ICEDIW +      N+ + L + GAE +   N 
Sbjct: 125 VFDEKRLFARGPAAGPVTVRGVRIGVPICEDIWLDESEDYENVVETLAETGAEIILVPNG 184

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY  +K   R  +   +++   LP++Y+NQV GQDEL+FDGASF  +G   LA Q+  F
Sbjct: 185 SPYARDKNDVRLSVAVARVTESGLPLVYLNQVCGQDELVFDGASFALNGDLSLAAQLPAF 244

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
           +E   +T   + +    W      +A       + + ADY ACVL LRDYV KN F  V+
Sbjct: 245 AES--ITTLRFTRNGEDWRCAGPIAAQP-----EGDHADYAACVLGLRDYVAKNGFPGVL 297

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +G+SGGIDSALCAAIAVDALG + V  +MLPY+YT+  S+ DA   A  LG +Y+VLPI 
Sbjct: 298 LGISGGIDSALCAAIAVDALGADQVHGVMLPYRYTAASSIADAGELAGHLGIRYEVLPIA 357

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
           + V  F +++S   +  P  I  EN+Q+R RG +LMA+SN +  M++TT NKSE+SVGY 
Sbjct: 358 EAVTGFETILSGIFKNLPPDITEENLQARTRGTLLMAISNKTGLMVVTTGNKSEMSVGYA 417

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGFNP+KD+YKTQVF+LA+ RNS     GLGP  EVIPP I+ + P+AELR +
Sbjct: 418 TLYGDMNGGFNPIKDIYKTQVFRLAALRNSWRPEGGLGPAGEVIPPDIITRPPTAELREN 477

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFINNDQ----EYNDETVRYVEHLLYGSEYKRRQA 532
           QTDQ+SLP Y +LD I++R+VE EE     DQ     ++ ETV  ++HLL  +EYKRRQA
Sbjct: 478 QTDQDSLPTYDVLDAILERLVEREEPL---DQIIAAGFDRETVTRIDHLLNVAEYKRRQA 534

Query: 533 PVGTKITAKSFGRDRLYPISNKFRDH 558
             G K+T ++FGRDR YPI+N+FRD 
Sbjct: 535 APGVKVTPRNFGRDRRYPITNRFRDK 560


>gi|312115466|ref|YP_004013062.1| NAD+ synthetase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220595|gb|ADP71963.1| NAD+ synthetase [Rhodomicrobium vannielii ATCC 17100]
          Length = 554

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 282/560 (50%), Positives = 373/560 (66%), Gaps = 8/560 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    +IA AQLNPV+GD+AGN+A AR AR++A     DL++FTELFI+GYPPEDL+ K 
Sbjct: 1   MTASFRIACAQLNPVLGDLAGNVALARAARDDARALAADLVVFTELFIAGYPPEDLILKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+ AC  A   L + T DGG  +++G P  +     N+V +L  G I A+R K++LPNY
Sbjct: 61  AFVAACMEATRALAATTADGGPALLIGTPWGEDGKAYNAVALLAGGRIQALRYKVDLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F EKR F  G   +P+ F  +RLG+ ICEDIW  + +   L  +GAE L S N SP+ 
Sbjct: 121 SVFDEKRVFAPGPLPEPVDFAGLRLGLPICEDIWTPA-VVGSLAARGAELLISPNGSPFT 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R ++   +++   LP++Y+NQ GGQDEL+FDGASF  +    LA Q+  +    
Sbjct: 180 LKKRTQRLDVARARVAETGLPLLYINQFGGQDELVFDGASFALNRDGALAAQLPAWETAL 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +TEW  D     W  +   SA       +  EA Y ACV+ LRDYV+KN F  V++GLS
Sbjct: 240 AITEWRRDA--GGWACVEGPSARVE----EGREAAYLACVIGLRDYVEKNRFPGVVLGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+CAA+A DALG   V  IMLPY+YTS  SL+DAAACA+ALG +YD++PIH  V 
Sbjct: 294 GGIDSAICAAMATDALGAARVHCIMLPYRYTSNASLDDAAACAEALGVRYDIVPIHTAVE 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F  +++   +    G+  EN+QSRIRG  LMA+SN    M++TT NKSE+S GY TLYG
Sbjct: 354 AFGGMLAPLFKGAEPGLAEENLQSRIRGTTLMAVSNKFGGMVVTTGNKSEVSAGYATLYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNP+KDLYKTQVF L+ +RN H     LGP   VIP +I+ K+P+AELR +QTDQ
Sbjct: 414 DMNGGFNPIKDLYKTQVFALSRFRNEHVPKGCLGPGGVVIPDNIITKAPTAELRENQTDQ 473

Query: 481 ESLPPYPILDDIIKRIVENEESF-INNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LDDI++ +V+ EE       + +  ETV+ VE LLY SEYKRRQA  G KIT
Sbjct: 474 DSLPPYDVLDDILESLVDREEPLSAVVARGHAPETVKKVERLLYLSEYKRRQAAPGVKIT 533

Query: 540 AKSFGRDRLYPISNKFRDHI 559
            ++FGRDR YPI N+FR+ +
Sbjct: 534 ERNFGRDRRYPIVNRFREQL 553


>gi|158422537|ref|YP_001523829.1| NAD synthetase [Azorhizobium caulinodans ORS 571]
 gi|158329426|dbj|BAF86911.1| NAD+ synthase [Azorhizobium caulinodans ORS 571]
          Length = 566

 Score =  545 bits (1405), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 271/556 (48%), Positives = 367/556 (66%), Gaps = 9/556 (1%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           + L+IA+AQLNPVVGD+AGN  K R AR+EA  QG DL++F+ELF++GYPPEDLV K +F
Sbjct: 17  ETLRIAVAQLNPVVGDVAGNAEKVRMARDEAALQGADLVVFSELFLAGYPPEDLVLKPAF 76

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
            QAC +A+D L ++T  GG  ++VG P  +   + N V +L+ G I A R K++LPNY  
Sbjct: 77  QQACRAALDELAAETV-GGPALLVGAPWVEDGHLHNGVFLLEGGRIAAKRFKVDLPNYGV 135

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F+ G    PI F+ +RLG+ +CEDIW   ++ + L + GAE L   N SPY  +
Sbjct: 136 FDEKRVFVPGPLPGPIPFKGVRLGVPVCEDIW-GPDVVECLSETGAEILIVPNGSPYRRS 194

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
              +R  I   ++    LP++YVNQVGGQDEL+FDGASF  +  +    Q   F+E+   
Sbjct: 195 VYDERANIAVARVVESGLPLLYVNQVGGQDELVFDGASFALNADRTQVMQFPGFAERVRT 254

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
           T+W   +  + W       A      L+ + ADY ACVL L+DYV KN F  V++GLSGG
Sbjct: 255 TQWRRYE--NGWKCEEAPFADR----LEGDRADYAACVLGLKDYVNKNRFPGVVLGLSGG 308

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSA+CAA+AVDALG E V  IMLPY++TS  SL DAA  A+ LG +YD LPI   V   
Sbjct: 309 IDSAICAAMAVDALGPERVHCIMLPYRFTSQDSLSDAADVARRLGVRYDTLPIAPAVEAL 368

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
             +++         +  EN+QSR+RG +LM++SN   AM++TT NKSE+S GY TLYGDM
Sbjct: 369 EGVLAPLFAGRERDVTEENLQSRVRGTLLMSVSNKFGAMVVTTGNKSEMSTGYATLYGDM 428

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GG+NP+KDLYKT+VF+L+  RN+   T  LGP   VIP ++++K P+AELR +Q DQ+S
Sbjct: 429 NGGYNPIKDLYKTEVFRLSRLRNTWKPTGALGPDGIVIPDALIDKPPTAELRENQKDQDS 488

Query: 483 LPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY +LD I+ R+VE E        + ++   V+ VE +L  +EYKRRQA  G K+T +
Sbjct: 489 LPPYEVLDAILARLVEAETPVAQLIADGFDPAVVKRVERMLNIAEYKRRQAAPGVKVTTR 548

Query: 542 SFGRDRLYPISNKFRD 557
           +FGRDR YPI+N FRD
Sbjct: 549 NFGRDRRYPITNGFRD 564


>gi|192290590|ref|YP_001991195.1| NAD synthetase [Rhodopseudomonas palustris TIE-1]
 gi|192284339|gb|ACF00720.1| NAD+ synthetase [Rhodopseudomonas palustris TIE-1]
          Length = 587

 Score =  545 bits (1403), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 279/561 (49%), Positives = 376/561 (67%), Gaps = 13/561 (2%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           +L I++AQLNP VGDIAGN  KAR AR +A   G DLI++ ELFI+GYPPEDLV K +F 
Sbjct: 7   RLTISLAQLNPTVGDIAGNADKARAARRQAAADGADLIVYPELFIAGYPPEDLVLKPAFQ 66

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
            AC +AI+ L  +T DGG  +++G P  D   + N+  +LD G I A+R K+NLPNY  F
Sbjct: 67  AACRAAIEDLARETADGGPAMLIGSPWVDNGKLYNACALLDGGRIAAIRHKVNLPNYGVF 126

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNS-----NICKHLKKQGAEFLFSLNASP 178
            EKR F  G  + P+  R +R+G+ ICED W        N+ + L + GAE L   N SP
Sbjct: 127 DEKRVFARGPVSGPVTIRGVRIGVPICEDTWLEESEDYENVVECLAETGAELLVVPNGSP 186

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K   R  +   +++   LP++YVNQVGGQDEL+FDGASF  +  + LA Q+  F E
Sbjct: 187 YARGKNDMRMSVSVARVTESDLPLVYVNQVGGQDELVFDGASFVLNADRTLAAQLPGFVE 246

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
              +T   + +  + W    D   + +   ++ +EADY ACVL LRDYV+KN F  V++G
Sbjct: 247 S--VTTLSFVKGAAGWR--CDGPVAPV---IEGDEADYAACVLGLRDYVRKNGFPGVLLG 299

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           +SGGIDSALCAAIAVDALG + V+ +MLP++YT+  SL+DA   A ALG  Y+VLPI   
Sbjct: 300 ISGGIDSALCAAIAVDALGADKVRGVMLPFRYTAQISLDDAGRLASALGFGYEVLPIAQA 359

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V  F +++++        I  EN+Q+R RG +LMA+SN + AM++TT NKSE+SVGY TL
Sbjct: 360 VEGFEAILAKPFAGLERDITEENLQARTRGTLLMAISNKTGAMVVTTGNKSEMSVGYATL 419

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGFNP+KD+YKTQVF+L+S RN       LGP  EVIP SI+ + P+AELR +QT
Sbjct: 420 YGDMNGGFNPIKDIYKTQVFRLSSLRNRWKPDDALGPDGEVIPESIIIRPPTAELRENQT 479

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLPPY +LD I++R+VE E+   +   E ++ +TV  ++ LL  +EYKRRQA  G K
Sbjct: 480 DQDSLPPYDVLDAILERLVEREQPLASIVAEGFDKDTVVRIDRLLNIAEYKRRQAAPGVK 539

Query: 538 ITAKSFGRDRLYPISNKFRDH 558
           +T K+FGRDR YPI+N+FRD 
Sbjct: 540 VTRKNFGRDRRYPITNRFRDK 560


>gi|75675418|ref|YP_317839.1| NAD synthetase [Nitrobacter winogradskyi Nb-255]
 gi|74420288|gb|ABA04487.1| NH(3)-dependent NAD(+) synthetase [Nitrobacter winogradskyi Nb-255]
          Length = 583

 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 276/560 (49%), Positives = 362/560 (64%), Gaps = 13/560 (2%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            KI + QLNP VGDI GN AKAR AR +A   G  L+   ELFI+GYPPEDLV + +F  
Sbjct: 6   FKITLGQLNPTVGDIVGNAAKARAARAQAKADGAALVALPELFIAGYPPEDLVLRPAFQA 65

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  AI+ L  +T DGG  +++G P  D   + N+  +LD G + A+R K+NLPNY  F 
Sbjct: 66  ACREAIEALARETSDGGPAMLIGTPWVDDGKLYNAYALLDEGRVAALRFKVNLPNYGVFD 125

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIW-----KNSNICKHLKKQGAEFLFSLNASPY 179
           EKR F  G    P+  R +R+G+ ICED W     +  N+ + L + GAE L   N SPY
Sbjct: 126 EKRVFARGPVGGPLKIRGVRIGVPICEDTWVEESAEYENVVECLAETGAEILVVPNGSPY 185

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
              K   R  I   +++   LP++Y+NQVGGQDEL+FDGASF  +  + LA Q+  F E 
Sbjct: 186 AKGKSDIRLSISVARVTESDLPLVYLNQVGGQDELVFDGASFVLNADRSLAAQLPFFEES 245

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
            F  +W    +   W       A  +   +  ++ADY ACVL LRDYV+KN F  V++G+
Sbjct: 246 VFTLQWTRSAE--GWR-----CAGPVAPQIDGDKADYAACVLGLRDYVRKNGFPGVLLGV 298

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSALCAAIAVDALG E V+ +MLP+++T+  SL+DAA  A ALG +YDVLPI   V
Sbjct: 299 SGGIDSALCAAIAVDALGAEQVRGVMLPFRFTAQVSLDDAARLATALGIRYDVLPIAQAV 358

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F  ++S      P  I  EN+QSR RG +LMA+SN   AM++TT NKSE+SVGY TLY
Sbjct: 359 NGFEEILSGVFAGAPRDITEENLQSRARGTLLMAMSNKLGAMVVTTGNKSEMSVGYATLY 418

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGFNP+KD+YKT+V ++AS RN+      LGP  EVIPP  + + P+AELR  Q D
Sbjct: 419 GDMNGGFNPIKDIYKTEVLRMASLRNAWKPDGALGPSGEVIPPGAISRPPTAELREGQLD 478

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLPPY +LD I++R+VE EE       E ++ + V  V+ LL  +EYKRRQA  G K+
Sbjct: 479 QDSLPPYDLLDAILERLVEREEPLAAIVAEGFDHDVVVRVDRLLNAAEYKRRQAAPGVKV 538

Query: 539 TAKSFGRDRLYPISNKFRDH 558
           T ++FGRDR YPI+N+FRD 
Sbjct: 539 TRRNFGRDRRYPITNRFRDS 558


>gi|316934840|ref|YP_004109822.1| NAD+ synthetase [Rhodopseudomonas palustris DX-1]
 gi|315602554|gb|ADU45089.1| NAD+ synthetase [Rhodopseudomonas palustris DX-1]
          Length = 585

 Score =  542 bits (1397), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 280/561 (49%), Positives = 376/561 (67%), Gaps = 13/561 (2%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           +L I++AQLNP+VGDIAGN  KAR AR +A   G DLI++ ELFI+GYPPEDLV K +F 
Sbjct: 7   RLTISLAQLNPMVGDIAGNADKARAARRQAAADGADLIVYPELFIAGYPPEDLVLKPAFQ 66

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
            AC +AI+ L  +T DGG  +++G P  D   + N+  +LD G I A+R K+NLPNY  F
Sbjct: 67  AACRAAIEELARETADGGPAMLIGSPWVDGGKLYNACALLDGGRIAALRFKVNLPNYGVF 126

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIW-----KNSNICKHLKKQGAEFLFSLNASP 178
            EKR F  G    P+  R +R+G+ ICED W     +  N+ + L + GAE L   N SP
Sbjct: 127 DEKRVFSRGPVAGPMTIRGVRIGVPICEDTWLEESDEYENVVECLAETGAEILIVPNGSP 186

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K   R  +   +++   LP++Y+NQVGGQDEL+FDGASF  +  + LA Q+  F E
Sbjct: 187 YAGGKTDLRMSVSVARVTESDLPLVYLNQVGGQDELVFDGASFVLNADRTLAAQLPGFVE 246

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
              +T   + +  + W    D   + +   L+ +EADY ACVL LRDYV+KN F  V++G
Sbjct: 247 S--ITTLSFVRGAAGWR--CDGPVAPV---LEGDEADYAACVLGLRDYVRKNGFPGVLLG 299

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           +SGGIDSALCAAIAVDALG   V+ +MLP++YT+  SL+DA   A ALG  Y+VLPI   
Sbjct: 300 ISGGIDSALCAAIAVDALGAGKVRGVMLPFRYTAQVSLDDAGRLAGALGFGYEVLPIAQA 359

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V  F +++++        I  EN+Q+R RG +LMA+SN + AM++TT NKSE+SVGY TL
Sbjct: 360 VEGFEAILAKPFAGLARDITEENLQARTRGTLLMAISNKTGAMVVTTGNKSEMSVGYATL 419

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGFNP+KD+YKTQVF+L+S RN       LGP  EVIP SI+ + P+AELR +QT
Sbjct: 420 YGDMNGGFNPIKDIYKTQVFRLSSLRNRWKPDDALGPDGEVIPESIIIRPPTAELRENQT 479

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLPPY +LD I++R+VE EE   +   E ++ +TV  ++ LL  +EYKRRQA  G K
Sbjct: 480 DQDSLPPYDVLDAILQRLVEREEPLASIVAEGFDKDTVVRIDRLLNIAEYKRRQAAPGVK 539

Query: 538 ITAKSFGRDRLYPISNKFRDH 558
           +T K+FGRDR YPI+N+FRD 
Sbjct: 540 VTRKNFGRDRRYPITNRFRDK 560


>gi|115524006|ref|YP_780917.1| NAD synthetase [Rhodopseudomonas palustris BisA53]
 gi|115517953|gb|ABJ05937.1| NH(3)-dependent NAD(+) synthetase [Rhodopseudomonas palustris
           BisA53]
          Length = 587

 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 274/558 (49%), Positives = 371/558 (66%), Gaps = 13/558 (2%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           + +AQLNP VGDIAGN AKAR AR +A   G DLI+F ELF+SGYPPEDLV K +F  AC
Sbjct: 12  VTLAQLNPTVGDIAGNAAKARVARAQARDDGADLIVFPELFLSGYPPEDLVLKPAFQAAC 71

Query: 67  SSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEK 126
            +A++ L  +T DGG  +++G P  D   + N+  +LDAG I ++R K+NLPNY  F EK
Sbjct: 72  RAAVEELARETADGGPAMLIGSPWVDDGRLYNACALLDAGAIASIRYKVNLPNYGVFDEK 131

Query: 127 RTFISGYSNDPIVFRDIRLGILICEDIWKNS-----NICKHLKKQGAEFLFSLNASPYYH 181
           R F  G  + P+  R +R+G+ ICED W        N+ + L + GAE L   N SPY  
Sbjct: 132 RVFARGPVSGPMTIRGVRVGVPICEDTWMEESADYENVVECLAETGAELLIVPNGSPYAR 191

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K   R  +   +++   LP++Y+NQVGGQDEL+FDGASF  +    LA Q+  F E   
Sbjct: 192 GKNDIRLAVQVARVTESDLPLVYLNQVGGQDELVFDGASFVLNADCSLAAQLPGFRESVV 251

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
              W+     +   +  +   + +   L  +E DY ACVL LRDYV+KN F  V++G+SG
Sbjct: 252 TLRWNK----TNTGWRCEGPVAPL---LDGDEGDYAACVLGLRDYVRKNGFPGVLLGVSG 304

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSALCAAIAVDALG + ++ +MLP++YT+  SL+DAA  A ALG  Y VLPI   V  
Sbjct: 305 GIDSALCAAIAVDALGADKLRGVMLPFRYTAQVSLDDAAKLAAALGFNYAVLPIAQAVEG 364

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F +++++  +  P  I  EN+Q+R RG +LMA+SN + AM++TT NKSE+SVGY TLYGD
Sbjct: 365 FEAILAETFKGLPRDITEENLQARTRGTLLMAISNKTGAMVVTTGNKSEMSVGYATLYGD 424

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YKT+VF+L+S RN       LGP  EVIP +I+ + P+AELR +QTDQ+
Sbjct: 425 MNGGFNPIKDIYKTEVFRLSSLRNRWKPDDALGPSGEVIPENIITRPPTAELRENQTDQD 484

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPY ILD I++R+VE E+   +     ++ +TV  ++ LL  +EYKRRQA  G K+T 
Sbjct: 485 SLPPYDILDGILERLVEREQPLADIVAAGFDRDTVARIDRLLNVAEYKRRQAAPGVKVTR 544

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 545 KNFGRDRRYPITNRFRDS 562


>gi|39935055|ref|NP_947331.1| NAD synthetase [Rhodopseudomonas palustris CGA009]
 gi|39648906|emb|CAE27427.1| NH3-dependent NAD synthetase [Rhodopseudomonas palustris CGA009]
          Length = 584

 Score =  541 bits (1394), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 278/561 (49%), Positives = 375/561 (66%), Gaps = 13/561 (2%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           +L I++AQLNP VGDIAGN  KAR AR  A   G DL+++ ELFI+GYPPEDLV K +F 
Sbjct: 6   RLTISLAQLNPTVGDIAGNADKARAARRRAAADGADLVVYPELFIAGYPPEDLVLKPAFQ 65

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
            AC +AI+ L  +T DGG  +++G P  D   + N+  +LD G I A+R K+NLPNY  F
Sbjct: 66  AACRAAIEDLARETADGGPAMLIGSPWVDNGKLYNACALLDGGRIAAIRHKVNLPNYGVF 125

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNS-----NICKHLKKQGAEFLFSLNASP 178
            EKR F  G  + P+  R +R+G+ ICED W        N+ + L + GAE L   N SP
Sbjct: 126 DEKRVFARGPVSGPVTIRGVRIGVPICEDTWLEESEDYENVVECLAETGAELLVVPNGSP 185

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K   R  +   +++   LP++YVNQVGGQDEL+FDGASF  +  + LA Q+  F E
Sbjct: 186 YARGKNDMRMSVSVARVTESDLPLVYVNQVGGQDELVFDGASFVLNADRTLAAQLPGFVE 245

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
              +T   + +  + W    D   + +   ++ +EADY ACVL LRDYV+KN F  V++G
Sbjct: 246 S--VTTLSFVKGAAGWR--CDGPVAPV---IEGDEADYAACVLGLRDYVRKNGFPGVLLG 298

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           +SGGIDSALCAAIAVDALG + V+ +MLP++YT+  SL+DA   A ALG  Y+VLPI   
Sbjct: 299 ISGGIDSALCAAIAVDALGADKVRGVMLPFRYTAQISLDDAGRLASALGFGYEVLPIAQA 358

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V  F +++++        I  EN+Q+R RG +LMA+SN + AM++TT NKSE+SVGY TL
Sbjct: 359 VEGFEAILAKPFAGLERDITEENLQARTRGTLLMAISNKTGAMVVTTGNKSEMSVGYATL 418

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGFNP+KD+YKTQVF+L+S RN       LGP  EVIP SI+ + P+AELR +QT
Sbjct: 419 YGDMNGGFNPIKDIYKTQVFRLSSLRNRWKPDDALGPDGEVIPESIIIRPPTAELRENQT 478

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLPPY +LD I++R+VE EE   +   + ++ +TV  ++ LL  +EYKRRQA  G K
Sbjct: 479 DQDSLPPYDVLDAILERLVEREEPLASIVADGFDKDTVVRIDRLLNIAEYKRRQAAPGVK 538

Query: 538 ITAKSFGRDRLYPISNKFRDH 558
           +T K+FGRDR YPI+N+FRD 
Sbjct: 539 VTRKNFGRDRRYPITNRFRDK 559


>gi|154245324|ref|YP_001416282.1| NAD synthetase [Xanthobacter autotrophicus Py2]
 gi|154159409|gb|ABS66625.1| NAD+ synthetase [Xanthobacter autotrophicus Py2]
          Length = 569

 Score =  541 bits (1393), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 279/554 (50%), Positives = 376/554 (67%), Gaps = 9/554 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L IA+AQLNP VGD+AGN+  ARR    A   G DL++F ELFI+GYPPEDLV K +F Q
Sbjct: 23  LFIAVAQLNPTVGDVAGNLDLARRTSAGARDAGADLVVFPELFIAGYPPEDLVLKPAFQQ 82

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC +AI+TL ++T DG A +++G P  ++  + NSV++L+ G I AVR K++LPNY  F 
Sbjct: 83  ACRAAIETLAAETADGPA-LLIGAPWVEEGKLYNSVLLLENGGISAVRHKVDLPNYGVFD 141

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    PI F+ +RLG+ ICEDIW  +++ + L + GAE L   N SPY  +  
Sbjct: 142 EKRVFTPGPLPGPIPFKGVRLGVPICEDIW-GADVVECLAETGAELLIVPNGSPYRQSVY 200

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +R  +   ++   HLP++YVNQVGGQDEL+FDGASF  +  + LA Q   F E+  +++
Sbjct: 201 AERENVAVARVVESHLPLLYVNQVGGQDELVFDGASFALNPDRFLALQFPGFMERVRISK 260

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   +  + W  +  + A      ++ +EADY ACVL LRDYV KN F  V++GLSGGID
Sbjct: 261 WQRFE--NGWKCLGANLADR----IEGDEADYAACVLGLRDYVNKNRFPGVVLGLSGGID 314

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+AVDALG E V  IMLPY+YTS +SL DAAA A+AL  +YDVLPI   V    +
Sbjct: 315 SAICAAMAVDALGPERVHCIMLPYRYTSEESLADAAAVAQALFVRYDVLPIVAGVEGMEA 374

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++   +     +  EN+QSR+RG +LM++SN   AM++TT NKSE+S GY TLYGDM+G
Sbjct: 375 ALAPLFEGTQRDVTEENLQSRVRGALLMSVSNKFGAMVVTTGNKSEMSTGYATLYGDMNG 434

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           G+NP+KDLYKTQV +L+  RN       LGP   VIP S+++K P+AELR +Q D++SLP
Sbjct: 435 GYNPIKDLYKTQVTRLSRLRNRWKPADALGPDGVVIPDSLIDKPPTAELRENQKDEDSLP 494

Query: 485 PYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY +LD I++R+VE E S      + +N  TV  VE LL  +EYKRRQA  G K+T ++F
Sbjct: 495 PYAVLDAILERLVEREHSVAQIIADGFNAATVTRVERLLNIAEYKRRQAAPGVKVTGRNF 554

Query: 544 GRDRLYPISNKFRD 557
           GRDR YPI+N+FR+
Sbjct: 555 GRDRRYPITNRFRE 568


>gi|91976537|ref|YP_569196.1| NAD synthetase [Rhodopseudomonas palustris BisB5]
 gi|91682993|gb|ABE39295.1| NH(3)-dependent NAD(+) synthetase [Rhodopseudomonas palustris
           BisB5]
          Length = 585

 Score =  539 bits (1388), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 279/561 (49%), Positives = 376/561 (67%), Gaps = 13/561 (2%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           +L I++AQLNP VGDIAGN A AR AR +A  +G +L++F ELFISGYPPEDLV K +F 
Sbjct: 7   RLTISLAQLNPTVGDIAGNAAMARAARAQAAAEGAELVVFPELFISGYPPEDLVLKPAFQ 66

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
            AC +A++ L  +T DGG  +++G P  D   + N+  +LD G I A+R K+NLPNY  F
Sbjct: 67  TACRAAVEDLARETADGGPAMLIGSPWLDGGKLYNACALLDGGRIAAIRTKVNLPNYGVF 126

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNS-----NICKHLKKQGAEFLFSLNASP 178
            EKR F  G  + P+  R +R+G+ ICED W        N+ + L + GAE L   N SP
Sbjct: 127 DEKRVFSRGPVSGPMTIRGVRVGVPICEDTWLEESEDYENVVECLAETGAEILIVPNGSP 186

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K   R  +   +++   LP++Y+NQVGGQDEL+FDGASF  +  + LA Q+  F+E
Sbjct: 187 YARGKSDLRLSVQVARVTESDLPLVYLNQVGGQDELVFDGASFVLNADRSLAAQLPAFAE 246

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
              +T  H+ +  S W      + +     L  +E DY ACVL LRDYV+KN F  V++G
Sbjct: 247 S--ITTLHWQKGASGWRCDGPVAPT-----LDGDEGDYAACVLGLRDYVRKNGFPGVLLG 299

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           +SGGIDSALCAAIAVDALG + V+ +MLP++YT+  SL+DA   A+ALG  Y+VLPI   
Sbjct: 300 ISGGIDSALCAAIAVDALGADKVRGVMLPFRYTAQISLDDADGLARALGFGYEVLPIAAA 359

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           VN F  ++++        I  EN+Q+R RG +LMA+SN + AM++TT NKSE+SVGY TL
Sbjct: 360 VNGFEDILAKPFAGLERDITEENLQARTRGTLLMAISNKTGAMVVTTGNKSEMSVGYATL 419

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGFNP+KD+YKT+VF+L+S RN       LGP  EVIP SI+ + P+AELR +QT
Sbjct: 420 YGDMNGGFNPIKDIYKTEVFRLSSLRNRWKPDGALGPDGEVIPESIIVRPPTAELRENQT 479

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLPPY +LD I++R+VE EE       E ++ +TV  ++ LL  +EYKRRQA  G K
Sbjct: 480 DQDSLPPYEVLDAILERLVEREEPLATIVAEGFDRDTVVRIDRLLNIAEYKRRQAAPGVK 539

Query: 538 ITAKSFGRDRLYPISNKFRDH 558
           +T K+FGRDR YPI+N+FRD 
Sbjct: 540 VTRKNFGRDRRYPITNRFRDK 560


>gi|85715402|ref|ZP_01046384.1| NAD(+) synthase [Nitrobacter sp. Nb-311A]
 gi|85697823|gb|EAQ35698.1| NAD(+) synthase [Nitrobacter sp. Nb-311A]
          Length = 583

 Score =  538 bits (1387), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 276/560 (49%), Positives = 362/560 (64%), Gaps = 13/560 (2%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            KI + QLNP VGDIAGN AKAR AR +A   G  L+   ELFI+GYPPEDLV + +F  
Sbjct: 6   FKITLGQLNPTVGDIAGNAAKARAARAQAKADGAALLALPELFIAGYPPEDLVLRPAFQA 65

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  AI+ L  +T DGG  +++G P  D   + N+  +LD G + A+R K+NLPNY  F 
Sbjct: 66  ACREAIEDLARETSDGGPAMLIGTPWVDDGKLYNAYALLDEGRVAAIRFKVNLPNYGVFD 125

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIW-----KNSNICKHLKKQGAEFLFSLNASPY 179
           EKR F  G    P+  R +R+G+ ICED W     +  NI + L + GAE L   N SPY
Sbjct: 126 EKRVFARGPVGGPLKIRGVRIGVPICEDTWVEESAEYENIVECLAETGAEILIVPNGSPY 185

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
              K   R  I   +++   LP++Y+NQVGGQDEL+FDGASF  +    LA Q   F E 
Sbjct: 186 AKGKSDIRLSISVARVTESDLPLVYLNQVGGQDELVFDGASFVLNADCSLAAQFPAFEES 245

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
               +W    +   W      +       ++ +EADY ACVL LRDYV+KN F  V++G+
Sbjct: 246 IVTLQWTRSAE--GWRCTGPVAPQ-----IEGDEADYAACVLGLRDYVRKNGFPCVLLGV 298

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSALCAAIAVDALG E V+ +MLP ++T+  SL+DAA  A ALG +Y+VLPI   V
Sbjct: 299 SGGIDSALCAAIAVDALGAERVRGVMLPSRFTAQVSLDDAARLATALGIRYEVLPIAPAV 358

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F  ++S      P     EN+QSR RG +LMA+SN + AML+TT NKSE+SVGY TLY
Sbjct: 359 EGFEKILSATFAGLPRDTTEENLQSRARGTLLMAISNKTGAMLVTTGNKSEMSVGYATLY 418

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGFNP+KD++KT+VF+LAS RN+       GP  EVIPPSI+ + P+AELR +Q D
Sbjct: 419 GDMNGGFNPIKDIFKTEVFRLASLRNAWKPDGAFGPSGEVIPPSIIARPPTAELRENQLD 478

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLPPY +LD I++R+VE EE   +   E ++ + +  V+ LL  +EYKRRQA  G K+
Sbjct: 479 QDSLPPYELLDAILERLVEREEPLASIVAEGFDRDVIVRVDRLLNAAEYKRRQAAPGVKV 538

Query: 539 TAKSFGRDRLYPISNKFRDH 558
           T ++FGRDR YPI+N+FRD 
Sbjct: 539 TRRNFGRDRRYPITNRFRDS 558


>gi|86750492|ref|YP_486988.1| NAD synthetase [Rhodopseudomonas palustris HaA2]
 gi|86573520|gb|ABD08077.1| NH(3)-dependent NAD(+) synthetase [Rhodopseudomonas palustris HaA2]
          Length = 585

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 276/561 (49%), Positives = 370/561 (65%), Gaps = 13/561 (2%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           +  I++AQLNP VGDI GN A AR AR +A  +  D+I+F ELFISGYPPEDLV K +F 
Sbjct: 7   RFTISLAQLNPTVGDITGNAAMARAARAQAAAENADVIVFPELFISGYPPEDLVLKPAFQ 66

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
            AC +A++ L  +T DGG  +++G P  D   + N+  +LD G I A+R K+NLPNY  F
Sbjct: 67  AACRAAVEELARETADGGPAMLIGSPWVDGGKLYNACALLDGGRIAAIRFKVNLPNYGVF 126

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNS-----NICKHLKKQGAEFLFSLNASP 178
            EKR F  G    P+  R +R+G+ ICED W        N+ + L + GAE L   N SP
Sbjct: 127 DEKRVFARGPVAGPVTIRGVRVGVPICEDTWLEESEDYENVVECLAETGAEILIVPNGSP 186

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K   R  +   +++   LP++Y+NQVGGQDEL+FDGASF  +  + LA Q+  F+E
Sbjct: 187 YARGKGDLRLSVQVARVTESDLPLVYLNQVGGQDELVFDGASFALNADRSLAAQLPAFAE 246

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
                 W    Q S   +  D   +   +P   +E DY ACVL LRDYV+KN F  V++G
Sbjct: 247 CITTLVW----QKSADGWRCDGPVAA--VP-DGDEGDYAACVLGLRDYVRKNGFPGVLLG 299

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           +SGGIDSALCAAIAVDALG   V+ +MLP++YT+  SL+DA+  A ALG  Y+VLPI   
Sbjct: 300 ISGGIDSALCAAIAVDALGAGRVRGVMLPFRYTAQISLDDASRLANALGFGYEVLPIAQA 359

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V  F +++++        I  EN+Q+R RG +LMA+SN + AM++TT NKSE+SVGY TL
Sbjct: 360 VEGFEAILAKPFAGLARDITEENLQARTRGTLLMAISNKTGAMVVTTGNKSEMSVGYATL 419

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGFNP+KD+YKTQVF+L+S RN       LGP  EVIP SI+ + P+AELR +QT
Sbjct: 420 YGDMNGGFNPIKDIYKTQVFRLSSLRNRWKPDGALGPDGEVIPESIIVRPPTAELRENQT 479

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLPPY +LD I++R+VE E+   +   E ++ +TV  ++ LL  +EYKRRQA  G K
Sbjct: 480 DQDSLPPYEVLDAILERLVEREQPLASIVAEGFDKDTVMRIDRLLNIAEYKRRQAAPGVK 539

Query: 538 ITAKSFGRDRLYPISNKFRDH 558
           +T K+FGRDR YPI+N+FRD 
Sbjct: 540 VTRKNFGRDRRYPITNRFRDK 560


>gi|209885642|ref|YP_002289499.1| glutamine-dependent NAD(+) synthetase [Oligotropha carboxidovorans
           OM5]
 gi|209873838|gb|ACI93634.1| glutamine-dependent NAD(+) synthetase [Oligotropha carboxidovorans
           OM5]
          Length = 584

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 272/566 (48%), Positives = 369/566 (65%), Gaps = 13/566 (2%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           ++  + +AQ+NP VGDI+GN AKA  AR +A   G  L++  ELF+ GYPPED+V K +F
Sbjct: 5   ERFVVTLAQINPTVGDISGNAAKAWAARAKAAADGASLLVLPELFLCGYPPEDIVLKPAF 64

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
              C + I+TL   T DGG  +++G P  D+  + N+V +LD G +  +R K NLPNY  
Sbjct: 65  QARCRAEIETLARATADGGPAVLIGTPWVDEGKLYNAVALLDGGRVAGLRFKANLPNYGV 124

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNS-----NICKHLKKQGAEFLFSLNAS 177
           F EKR F  G +  P+  R +R+G+ ICED W        N+ + L + GAE L   N S
Sbjct: 125 FDEKRIFARGPAAGPLTVRGVRIGVPICEDTWMEESAEYENVVECLAETGAEILIVPNGS 184

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY  NK   R  +   +I+   LP IY+NQVGGQDEL+FDGASF  +  + LA Q+  F 
Sbjct: 185 PYARNKNDIRLSMAVARITESGLPFIYLNQVGGQDELVFDGASFAINADRSLAAQLPCFQ 244

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           E      W  D+      +      S M   L+ + ADY ACVL LRDYV KN F  V++
Sbjct: 245 ESITTLTWLRDEN----GWTCKGPVSPM---LEGDRADYAACVLGLRDYVGKNGFPGVLL 297

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           G+SGGIDSALC AIAVDA+G E V+ +MLPY++T+ +S+EDAA  A+A G +Y+VLPI  
Sbjct: 298 GISGGIDSALCLAIAVDAIGVERVRGVMLPYRFTAKESIEDAARIARAFGIRYEVLPIAA 357

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
            V  F  ++    + +P  +  EN+Q+R RG +LMA+SN    ML+TT NKSE+SVGY T
Sbjct: 358 AVTGFEGILKDTFKGKPRDVTEENLQARTRGVLLMAISNKFGDMLVTTGNKSEMSVGYAT 417

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGFNP+KD+YKT+VF+L+S RNS      LGP  +VIP SI+ + P+AELR +Q
Sbjct: 418 LYGDMNGGFNPIKDIYKTEVFRLSSLRNSWKPEGALGPSGKVIPVSIIARPPTAELRENQ 477

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGT 536
           TDQ+SLPPY ILD I++R+VE++ S     +E ++ +TV  ++ LL  +EYKRRQA  G 
Sbjct: 478 TDQDSLPPYDILDGILERLVEHDMSVAEIVEEGFDRDTVMRIDRLLNLAEYKRRQAAPGV 537

Query: 537 KITAKSFGRDRLYPISNKFRDHISEE 562
           K+T +SFGRDR YPI+N+FRD+   E
Sbjct: 538 KVTRRSFGRDRRYPITNRFRDNGESE 563


>gi|299133610|ref|ZP_07026804.1| NAD+ synthetase [Afipia sp. 1NLS2]
 gi|298591446|gb|EFI51647.1| NAD+ synthetase [Afipia sp. 1NLS2]
          Length = 584

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 276/563 (49%), Positives = 365/563 (64%), Gaps = 17/563 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           K  + +AQLNP VGDIAGN AKAR AR +A   G  L++  ELF+ GYPPED+V K SF 
Sbjct: 6   KFTVTLAQLNPTVGDIAGNAAKARDARAKAAADGAALVVLPELFLCGYPPEDIVLKPSFQ 65

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
             C  A++ L  +T DG   +++G P  ++  + N+V +LD G I  +R K NLPNY  F
Sbjct: 66  ARCRIAVEELARETSDGSPAVLIGTPWVEEGKLYNAVALLDGGRIAGLRFKANLPNYGVF 125

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNS-----NICKHLKKQGAEFLFSLNASP 178
            EKR F  G +  P+  R +R+G+ ICED W        N+ + L + GAE L   N SP
Sbjct: 126 DEKRIFARGPAAGPLTIRGVRIGVPICEDTWMEESAEYENVVECLSETGAEILIVPNGSP 185

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K   R  +  G+++   LP +YVNQVGGQDEL+FDGASF  +  + LA Q+  F E
Sbjct: 186 YARAKNDIRLSMAVGRVTESGLPFVYVNQVGGQDELVFDGASFALNADRSLAAQLPCFEE 245

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQE-EEADYNACVLSLRDYVQKNNFHKVII 297
                 W   +    W      S      PL E + ADY ACVL LRDYV KN F  V++
Sbjct: 246 VTTTLTWT--KSAKGWTCKGPIS------PLIEGDRADYAACVLGLRDYVGKNGFPGVLL 297

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           G+SGGIDSALC AIAVDA+G E V+ +MLP+++T+ +S+EDAA  A+ LG +YDVLPI  
Sbjct: 298 GISGGIDSALCLAIAVDAIGVERVRGVMLPFRFTAKESIEDAARIARGLGIRYDVLPIAA 357

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
            VN F  ++      +P  +  EN+Q+R RG +LMA+SN    ML+TT NKSE+SVGY T
Sbjct: 358 AVNGFEDILKDVFNGKPRDVTEENLQARTRGVLLMAISNKFGDMLVTTGNKSEMSVGYAT 417

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGFNP+KD+YKT+VF+L+S RNS      LGP  +VIP SI+ + P+AELR +Q
Sbjct: 418 LYGDMNGGFNPIKDIYKTEVFRLSSLRNSWKPEGALGPSGKVIPVSIIARPPTAELRENQ 477

Query: 478 TDQESLPPYPILDDIIKRIVENEESF--INNDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           TDQ+SLPPY ILD I++R+VE + S   I  D  ++ +TV  ++ LL  +EYKRRQA  G
Sbjct: 478 TDQDSLPPYEILDGILERLVERDMSVAEIVGDG-FDRDTVLRIDRLLNLAEYKRRQAAPG 536

Query: 536 TKITAKSFGRDRLYPISNKFRDH 558
            K+T K+FGRDR YPI+N+FRD+
Sbjct: 537 VKVTRKNFGRDRRYPITNRFRDN 559


>gi|300023353|ref|YP_003755964.1| NAD+ synthetase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525174|gb|ADJ23643.1| NAD+ synthetase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 575

 Score =  516 bits (1329), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 273/559 (48%), Positives = 357/559 (63%), Gaps = 9/559 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IA+AQLN  VGD+AGN  +A  A  +A     D+I+F ELF++GYPPEDLV K +F  
Sbjct: 1   MRIALAQLNATVGDLAGNARRAAEAHAKAAALSADVIVFPELFLNGYPPEDLVLKPAFQD 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           A  + ++ L +   +G A ++    R+D + V N+V +LD G I A+  K  LPNY  F 
Sbjct: 61  ATRAELERLATACAEGPAILMGTIWRKDGK-VYNAVALLDRGRIEAITAKAELPNYGVFD 119

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F SG    P+  R +R+G+ ICEDIW    + + L + GAE + S N SP+  +K 
Sbjct: 120 EKRVFASGPMPGPLNVRGVRIGVPICEDIWTPEAV-ETLAETGAEIIISPNGSPFDWHKP 178

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R  I   +++   LP+ Y+NQVGGQDEL+FDGASF  +G + LA Q+  + E   +TE
Sbjct: 179 DTRMNIAVARVTESGLPLAYLNQVGGQDELVFDGASFVLNGDRSLAVQLPAWREALVVTE 238

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W +    S W   S + A           A Y+ACVL LRDYV KN F  V++GLSGGID
Sbjct: 239 WQHTP--SGWRCQSGEVAKLS----DGSAAAYDACVLGLRDYVDKNAFPGVVLGLSGGID 292

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL AAIAVDALG + V  +MLP K+TS  SL+DAA CAKALG +YD + I   V     
Sbjct: 293 SALVAAIAVDALGPDRVHAVMLPSKFTSDDSLQDAAECAKALGIRYDKVSIEPAVAGLTW 352

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        S I  EN+QSR+RG ILMA+SN   AML+TT NKSE+SVGY TLYGDM+G
Sbjct: 353 SLKDLFAGTNSDITEENLQSRVRGTILMAISNKFGAMLVTTGNKSEMSVGYATLYGDMNG 412

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYKT+V+ L+ WRN        GP   VIP  IL K+P+AELR +QTDQ+SLP
Sbjct: 413 GFNPIKDLYKTEVYALSRWRNEQRPDGAFGPQGIVIPERILTKAPTAELRANQTDQDSLP 472

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY  LDDI+  +VE E        + +  ETV+ VE LLY +EYKRRQA  G KI++++F
Sbjct: 473 PYDALDDILVSLVEKEMPVAAVIARGHTLETVKKVERLLYLAEYKRRQAAPGVKISSRNF 532

Query: 544 GRDRLYPISNKFRDHISEE 562
           GRDR YPI+N+FR+ +  E
Sbjct: 533 GRDRRYPITNRFREDVPSE 551


>gi|163793633|ref|ZP_02187608.1| Glutamine-dependent NAD(+) synthetase [alpha proteobacterium
           BAL199]
 gi|159181435|gb|EDP65950.1| Glutamine-dependent NAD(+) synthetase [alpha proteobacterium
           BAL199]
          Length = 562

 Score =  506 bits (1304), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 258/559 (46%), Positives = 353/559 (63%), Gaps = 12/559 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L I +AQLNP VGDIAGN+ K RR R +A  +G D++L  EL++ GYPPEDLV K 
Sbjct: 1   MTDTLTITLAQLNPRVGDIAGNLDKLRRVRAQAAAEGADVVLTPELYLCGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F+     A++ L  +T DGG  ++VG P  D   + N++V+LDAG ++  R K++LPNY
Sbjct: 61  MFVAEIRDAVEALARETGDGGPAVLVGAPWLDDGKLYNAMVLLDAGEVVTARYKVDLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F++G    PI  R +R+G+ ICEDIW   +I + + + G E L   N SP+ 
Sbjct: 121 GVFDEKRVFVAGPPPGPIDVRGVRIGVPICEDIW-TPDIVECVAETGGEILLIPNGSPFE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R ++   ++    LP++Y+NQ+GGQDEL+FDGASF  +  + LA QM  ++E  
Sbjct: 180 LGKSDVRVQLAVARVVESGLPLVYLNQIGGQDELVFDGASFVLNPDRSLALQMPAWTEAV 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE--EADYNACVLSLRDYVQKNNFHKVIIG 298
             T W          +  D    T     Q E  E+ Y A +  LRDYV KN F  VI+G
Sbjct: 240 VTTHWKRTPD----GWTCDTGVRTK----QPEGLESLYCALMTGLRDYVTKNGFPGVILG 291

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           +SGGIDSA+ AAIAVDALG + V+ +M+P  YTS  SLEDAAA A+ +G +Y  + I   
Sbjct: 292 MSGGIDSAISAAIAVDALGPDKVRCVMMPSPYTSDHSLEDAAAAAEMMGVQYSSINIGPA 351

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           +  F  ++S+        I  EN+Q+R RG  LMALSN    M+L+T NKSE+SVGY TL
Sbjct: 352 MQAFDGMLSEAFAGTKPDITEENLQARSRGITLMALSNKFGHMVLSTGNKSEMSVGYATL 411

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM GG++ LKD+YK  VF L+SWRNS+    GLGP   ++P  I+ K PSAELRP Q 
Sbjct: 412 YGDMCGGYSVLKDVYKMTVFALSSWRNSNKPAGGLGPDGPIMPERIITKPPSAELRPDQK 471

Query: 479 DQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           D++SLPPYP+LD I+  ++ENE       ++ ++ +TV  +  +L  +EYKRRQAP G K
Sbjct: 472 DEDSLPPYPVLDAILMELIENESPIATIVEKGFDSDTVLRIWRMLDRAEYKRRQAPPGVK 531

Query: 538 ITAKSFGRDRLYPISNKFR 556
           +TA+SFGRDR YP++N F+
Sbjct: 532 VTARSFGRDRRYPLTNAFQ 550


>gi|87198992|ref|YP_496249.1| NAD synthetase [Novosphingobium aromaticivorans DSM 12444]
 gi|87134673|gb|ABD25415.1| NH(3)-dependent NAD(+) synthetase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 573

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 262/566 (46%), Positives = 354/566 (62%), Gaps = 23/566 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M+  L+I +AQLN  VGD+A N+A     RE A  +  DLI+F EL + GYPPEDL+ K 
Sbjct: 19  MVDTLRITLAQLNQSVGDLAANVAAMLAVRERA--RDADLIVFPELQLIGYPPEDLIMKP 76

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           + ++  ++ ++ L   T DGG  ++VG        + N V +L+ G + A R K  LPNY
Sbjct: 77  ALVERATAELEKLARVTADGGPAMLVGSVFVRDGALHNGVALLEGGRVAATRFKYELPNY 136

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F+ G   +P++F+   LG+ ICEDIW + ++C+HL + GAE    +N SPY 
Sbjct: 137 GTFDEKRYFLPGPLPEPVLFKGAMLGLPICEDIW-HPDVCRHLAELGAEIFICINGSPYE 195

Query: 181 HNK-------LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQM 233
            +K       + KR  I TG      +P+ YVN+VGGQDE++FDGASF    +  +  QM
Sbjct: 196 IDKDVLRIDGVAKRRAIDTG------IPLAYVNRVGGQDEIVFDGASFVVGPEGAVWVQM 249

Query: 234 KHFSEQNFMTEWHYDQ--QLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNN 291
             + E    T WH       ++W       A  ++   +  E  Y A V++LRDYV KN 
Sbjct: 250 PDWEESVVTTVWHRSDFGDANRWRC----EAGEVHELAEHPEDIYCAMVMALRDYVNKNR 305

Query: 292 FHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYD 351
           F  V++GLSGGIDSA+CAAIAVDALG + V  +MLP +YTS +SL+DAA CA+ LG + D
Sbjct: 306 FPGVVLGLSGGIDSAICAAIAVDALGPDRVWCVMLPSRYTSQESLDDAAGCARMLGVRLD 365

Query: 352 VLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEI 411
            +PI   V+ F  +++         +  ENIQSRIRG  LMALSN    ML+TT NKSE+
Sbjct: 366 TVPIGPAVDAFDGMLAPVFAGRQPDLTEENIQSRIRGVTLMALSNKFGPMLVTTGNKSEM 425

Query: 412 SVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSA 471
           SVGY T+YGDM+GG+NPLKD YKT VF ++ WRNSH    GLGP   V+P  I+ K PSA
Sbjct: 426 SVGYATIYGDMNGGYNPLKDAYKTTVFAVSEWRNSHRPKIGLGPDGPVMPQRIITKPPSA 485

Query: 472 ELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRR 530
           ELRP Q D +SLPPY +LD I++ +VENE+S      E +  +TV  +E LL  +EYKRR
Sbjct: 486 ELRPDQKDSDSLPPYDVLDAILQGLVENEKSVDQIVAEGFERDTVARIERLLNLAEYKRR 545

Query: 531 QAPVGTKITAKSFGRDRLYPISNKFR 556
           QAP G K+ A+++GRDR YPI++ FR
Sbjct: 546 QAPPGVKLGARNYGRDRRYPITHGFR 571


>gi|114569533|ref|YP_756213.1| NH(3)-dependent NAD(+) synthetase [Maricaulis maris MCS10]
 gi|114339995|gb|ABI65275.1| NH(3)-dependent NAD(+) synthetase [Maricaulis maris MCS10]
          Length = 552

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 263/561 (46%), Positives = 367/561 (65%), Gaps = 13/561 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  ++ +  AQLNPVVGD+AGN+AKAR A  EA  +G D+++F E+F+ GYPPEDLV K 
Sbjct: 1   MTDRIILVTAQLNPVVGDVAGNLAKARAAHAEAKTRGGDMVVFPEMFLLGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S ++AC SA+D L + T DG A I++G P +    + N+V +LD G ++A+R K  LPNY
Sbjct: 61  SAVEACRSALDALAAITRDGPA-ILIGLPWKQNSCLYNAVALLDEGRLVALRFKRELPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F EKR F +G   D + +R I+LG+ ICED+W   ++ + L  +GAE + +LN SP+ 
Sbjct: 120 AVFDEKRVFEAGPLPDIVKWRGIKLGLPICEDLWLG-DVPRALIDKGAEMIITLNGSPWR 178

Query: 181 HNKLKKRHEIVTGQISHVHLP--IIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
               ++R +  +G       P  +I+VNQVGGQDEL+FDGASF  D + +   ++  F E
Sbjct: 179 RTIERERKQAFSGWFDSWASPKAMIFVNQVGGQDELVFDGASFSRDSEGREVQRLPAFEE 238

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE-EADYNACVLSLRDYVQKNNFHKVII 297
                EW    +   W       A    + ++   EAD+ A   +L DY+ KN F  V++
Sbjct: 239 AIDAVEWVRTDK--GWF-----GAGGQIVSVKSGLEADWKAMTRALGDYIGKNGFPGVVL 291

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           G+SGGIDSA+ AAIAVDALG + V  +M+P KYTS +S EDA ACA+ALG +YD++ +  
Sbjct: 292 GMSGGIDSAISAAIAVDALGADKVWAVMMPSKYTSQESFEDAKACAEALGIRYDIIDVEP 351

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
            +  F +++S   +        EN+QSR RG +LMALSN    M+L+T NKSE++VGY T
Sbjct: 352 TIASFNAILSTPFKGTKPDTTEENLQSRARGVVLMALSNKFGPMVLSTGNKSEMAVGYAT 411

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GG+N LKD+YKT+VF+LA WRNS     GLGP+ +VIP  I+ K PSAEL   Q
Sbjct: 412 LYGDMNGGYNALKDIYKTEVFELAWWRNSANHQVGLGPVGQVIPERIITKPPSAELAEDQ 471

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGT 536
            D++SLPPY +LD I+  ++E E S      + +DE  V+ +E+LLY +EYKRRQAP G 
Sbjct: 472 KDEDSLPPYDVLDAILYGLIEEERSVRELVADGHDEAEVKRIENLLYRAEYKRRQAPPGV 531

Query: 537 KITAKSFGRDRLYPISNKFRD 557
           KI  K+FGRDR YPI+N+FR+
Sbjct: 532 KIGPKNFGRDRRYPITNRFRN 552


>gi|94497814|ref|ZP_01304380.1| NAD+ synthetase [Sphingomonas sp. SKA58]
 gi|94422703|gb|EAT07738.1| NAD+ synthetase [Sphingomonas sp. SKA58]
          Length = 553

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 260/561 (46%), Positives = 346/561 (61%), Gaps = 15/561 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  KL IA+AQ+   VGD+  N       R  A  +G DLI+F EL + GYPPEDLV K 
Sbjct: 1   MTDKLVIALAQMTQSVGDLKANADAMLEWRARA--KGADLIVFPELQLIGYPPEDLVLKP 58

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           + +      +D +  +T DGG  ++VG     Q  + N V +LD G +  VR K  LPNY
Sbjct: 59  ALVTQADYQLDRMAQETADGGPAMLVGTVVAAQGVLFNVVALLDNGAVTTVRAKRELPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G    PI FR +++G+ ICEDIW    +  HL+ +GAE L S N SP+ 
Sbjct: 119 GTFDEKRLFAPGPLPAPIDFRGVKIGVPICEDIW-FPFVTAHLRSEGAEILISPNGSPFE 177

Query: 181 HNKLKKRHEIVTG-QISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
            +K  +R   V G ++    LP+ Y+N+VGGQDEL+FDGASF  +    +A Q+  + E 
Sbjct: 178 VDKDDRRLNAVAGTRVRETGLPLAYLNRVGGQDELVFDGASFVMNADLSIAQQLPDWEEA 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIG 298
             +T+W  ++   QW  +  D        L    AD YNA VL LRDYV +N F  +++G
Sbjct: 238 LVLTQW--EKWDGQWVCLPGDRHE-----LDPRPADIYNAMVLGLRDYVNRNRFPGIVLG 290

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL AA+AVDALG + V  +M+P ++TS  SL+DA ACA+ LG +YD++PI   
Sbjct: 291 LSGGIDSALSAAVAVDALGADRVWCVMMPSRFTSQDSLDDAVACARLLGVRYDIIPIEPA 350

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V  F +++          +  EN+QSRIRG  LMALSN    MLLTT NKSE+SVGY T+
Sbjct: 351 VGAFDAMLGPVFDGRAPDLTEENLQSRIRGVTLMALSNKCGHMLLTTGNKSEMSVGYATI 410

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSH--GITSGLGPLTEVIPPSILEKSPSAELRPH 476
           YGDM+GG++ LKD YKT VF L+ WRN+H   + +G+GP   V+P  ++ K PSAELR  
Sbjct: 411 YGDMAGGYSVLKDAYKTTVFDLSRWRNAHVPSLGAGMGPAGPVMPERVITKPPSAELRAD 470

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q D +SLPPY ILD I+  +VE E S  +   + +  ETV  +E LLY +EYKRRQAP G
Sbjct: 471 QRDDDSLPPYEILDPILYGLVEEELSVDDLVARGFEKETVARIERLLYVAEYKRRQAPPG 530

Query: 536 TKITAKSFGRDRLYPISNKFR 556
            K+  ++FGRDR YPI+N FR
Sbjct: 531 VKLGIRNFGRDRRYPITNAFR 551


>gi|218461035|ref|ZP_03501126.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli Kim
           5]
          Length = 430

 Score =  491 bits (1265), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 241/423 (56%), Positives = 299/423 (70%), Gaps = 7/423 (1%)

Query: 137 PIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQIS 196
           P+ FR +RLGI ICEDIW    +C+ L + GAE L S N SPYY  K+  RH++V  Q+ 
Sbjct: 14  PVNFRGVRLGIPICEDIWGELGVCETLAESGAEILLSPNGSPYYRGKVDIRHQVVLKQVI 73

Query: 197 HVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNY 256
              LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     +T W   +  S W+ 
Sbjct: 74  ETGLPLIYAAQLGGQDELVFDGASFAFNADRSLAFQMSEFETALAVTTWKRGE--SGWHC 131

Query: 257 MSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDAL 316
                A    IP ++EEADY AC+L  RDYV KN F  V++GLSGGIDSA+CAAIAVDAL
Sbjct: 132 AEGPMAR---IP-EDEEADYRACLLGFRDYVNKNGFKTVVLGLSGGIDSAICAAIAVDAL 187

Query: 317 GKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSG 376
           G+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI   V  F S +S   +   SG
Sbjct: 188 GEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEQPVTGFSSALSDLFEGTESG 247

Query: 377 IVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQ 436
           I  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGDM+GGFNP+KDLYK Q
Sbjct: 248 ITEENLQSRARGVILMAISNKFGAMVVTTGNKSEMSVGYATLYGDMNGGFNPIKDLYKMQ 307

Query: 437 VFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRI 496
           V+ LA WRN +   S LGP  EVIP +I++K+PSAELRP Q DQ+SLPPYP+LDDI++ +
Sbjct: 308 VYALARWRNENVPPSALGPSGEVIPQNIIDKAPSAELRPDQKDQDSLPPYPVLDDILECL 367

Query: 497 VENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           VE E +        +D   V  VEHLLY +EYKRRQ+  G KIT K+FGRDR YPI+N+F
Sbjct: 368 VEKEMAVEEIVARGHDVAIVHRVEHLLYLAEYKRRQSAPGVKITKKNFGRDRRYPITNRF 427

Query: 556 RDH 558
           RD 
Sbjct: 428 RDR 430


>gi|326386431|ref|ZP_08208054.1| NAD synthetase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209092|gb|EGD59886.1| NAD synthetase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 555

 Score =  490 bits (1261), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 263/566 (46%), Positives = 346/566 (61%), Gaps = 23/566 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  KL I +AQLN  VGD+A N    R+ R  A     DLI+F E+ + GYPPEDL+ K 
Sbjct: 1   MADKLIITLAQLNQNVGDLAANAESVRKVRAAAMHS--DLIVFPEMHLIGYPPEDLIQKP 58

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           + I+  +  +  L   T DGG  ++VG        + N V +L+ G I AVR K  LPNY
Sbjct: 59  ALIERAAHEMQELAKLTADGGPALLVGSVFVRDGALHNGVALLEGGRIAAVRFKYELPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F+ G   +P++F+   LG+ ICEDIW + ++C+HL + GAE    +N SPY 
Sbjct: 119 GTFDEKRYFLPGPLPEPVLFKGAMLGLPICEDIW-HPDVCRHLAQLGAEIFICVNGSPYE 177

Query: 181 HNK-------LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQM 233
            +K       + KR  I TG      +P+ Y+N+VGGQDE++FDGASF    +  L  Q 
Sbjct: 178 IDKDVLRIDGVAKRRAIDTG------IPLAYLNRVGGQDEIVFDGASFVVGPEGALWIQA 231

Query: 234 KHFSEQNFMTEWHYDQ--QLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNN 291
             + E    TEW+  +     +W   + D    ++ P +  E  Y A VL+LRDYV KN 
Sbjct: 232 PDWEEAVIHTEWNRVKVGNGHRWRCQAGD----VHEPTEHPEDIYCAMVLALRDYVNKNR 287

Query: 292 FHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYD 351
           F  V++GLSGGIDSA+ AAIAVDALG E V  +MLP +YTS +SL+DA  CA+ LG + D
Sbjct: 288 FPGVVLGLSGGIDSAITAAIAVDALGPERVWCVMLPSRYTSQESLDDAEGCARMLGVRLD 347

Query: 352 VLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEI 411
            +PI   V+ F  +++    +    +  EN+QSRIRG  LMALSN    MLLTT NKSE+
Sbjct: 348 TIPIEPAVDGFAEMLAPVFADRKPDLTEENLQSRIRGTTLMALSNKFGPMLLTTGNKSEM 407

Query: 412 SVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSA 471
           SVGY T+YGDM+GG+NPLKD YKT VF ++ WRN      GLGP   V+P  IL K PSA
Sbjct: 408 SVGYATIYGDMNGGYNPLKDAYKTTVFAISEWRNRARPKIGLGPDGPVMPERILTKPPSA 467

Query: 472 ELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRR 530
           ELRP Q D +SLP YP+LD I+  +VE E S      E Y+  TV  +E LL+ +EYKRR
Sbjct: 468 ELRPDQKDSDSLPDYPVLDAILMDLVEQERSVDQIVAEGYDRATVERIERLLHIAEYKRR 527

Query: 531 QAPVGTKITAKSFGRDRLYPISNKFR 556
           QAP G K+  ++FGRDR YPI++ FR
Sbjct: 528 QAPPGVKLGMRNFGRDRRYPITHAFR 553


>gi|283856355|ref|YP_162634.2| NAD synthetase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775354|gb|AAV89523.2| NAD+ synthetase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 558

 Score =  489 bits (1260), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 246/559 (44%), Positives = 355/559 (63%), Gaps = 10/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  +L I +AQ+   VG    N     + R+EA +  +DLILF EL + GYPPEDLV K 
Sbjct: 3   MTDQLTILLAQIPQTVGHCRRNADAMLKIRQEAGK--VDLILFPELQLIGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S +Q     ++ L   T DGGA ++VG   Q++  + N+V +LD G I A+R K +LPNY
Sbjct: 61  SLLQNAKEELERLALATSDGGAAMLVGTAWQEKGRIFNAVALLDQGKIAAIRYKHDLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G   +P++FRD+ LGI +CEDIW    +C HLK++GAE L   N SP+ 
Sbjct: 121 GTFDEKRIFSAGPLPEPVLFRDVSLGIPVCEDIW-TEKLCAHLKERGAEILLVPNGSPFE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   RH++V  ++    LP +Y+N+VGGQDE++FDG SF  +    +   +  +    
Sbjct: 180 SGKYPVRHKVVADRVKETGLPCLYLNRVGGQDEVVFDGGSFVVNRDGAVPISLPQWQADC 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD--YNACVLSLRDYVQKNNFHKVIIG 298
           ++T WH  ++     +  D+   +     ++      Y A ++ L DYV++N F  V++G
Sbjct: 240 YVTHWHKTEE----GWSCDEGLQSKISEGEDRRLSDIYQAMMMGLGDYVRQNGFSGVLLG 295

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL AA+AVDALG + V  +MLP +YTS +SL+DA ACA+ LGC+ D +PI+  
Sbjct: 296 LSGGIDSALSAAVAVDALGADKVWCVMLPSRYTSQESLDDARACAEMLGCRLDSVPINPA 355

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V     +++     +   I  ENIQSR+RG +LMA+SN    M+LTT NKSE++VGY TL
Sbjct: 356 VEAIDGMLAPLFSGKKPDITEENIQSRLRGVVLMAISNKFSPMVLTTGNKSEMAVGYATL 415

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GG++ LKDLYK+ VF+++ WRNSH     LGP   V+P  ++ K PSAELR  Q 
Sbjct: 416 YGDMNGGYSVLKDLYKSDVFKVSRWRNSHKPAHALGPDGYVMPDRVITKPPSAELREDQK 475

Query: 479 DQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           D +SLPPY ILD ++  ++E + S  +   + Y+ + V  +E+LL+ +EYKRRQAP G K
Sbjct: 476 DSDSLPPYDILDAVLHGLIEEDLSCSDLVKRGYDPDLVTRIENLLHRAEYKRRQAPPGVK 535

Query: 538 ITAKSFGRDRLYPISNKFR 556
           + +++FGRDR YP+S++FR
Sbjct: 536 LGSRNFGRDRRYPLSHQFR 554


>gi|209964282|ref|YP_002297197.1| NAD synthetase [Rhodospirillum centenum SW]
 gi|209957748|gb|ACI98384.1| glutamine-dependent NAD(+) synthase [Rhodospirillum centenum SW]
          Length = 559

 Score =  488 bits (1256), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 262/556 (47%), Positives = 352/556 (63%), Gaps = 8/556 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L IA+AQ+NP VG +  N+ + R AR EA  +G DL++ +EL +SGYPPEDLV K 
Sbjct: 1   MTDSLTIALAQINPTVGALRANLDRIRTARAEAAARGADLVVLSELVVSGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F+     A++ L +DT DGG G+++G P ++     N+ ++LD G + AVR K +LPNY
Sbjct: 61  FFLDTVQQAVEELAADTGDGGPGLLLGAPWREAGRTHNAALLLDGGRVAAVRFKHDLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G    P+ FR +RLGI+ICED+W   ++ + L + GAE L   N SP+ 
Sbjct: 121 GPFDEKRVFDPGPLPGPVSFRGVRLGIVICEDMW-TPDVAETLAETGAEILIVPNGSPFE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K  +R  +   +++   LP+ YVNQVGGQDEL+FDG SF  +  + LA Q+  F E  
Sbjct: 180 TDKADRRLSLAVARVTETGLPLAYVNQVGGQDELVFDGGSFVLNADRGLAAQLPSFEEHV 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T W        W   S    + M  P +  EA Y A VL LRDYV+KN F  VI+GLS
Sbjct: 240 AITHWTRGD--GGWTCTS----TEMTAPAEGLEAIYRAMVLGLRDYVRKNRFPGVILGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL AA+AVDALG + V  +M+P  YTS +SLEDAA CA+ LGC+ D + I   + 
Sbjct: 294 GGIDSALSAAVAVDALGADRVHCVMMPSPYTSRESLEDAAECAELLGCRIDTISIEPAMK 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F  ++     +    I  EN+QSR RG  LMALSN    M+L+T NKSE+SVGY TLYG
Sbjct: 354 AFEHMLEPAFADREPDITEENLQSRARGVTLMALSNKFGGMVLSTGNKSEMSVGYATLYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GG++ LKD+YKT V++L+ WRN        GP   VIP  I+ K+P+AEL+P QTDQ
Sbjct: 414 DMCGGYSVLKDVYKTTVYRLSHWRNRTLPRQAHGPAGRVIPERIITKAPTAELKPDQTDQ 473

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           ++LPPY ILDDI++ +VE +          +D ETV  V  +L  +EYKRRQAP G K+T
Sbjct: 474 DTLPPYEILDDILECLVEKDLGLAAIVARGHDRETVSRVWRMLDRAEYKRRQAPPGVKVT 533

Query: 540 AKSFGRDRLYPISNKF 555
           ++SFG+DR YPI++ F
Sbjct: 534 SRSFGKDRRYPITSGF 549


>gi|260752640|ref|YP_003225533.1| NAD synthetase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258552003|gb|ACV74949.1| NAD+ synthetase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 558

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 245/559 (43%), Positives = 355/559 (63%), Gaps = 10/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  +L I +AQ+   VG    N     + R+EA +  +DLILF EL + GYPPEDLV K 
Sbjct: 3   MTDQLTILLAQIPQTVGHCRRNADAMLKIRQEAGK--VDLILFPELQLIGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S +Q     ++ L   T DGGA ++VG   Q++  + N+V +LD G I A+R K +LPNY
Sbjct: 61  SLLQNAKEELERLALATSDGGAAMLVGTAWQEKGRIFNAVALLDQGKIAAIRYKHDLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G   +P++FRD+ LGI +CEDIW    +C HLK++GAE L   N SP+ 
Sbjct: 121 GTFDEKRIFSAGPLPEPVLFRDVSLGIPVCEDIW-TEKLCAHLKERGAEILLVPNGSPFE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R ++V  ++    LP +Y+N+VGGQDE++FDG SF  +    +   +  +    
Sbjct: 180 SGKYPVRRKVVADRVKETGLPCLYLNRVGGQDEVVFDGGSFVVNRDGAVPVSLPQWQADC 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD--YNACVLSLRDYVQKNNFHKVIIG 298
           ++T WH  ++     +  D+   +  +  ++      Y A ++ L DYV++N F  V++G
Sbjct: 240 YVTHWHKTEE----GWSCDEGLQSKILEGEDGRLSDIYQAMMMGLGDYVRQNGFSGVLLG 295

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL AA+AVDALG + V  +MLP +YTS +SL+DA ACA+ LGC+ D +PI+  
Sbjct: 296 LSGGIDSALSAAVAVDALGADKVWCVMLPSRYTSQESLDDARACAEMLGCRLDSVPINPA 355

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V     +++     +   I  ENIQSR+RG +LMA+SN    M+LTT NKSE++VGY TL
Sbjct: 356 VEAIDGMLAPLFSGKKPDITEENIQSRLRGVVLMAISNKFSPMVLTTGNKSEMAVGYATL 415

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GG++ LKDLYK+ VF+++ WRNSH     LGP   V+P  ++ K PSAELR  Q 
Sbjct: 416 YGDMNGGYSVLKDLYKSDVFKVSRWRNSHKPAHALGPDGYVMPDRVITKPPSAELREDQK 475

Query: 479 DQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           D +SLPPY ILD ++  ++E + S  +   + Y+ + V  +E+LL+ +EYKRRQAP G K
Sbjct: 476 DSDSLPPYDILDAVLHGLIEEDLSCSDLVKRGYDPDLVTRIENLLHRAEYKRRQAPPGVK 535

Query: 538 ITAKSFGRDRLYPISNKFR 556
           + +++FGRDR YP+S++FR
Sbjct: 536 LGSRNFGRDRRYPLSHQFR 554


>gi|241762372|ref|ZP_04760451.1| NAD+ synthetase [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241373059|gb|EER62708.1| NAD+ synthetase [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 558

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 245/559 (43%), Positives = 354/559 (63%), Gaps = 10/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  +L I +AQ+   VG    N     + R+EA +  +DLILF EL + GYPPEDLV K 
Sbjct: 3   MTDQLTILLAQIPQTVGHCRRNADAMLKIRQEAGK--VDLILFPELQLIGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S +Q     ++ L   T DGGA ++VG   Q++  + N+V +LD G I A+R K +LPNY
Sbjct: 61  SLLQNAKEELERLALATSDGGAAMLVGTAWQEKGRIFNAVALLDQGKIAAIRYKHDLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G   +P++FRD+ LGI +CEDIW    +C HLK++GAE L   N SP+ 
Sbjct: 121 GTFDEKRIFSAGPLPEPVLFRDVSLGIPVCEDIW-TEKLCDHLKERGAEILLVPNGSPFE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R ++V  ++    LP +Y+N+VGGQDE++FDG SF  +    +   +  +    
Sbjct: 180 SGKYPVRRKVVADRVKETGLPCLYLNRVGGQDEVVFDGGSFVVNRDGAVPVSLPRWQADC 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD--YNACVLSLRDYVQKNNFHKVIIG 298
           ++T WH  ++     +  D+   +     ++      Y A ++ L DYV++N F  V++G
Sbjct: 240 YVTRWHKTEE----GWSCDEGLQSKISEGEDGRLSDIYQAMMMGLGDYVRQNGFSGVLLG 295

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL AA+AVDALG + V  +MLP +YTS +SL+DA ACA+ LGC+ D +PI+  
Sbjct: 296 LSGGIDSALSAAVAVDALGADKVWCVMLPSRYTSQESLDDARACAEMLGCRLDSVPINPA 355

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V     +++     +   I  ENIQSR+RG +LMA+SN    M+LTT NKSE++VGY TL
Sbjct: 356 VEAIDGMLAPLFSGKKPDITEENIQSRLRGVVLMAISNKFSPMVLTTGNKSEMAVGYATL 415

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GG++ LKDLYK+ VF+++ WRNSH     LGP   V+P  ++ K PSAELR  Q 
Sbjct: 416 YGDMNGGYSVLKDLYKSDVFKVSRWRNSHKPAHALGPDGYVMPDRVITKPPSAELREDQK 475

Query: 479 DQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           D +SLPPY ILD ++  ++E + S  +   + Y+ + V  +E+LL+ +EYKRRQAP G K
Sbjct: 476 DSDSLPPYDILDAVLHGLIEEDLSCSDLVKRGYDPDLVTRIENLLHRAEYKRRQAPPGVK 535

Query: 538 ITAKSFGRDRLYPISNKFR 556
           + +++FGRDR YP+S++FR
Sbjct: 536 LGSRNFGRDRRYPLSHQFR 554


>gi|294010307|ref|YP_003543767.1| NAD+ synthase (glutamine-hydrolyzing) [Sphingobium japonicum UT26S]
 gi|292673637|dbj|BAI95155.1| NAD+ synthase (glutamine-hydrolyzing) [Sphingobium japonicum UT26S]
          Length = 553

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 258/561 (45%), Positives = 346/561 (61%), Gaps = 15/561 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  KL IA+AQ+   VGD+A N       R  A     DLI++ EL + GYPPEDLV K 
Sbjct: 1   MTDKLVIALAQMTQSVGDLAANADAMLEWRTRAMEA--DLIVYPELQLIGYPPEDLVLKP 58

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           + +   +  +D L   T DGG  ++VG     Q  + N V +L+ G + A+R K  LPNY
Sbjct: 59  ALVDRANHELDRLAQATADGGPAMLVGTVVASQGVLFNVVALLEDGAVTAIRQKRELPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G    PI FR +++G+ ICEDIW    +  HL+ +GAE L S N SP+ 
Sbjct: 119 GTFDEKRLFAPGPLPAPIDFRGVKIGVPICEDIW-FPFVTAHLRAEGAEILISPNGSPFE 177

Query: 181 HNKLKKRHEIVTG-QISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
            +K  +R   V G ++    LP++Y+N+VGGQDEL+FDGASF  +G   LA Q+  + E 
Sbjct: 178 VDKDDRRINAVAGTRVRETGLPLVYLNRVGGQDELVFDGASFVMNGDLSLAHQLPDWEEA 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIG 298
             +T  H+++   QW  +  +        L E  AD YNA VL LRDYV KN F  V++G
Sbjct: 238 LVLT--HWEKWEGQWVCLPGERHV-----LDERPADIYNAMVLGLRDYVNKNRFPGVVLG 290

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL AA+AVDALG + V  +M+P ++TS +SL+DA  CA+ LG +YD +PI   
Sbjct: 291 LSGGIDSALSAAVAVDALGADRVWCVMMPSRFTSRESLDDAIECARLLGVRYDSIPIEPA 350

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V  F ++++         +  ENIQSRIRG  LMALSN    MLLTT NKSE+SVGY T+
Sbjct: 351 VEAFDAMLADVFTGRQRDLTEENIQSRIRGVTLMALSNKYGHMLLTTGNKSEMSVGYATI 410

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSH--GITSGLGPLTEVIPPSILEKSPSAELRPH 476
           YGDM+GG++ LKD YKT VF L  WRN +   +    GP   V+P  ++ K PSAELR +
Sbjct: 411 YGDMAGGYSVLKDAYKTTVFDLCRWRNENVPSLGEAFGPEGPVMPDRVITKPPSAELRDN 470

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q D++SLPPY +LD I+  +VE E S      + ++ +TV  +E LLY +EYKRRQ+P G
Sbjct: 471 QKDEDSLPPYEVLDPILYGLVEEELSVEQLVARGFDKDTVARIERLLYVAEYKRRQSPPG 530

Query: 536 TKITAKSFGRDRLYPISNKFR 556
            K+  ++FGRDR YPI+N FR
Sbjct: 531 VKLGMRNFGRDRRYPITNAFR 551


>gi|84683380|ref|ZP_01011283.1| glutamine-dependent NAD(+) synthetase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84668123|gb|EAQ14590.1| glutamine-dependent NAD(+) synthetase [Rhodobacterales bacterium
           HTCC2654]
          Length = 555

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 249/558 (44%), Positives = 341/558 (61%), Gaps = 8/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    ++ +AQLNPVVGDI GN   AR A   A   G D+++ TE F++GY P+DLV + 
Sbjct: 3   MADTFRLTLAQLNPVVGDIPGNADMARAAWTAAKEAGADMVMLTESFLTGYQPQDLVMRP 62

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F      A + L  D  DG   + +G P  D + + N+  +L+ G +     K  LPN 
Sbjct: 63  AFWSEAMEACEALAKDVADGPV-MGIGCPYHDGKDLYNAYWVLEGGRVRRRILKQMLPNE 121

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F EKR F      DPI    + LGI ICED W    +C++L  +GAE L   N SPYY
Sbjct: 122 TVFDEKRLFSHAEPQDPIKIGPLTLGIPICEDAWWPDAVCENLADKGAEVLAVPNGSPYY 181

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K++ RH ++  ++    LP+IY+N VGGQD+ +FDGASF  D Q +LAFQ + F E  
Sbjct: 182 RGKVETRHGVMRARVEETGLPLIYLNMVGGQDDQVFDGASFGMDAQGELAFQFREFDE-- 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     ++    W  +  +        L   EADY   V SLRDY+ K  F KV++GLS
Sbjct: 240 VIRHVDLEKGDDGWRIVPGEVVPA----LPAYEADYRVMVQSLRDYMGKTGFKKVLLGLS 295

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A IA DALG ENV+ +MLP +YTS  SL+DA A A+ LGC YD +PI    +
Sbjct: 296 GGIDSAIVATIAADALGPENVRCVMLPSEYTSQGSLDDAKAVAERLGCHYDFVPIKGPRD 355

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +     +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 356 AVTEALAPLFEGYAPDLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 415

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYK +VF+   WRN++     +GP  EVIP SI++K PSAELR  Q D 
Sbjct: 416 DMAGGYNPIKDLYKMRVFETCRWRNANHRDWMMGPAGEVIPVSIIDKPPSAELRDDQKDS 475

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I++ +V+ E S      Q ++ +TV+ VEHL++ SEYKR Q+  G ++T
Sbjct: 476 DSLPPYEVLDAILEGLVDKELSVAELVAQGFDRDTVKKVEHLIFISEYKRFQSAPGARLT 535

Query: 540 AKSFGRDRLYPISNKFRD 557
            +SF  DR YPI N++RD
Sbjct: 536 MRSFWLDRRYPIVNRWRD 553


>gi|46201454|ref|ZP_00055021.2| COG0171: NAD synthase [Magnetospirillum magnetotacticum MS-1]
          Length = 548

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 258/552 (46%), Positives = 351/552 (63%), Gaps = 10/552 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L IA+AQ+NPVVGDI GN+   R AR EA   G DL++F EL + GYPPEDLV K +F+ 
Sbjct: 2   LAIALAQINPVVGDIVGNMGLIRAARAEAKALGADLVVFGELTLCGYPPEDLVLKGAFLD 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC +A++ L ++T DG A ++VG P + ++ + N+ ++LD G I A R K +LPNY  F 
Sbjct: 62  ACEAAVNELAAETADGPA-LLVGAPWRVKDKLHNAALLLDHGRIAATRLKHHLPNYGVFD 120

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E R F  G    P+ FR +RLG+LICED+W  +++ + L + GAE L   N SP+  +K 
Sbjct: 121 EVRVFQPGPLPGPVSFRGVRLGVLICEDMW-YADVAETLGESGAEILVVPNGSPFEMDKP 179

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            KR +    ++    LP++YVNQVGGQDEL+FDGASF   G  ++A  +  +  Q  +T 
Sbjct: 180 TKRLDHARARVEETGLPLVYVNQVGGQDELVFDGASFVLGGDAKIAASIAPWQSQVVLTT 239

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   ++   W      +      P    E  Y A V  LRDYV KN F  V++GLSGGID
Sbjct: 240 WT--RESDGWRCEGPKAP-----PASRLEGVYQALVTGLRDYVGKNRFPGVVLGLSGGID 292

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAAIA DALG + V  +M+P  YTS +SLEDAA CA+ LG + D + I   +  F S
Sbjct: 293 SAICAAIAADALGPDKVWCVMMPSPYTSEESLEDAALCAQMLGVRLDTVNIGPAMAAFGS 352

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
           +++   +   S I  EN+QSR RG  LM LSN    M+L+T NKSE+S GY TLYGDM G
Sbjct: 353 MLAPIFEGRDSDITEENLQSRSRGLTLMGLSNKFGPMVLSTGNKSEMSCGYATLYGDMCG 412

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           G+  LKD+YKT VF L+SWRN H     LGP+  V+P  ++ K PSAEL+P Q DQ++LP
Sbjct: 413 GYAVLKDVYKTTVFALSSWRNGHRPPGCLGPVGAVMPERVITKPPSAELKPDQKDQDTLP 472

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY  LD +++ ++E E+S      + + +  VR V  +L  +EYKRRQAP G KI+++SF
Sbjct: 473 PYDELDAMLEAMIEEEKSVSEIVAKGFEEAVVRRVWRMLDRAEYKRRQAPPGVKISSRSF 532

Query: 544 GRDRLYPISNKF 555
           G+DR YPI+N F
Sbjct: 533 GKDRRYPITNAF 544


>gi|307293500|ref|ZP_07573344.1| NAD+ synthetase [Sphingobium chlorophenolicum L-1]
 gi|306879651|gb|EFN10868.1| NAD+ synthetase [Sphingobium chlorophenolicum L-1]
          Length = 553

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 255/561 (45%), Positives = 343/561 (61%), Gaps = 15/561 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  KL IA+AQ+   VGD+  N       R  A     DLI++ EL + GYPPEDLV K 
Sbjct: 1   MTDKLVIALAQMTQSVGDLTANADAMLEWRGRA--MDADLIVYPELQLIGYPPEDLVLKP 58

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           + +   +  +D L   T DGG  ++VG     Q  + N V +L+ G + A+R K  LPNY
Sbjct: 59  ALVDRANHELDRLAQATADGGPAMLVGTVVASQGVLFNVVALLEGGAVTAIRQKRELPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G    PI FR +++G+ ICEDIW    +  HL+ +GAE L S N SP+ 
Sbjct: 119 GTFDEKRLFAPGPLPAPIDFRGVKIGVPICEDIW-FPFVTAHLRSEGAEILISPNGSPFE 177

Query: 181 HNKLKKRHEIVTG-QISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
            +K  +R   V G ++    LP++Y+N+VGGQDEL+FDGASF  +G   +A Q+  + E 
Sbjct: 178 VDKDDRRINAVAGTRVRETGLPLVYLNRVGGQDELVFDGASFVMNGDLSIAQQLPDWEEA 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIG 298
             +T W  ++   QW  +  +        L E  AD YNA VL LRDYV KN F  V++G
Sbjct: 238 LVLTTW--EKWEGQWVCLPGERHV-----LDERPADIYNAMVLGLRDYVNKNRFPGVVLG 290

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL AA+AVDALG + V  +M+P ++TS +SL+DA  CA+ LG +YD +PI   
Sbjct: 291 LSGGIDSALSAAVAVDALGADRVWCVMMPSRFTSQESLDDAVECARLLGVRYDSIPIEPA 350

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V  F S+++         +  ENIQSRIRG  LM LSN    MLLTT NKSE+SVGY T+
Sbjct: 351 VEAFDSMLANVFTGRQRDLTEENIQSRIRGVTLMGLSNKYGHMLLTTGNKSEMSVGYATI 410

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSH--GITSGLGPLTEVIPPSILEKSPSAELRPH 476
           YGDM+GG++ LKD YKT VF L  WRN +   +    GP   ++P  ++ K PSAELR +
Sbjct: 411 YGDMAGGYSVLKDAYKTTVFDLCRWRNENVPSLGEAFGPKGPIMPDRVITKPPSAELRDN 470

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q D++SLPPY +LD I+  +VE E S      + ++ +TV  +E LLY +EYKRRQ+P G
Sbjct: 471 QKDEDSLPPYEVLDPILYGLVEEELSVEQLVARGFDKDTVARIERLLYVAEYKRRQSPPG 530

Query: 536 TKITAKSFGRDRLYPISNKFR 556
            K+  ++FGRDR YPI+N FR
Sbjct: 531 VKLGMRNFGRDRRYPITNAFR 551


>gi|254294201|ref|YP_003060224.1| NAD+ synthetase [Hirschia baltica ATCC 49814]
 gi|254042732|gb|ACT59527.1| NAD+ synthetase [Hirschia baltica ATCC 49814]
          Length = 553

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 266/560 (47%), Positives = 348/560 (62%), Gaps = 11/560 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  +L I  AQLN +VGD+  N+ KA  A +EA+  G DL++  ELF+ GYPPEDLV K 
Sbjct: 1   MSDRLTILSAQLNAIVGDVDANLEKAVGALKEAHACGADLVVLPELFLCGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVL--NSVVILDAGNIIAVRDKINLP 118
           +  +AC  A   L S T   G GIVVG P  ++   L  NSV ++  G I A+R K  LP
Sbjct: 61  ALSKACLRAAHELASQTRQDGPGIVVGMPVWEEGQALPYNSVALIADGEIKALRHKYELP 120

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           NY  F EKRTF  G    P+ FR   LG+ ICEDIW  + +   LK++GAE L S N SP
Sbjct: 121 NYDVFDEKRTFQQGPKPLPVGFRGFTLGLPICEDIWLEA-VPDALKEKGAEILLSPNGSP 179

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           +  N    R +  + Q + + LP++YVNQVGGQDEL FDG SF  D + ++  Q+  F E
Sbjct: 180 WRRNVRDARLKAFS-QWADLRLPLVYVNQVGGQDELAFDGESFAIDSRGRIVQQLPDFEE 238

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
              ++ W              D  S+      + E  Y A ++ L DYV+K  F  V+IG
Sbjct: 239 AYSVSVWERTPMGLMCVEGKKDELSS------DLEETYLATMMGLGDYVRKTGFPGVLIG 292

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSA+ AAIAVDALG ENV  +M+P +YTS +SL DA  CA+ALG KYD + I   
Sbjct: 293 LSGGIDSAMVAAIAVDALGPENVWCVMMPSRYTSRESLLDAQQCAEALGVKYDNIQISSA 352

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           VN +  ++S+           ENIQSR+RG  LMALSN    M+ TT NKSE++VGY TL
Sbjct: 353 VNAYDEMLSEAFTGTTPDTTEENIQSRVRGVTLMALSNKFGHMVTTTGNKSEMAVGYATL 412

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM GG+NPLKD+YKT+VF+LA WRN++   +  GP   VIP +I+ K PSAELR  Q 
Sbjct: 413 YGDMCGGYNPLKDIYKTEVFELARWRNANVPKNAHGPYGIVIPENIISKPPSAELREDQK 472

Query: 479 DQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           D++SLPPY ILDDI+  ++E EES      + + ++ VR ++ L+  +EYKRRQAP G K
Sbjct: 473 DEDSLPPYHILDDILYGLIEREESIEEIVSRGHFEDVVRRIDSLVRINEYKRRQAPPGVK 532

Query: 538 ITAKSFGRDRLYPISNKFRD 557
           I  K+FGR R YP+ N++RD
Sbjct: 533 IGDKNFGRGRRYPLVNRYRD 552


>gi|144901045|emb|CAM77909.1| NH3-dependent NAD+ synthetase protein [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 552

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 262/557 (47%), Positives = 352/557 (63%), Gaps = 11/557 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L IA AQ+NPVVGD+AGN+A+ R AR +A   G  L++F EL +SGYPPEDLV K 
Sbjct: 1   MSDSLSIAFAQINPVVGDVAGNVARIRAARAQAAADGAQLVVFPELVVSGYPPEDLVLKS 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+ A   A++ L +DT D G  I+VG P +    + N+ ++LD G + A R K +LPNY
Sbjct: 61  AFLDAIEQAVEDLAADTADNGPAILVGAPWRVAGRLHNAALLLDHGRVAASRLKHHLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F  G    PI FR +RLG+L+CED+W  S++ + L + GAE L   N SP+ 
Sbjct: 121 GVFDEARVFAPGPVPGPIQFRGVRLGVLVCEDMWY-SDVAETLAECGAEILVVPNGSPFE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K+  R      +++   LP+IYVNQ+GGQDEL+FDGASF  D + ++  ++  ++EQ 
Sbjct: 180 LDKVGVRLSRAKERVAETGLPLIYVNQLGGQDELVFDGASFALDAKGEVMVRLPAWAEQV 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
             T WH  +Q   W      S +    P+ E + D Y A VL LRDYV KN F  V++GL
Sbjct: 240 VTTRWH--KQDGAW------SVAGPIAPIPERDEDLYQAMVLGLRDYVGKNGFPGVVLGL 291

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL AA+A DALG + V  +M+P  YTS +SL+DAA  AK LGC+ D + I   +
Sbjct: 292 SGGIDSALAAAVAADALGADKVWCVMMPSPYTSQESLDDAAGVAKMLGCRLDNINIGPAM 351

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F  +++       + I  EN+QSR RG  LMALSN    M+L+T NKSE+S GY TLY
Sbjct: 352 GAFDHMLAPHFAGTNADITEENLQSRARGVTLMALSNKFGPMVLSTGNKSEMSTGYATLY 411

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GG+  LKD+YKT VF +  WRN +     LGP   V+P  ++ K PSAEL+P QTD
Sbjct: 412 GDMCGGYAVLKDVYKTAVFAVCRWRNGNFPAGALGPNGPVMPERVITKPPSAELKPDQTD 471

Query: 480 QESLPPYPILDDIIKRIVENEESF-INNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q++LPPY +LD I+  ++E E S      + Y+D  VR +  +L  +EYKRRQAP G KI
Sbjct: 472 QDTLPPYDVLDGILSCLIEGELSVEATVAKGYDDAMVRRIWRMLDRAEYKRRQAPPGVKI 531

Query: 539 TAKSFGRDRLYPISNKF 555
           T +SFG+DR YPI+N F
Sbjct: 532 TGRSFGKDRRYPITNGF 548


>gi|326404377|ref|YP_004284459.1| NAD(+) synthetase [Acidiphilium multivorum AIU301]
 gi|325051239|dbj|BAJ81577.1| NAD(+) synthetase [Acidiphilium multivorum AIU301]
          Length = 554

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 267/558 (47%), Positives = 347/558 (62%), Gaps = 12/558 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L +AIAQL+  VG I  N+A  R AR EA R+G DL++  EL I+GYPPEDLV K 
Sbjct: 1   MTDTLTLAIAQLDLHVGAIDRNLAAIRAARAEAARRGADLLVTPELGIAGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+ AC +A   L +DT DGG G++VG P + +  + N+  +LD G IIA R K  LPNY
Sbjct: 61  AFVAACEAAAAELAADTADGGPGVIVGLPWRAEGALHNAAFVLDGGRIIARRAKHELPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G +  P++FR  RLG++ICED W  + + + L + GAE L S+N SP+ 
Sbjct: 121 GVFDEKRVFAPGPAPGPVMFRGFRLGVMICEDWWLPA-VSETLAETGAELLISINGSPFE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R ++   ++    LP ++    GGQDE++FDGASF  +  + LA +M HF    
Sbjct: 180 DGKLGVRLQLALNRVVETGLPFVFAAMTGGQDEIVFDGASFALNADRSLALRMPHFRAAI 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD--YNACVLSLRDYVQKNNFHKVIIG 298
               W            +   A    +P + E  D  Y A V+ L DYV KN F  VI+G
Sbjct: 240 ETLVWK--------RTTTGLVAEPHVLPPEPERLDLVYRAMVMGLADYVNKNGFPGVILG 291

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL AA+AVDALG   V+ +M+P +YTS  SLEDAAACA  LG + D +PI   
Sbjct: 292 LSGGIDSALSAAVAVDALGPARVRAVMMPSRYTSAHSLEDAAACADLLGIRCDTVPIGGA 351

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
              F +++    +     I  ENIQSR RG ILMALSN    M+LTT NKSE+SVGY TL
Sbjct: 352 TEAFAAVLEPLYEGRTPDITEENIQSRARGLILMALSNKLGHMVLTTGNKSEMSVGYATL 411

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM GG++ LKD+YKT VF L+ WRN++     LGP   V+P  ++ K PSAELR +QT
Sbjct: 412 YGDMCGGYSVLKDVYKTTVFALSHWRNANRPADALGPAGAVMPERVITKPPSAELRENQT 471

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQEYNDE-TVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLPPY +LD +++ +VE E+S        +D  TV  V  LL  +EYKRRQAP G K
Sbjct: 472 DQDSLPPYDVLDAVLEGLVEGEKSIEELVAAGHDRATVARVWKLLDRAEYKRRQAPPGVK 531

Query: 538 ITAKSFGRDRLYPISNKF 555
           ITA++FGRDR YPI+N F
Sbjct: 532 ITARAFGRDRRYPITNGF 549


>gi|254463160|ref|ZP_05076576.1| glutamine-dependent NAD(+) synthetase [Rhodobacterales bacterium
           HTCC2083]
 gi|206679749|gb|EDZ44236.1| glutamine-dependent NAD(+) synthetase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 557

 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 248/556 (44%), Positives = 347/556 (62%), Gaps = 9/556 (1%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           + +I + QLNP +GDIAGN AKAR A E     G DL+   E+FI GY  +DLV K +  
Sbjct: 9   RFRITLGQLNPTMGDIAGNAAKARTAWEAGRDAGADLVALPEMFILGYNSQDLVMKPAVQ 68

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
            AC +AI+ L  +   G A + +G P  +   + N+  I   G I +   K NLPN   F
Sbjct: 69  AACLAAIEALAVECAHGPA-LAIGGPAVEDGKLFNAYFICRGGKISSKSLKHNLPNEDVF 127

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E R F SG    P    + R+G  ICED W +  + + L++ GAEFL   N SPYY  K
Sbjct: 128 DEVRIFDSGPLGGPYSVGNTRIGSPICEDAW-HEEVAETLEETGAEFLLVPNGSPYYRGK 186

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
              R   +  ++    LP+IY+N VGGQD+ +FDG SF  +   +LA QM  F E   ++
Sbjct: 187 FDVRMNQMVSRVVETGLPLIYLNMVGGQDDQVFDGGSFALNPGGKLAIQMPVFDE--LIS 244

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
             H D   +   +  DD   T+ IP Q E+ DY  CV +LRDY+ K  F KV++G+SGGI
Sbjct: 245 --HVDLTRTDEGWRVDDGEKTI-IPGQFEQ-DYRVCVTALRDYMSKTGFKKVLLGMSGGI 300

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL A IAVDALG ENV+ +MLP +YTS  SL+DA  CA+ +G +Y+ +PI +  +   
Sbjct: 301 DSALVATIAVDALGGENVRCVMLPSEYTSQGSLDDAKDCAERIGAEYNFVPISEGRDAIT 360

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           + ++   +   + +  ENIQSR+RG +LMA+SN   +MLLTT NKSE++VGY T+YGDMS
Sbjct: 361 NTLAPLFEGLEADVTEENIQSRLRGLLLMAMSNKFGSMLLTTGNKSEVAVGYATIYGDMS 420

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GG+NP+KD+YK +VF++  WRN +     +GP  EV+PPSI++K PSAELRP Q D +SL
Sbjct: 421 GGYNPIKDMYKVRVFEVCRWRNENHFEWMMGPKGEVVPPSIIDKPPSAELRPDQKDSDSL 480

Query: 484 PPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           P YP+LD I++ +V+++ S        Y+   V+ +EHLLY SEYKR Q+  GT+++ ++
Sbjct: 481 PDYPVLDGILEMLVDDDASVAQCVAAGYDRAVVKKIEHLLYISEYKRFQSAPGTRLSRRA 540

Query: 543 FGRDRLYPISNKFRDH 558
           F  DR YPI N++RD+
Sbjct: 541 FWLDRRYPIVNRWRDN 556


>gi|148260979|ref|YP_001235106.1| NAD synthetase [Acidiphilium cryptum JF-5]
 gi|146402660|gb|ABQ31187.1| NH(3)-dependent NAD(+) synthetase [Acidiphilium cryptum JF-5]
          Length = 583

 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 267/558 (47%), Positives = 347/558 (62%), Gaps = 12/558 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L +AIAQL+  VG I  N+A  R AR EA R+G DL++  EL I+GYPPEDLV K 
Sbjct: 30  MTDTLTLAIAQLDLHVGAIDRNLAAIRAARAEAARRGADLLVTPELGIAGYPPEDLVLKP 89

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+ AC +A   L +DT DGG G++VG P + +  + N+  +LD G IIA R K  LPNY
Sbjct: 90  AFVAACEAAAAELAADTADGGPGVIVGLPWRAEGALHNAAFVLDGGRIIARRAKHELPNY 149

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G +  P++FR  RLG++ICED W  + + + L + GAE L S+N SP+ 
Sbjct: 150 GVFDEKRVFAPGPAPGPVMFRGFRLGVMICEDWWLPA-VSETLAETGAELLVSINGSPFE 208

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R ++   ++    LP ++    GGQDE++FDGASF  +  + LA +M HF    
Sbjct: 209 DGKLGVRLQLALNRVVETGLPFVFAAMTGGQDEIVFDGASFALNADRSLALRMPHFRAAI 268

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD--YNACVLSLRDYVQKNNFHKVIIG 298
               W            +   A    +P + E  D  Y A V+ L DYV KN F  VI+G
Sbjct: 269 ETLVWK--------RTTTGLVAEPHVLPPEPERLDLVYRAMVMGLADYVNKNGFPGVILG 320

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL AA+AVDALG   V+ +M+P +YTS  SLEDAAACA  LG + D +PI   
Sbjct: 321 LSGGIDSALSAAVAVDALGPARVRAVMMPSRYTSAHSLEDAAACADLLGIRCDTVPIGGA 380

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
              F +++    +     I  ENIQSR RG ILMALSN    M+LTT NKSE+SVGY TL
Sbjct: 381 TEAFAAVLEPLYEGRTPDITEENIQSRARGLILMALSNKLGHMVLTTGNKSEMSVGYATL 440

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM GG++ LKD+YKT VF L+ WRN++     LGP   V+P  ++ K PSAELR +QT
Sbjct: 441 YGDMCGGYSVLKDVYKTTVFALSHWRNANRPADALGPAGAVMPERVITKPPSAELRENQT 500

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQEYNDE-TVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLPPY +LD +++ +VE E+S        +D  TV  V  LL  +EYKRRQAP G K
Sbjct: 501 DQDSLPPYDVLDAVLEGLVEGEKSIEELVAAGHDRATVARVWKLLDRAEYKRRQAPPGVK 560

Query: 538 ITAKSFGRDRLYPISNKF 555
           ITA++FGRDR YPI+N F
Sbjct: 561 ITARAFGRDRRYPITNGF 578


>gi|332557776|ref|ZP_08412098.1| NAD synthetase [Rhodobacter sphaeroides WS8N]
 gi|332275488|gb|EGJ20803.1| NAD synthetase [Rhodobacter sphaeroides WS8N]
          Length = 554

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 253/562 (45%), Positives = 358/562 (63%), Gaps = 17/562 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M ++ ++ +AQLNP VGD+AGN A ARRA +EA   G D++  TE+F++GY  +DLV ++
Sbjct: 1   MTERFRLTLAQLNPTVGDLAGNAALARRAWDEARAAGSDMLALTEMFVTGYQTQDLVMRR 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++   + I+ L +D  +G A I +G P  +   ++N   +LD G + A   K +LPN 
Sbjct: 61  AFVEEAMATIERLAADCAEGPA-IGIGGPCLEGGRLMNVYWVLDGGRVSARVFKHHLPNA 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F SG  + P     +R+GI ICED W ++++C+ L + GAE L   N SPY+
Sbjct: 120 EVFDEKRVFSSGEVHGPCRVGPLRIGIPICEDSW-HADVCETLAETGAEILLVPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R  ++  ++    LP++Y+N VGGQD+ +FDGASF  +   +L  Q+  F E  
Sbjct: 179 REKLDVRVNLMVTRVVETGLPLVYLNMVGGQDDQVFDGASFVLNPHGRLMAQLPAFEEAL 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE----EADYNACVLSLRDYVQKNNFHKVI 296
                H D +       +D+    +  P+  +    EADY+A VLSLRDY+ K+ F +V+
Sbjct: 239 V----HVDFE------AADEGWRALPAPIVAQPDLWEADYHAMVLSLRDYLGKSGFSRVL 288

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL AAIA DALG E V+ +MLP ++TS  SLEDAAA A+ALGC+ D + I 
Sbjct: 289 LGLSGGIDSALVAAIAADALGPEAVRCVMLPSRFTSRASLEDAAAVARALGCRLDEVGIG 348

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
                  + +    +    GI  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY 
Sbjct: 349 GPQEAVGAALGPLFEGTEPGITEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYC 408

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           T+YGDM+GG+NP+KDLYKT+VFQ+  WRN H      GP  EVIPP +++K PSAELR  
Sbjct: 409 TIYGDMNGGYNPIKDLYKTRVFQMCRWRNGHHRPWMKGPEGEVIPPRVIDKPPSAELRED 468

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q D++SLPPY  LD I++ +V+ EES      + +  ETV  +E L+ GSE+KR Q+  G
Sbjct: 469 QKDEDSLPPYATLDAILEGLVDREESVAELVARGFERETVARIERLILGSEWKRFQSAPG 528

Query: 536 TKITAKSFGRDRLYPISNKFRD 557
           T++T ++F  DR YP+ N++RD
Sbjct: 529 TRLTRRAFWLDRRYPMVNRWRD 550


>gi|126461777|ref|YP_001042891.1| NAD synthetase [Rhodobacter sphaeroides ATCC 17029]
 gi|126103441|gb|ABN76119.1| NH(3)-dependent NAD(+) synthetase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 554

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 251/562 (44%), Positives = 358/562 (63%), Gaps = 17/562 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M ++ ++ +AQLNP VGD+AGN A ARRA +EA   G D++  TE+F++GY  +DLV ++
Sbjct: 1   MTERFRLTLAQLNPTVGDLAGNAALARRAWDEARAAGSDMLALTEMFVTGYQTQDLVMRR 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++   + I+ L +D  +G A I +G P  +   ++N+  +L+ G + A   K +LPN 
Sbjct: 61  AFVEEAMATIERLAADCAEGPA-IGIGGPCLEDGRLMNAYWVLEGGRVSARVFKHHLPNA 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F SG  + P     +R+GI ICED W + ++C+ L + GAE L   N SPY+
Sbjct: 120 EVFDEKRVFASGEVHGPCRVGPLRIGIPICEDSW-HPDVCETLAETGAEILLVPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R  ++  ++    LP++Y+N VGGQD+ +FDGASF  +   +L  Q+  F E  
Sbjct: 179 REKLDVRVNLMVTRVVETGLPLVYLNMVGGQDDQVFDGASFVLNPHGRLMAQLPAFEEAL 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE----EADYNACVLSLRDYVQKNNFHKVI 296
                H D +       +D+    +  P+  +    EADY+A VLSLRDY+ K+ F +V+
Sbjct: 239 V----HVDFE------ATDEGWRALPAPIVAQPDLWEADYHAMVLSLRDYLGKSGFSRVL 288

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL AAIA DALG E V+ +MLP ++TS  SLEDAAA A+ALGC+ D + I 
Sbjct: 289 LGLSGGIDSALVAAIAADALGPEAVRCVMLPSRFTSQASLEDAAAVARALGCRLDEVGIG 348

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
                  + +    +    G+  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY 
Sbjct: 349 GPQEAVGAALGPLFEGTEPGVTEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYC 408

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           T+YGDM+GG+NP+KDLYKT+VFQ+  WRN H      GP  EVIPP +++K PSAELR  
Sbjct: 409 TIYGDMNGGYNPIKDLYKTRVFQMCRWRNGHHCPWMKGPEGEVIPPRVIDKPPSAELRED 468

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q D++SLPPY  LD I++ +V+ EES      + +  ETV  +E L+ GSE+KR Q+  G
Sbjct: 469 QKDEDSLPPYATLDAILEGLVDREESVAELVARGFERETVARIERLILGSEWKRFQSAPG 528

Query: 536 TKITAKSFGRDRLYPISNKFRD 557
           T++T ++F  DR YP+ N++RD
Sbjct: 529 TRLTRRAFWLDRRYPMVNRWRD 550


>gi|221638758|ref|YP_002525020.1| NAD synthetase [Rhodobacter sphaeroides KD131]
 gi|221159539|gb|ACM00519.1| NH(3)-dependent NAD(+) synthetase [Rhodobacter sphaeroides KD131]
          Length = 564

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 252/562 (44%), Positives = 359/562 (63%), Gaps = 17/562 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M ++ ++ +AQLNP VGD+AGN A ARRA +EA   G D++  TE+F++GY  +DLV ++
Sbjct: 11  MTERFRLTLAQLNPTVGDLAGNAALARRAWDEARAAGSDMLALTEMFVTGYQTQDLVMRR 70

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++     I+ L +D  +G A I +G P  +   ++N+  +L+ G + A   K +LPN 
Sbjct: 71  AFVEEAMVTIERLAADCAEGPA-IGIGGPCLEDGRLMNAYWVLEGGRVSARVFKHHLPNA 129

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F SG  + P     +R+GI ICED W ++++C+ L + GAE L   N SPY+
Sbjct: 130 EVFDEKRVFSSGEVHGPCRVGPLRIGIPICEDSW-HADVCETLAETGAEILLVPNGSPYH 188

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R  ++  ++    LP++Y+N VGGQD+ +FDGASF  +   +L  Q+  F E  
Sbjct: 189 REKLDVRVNLMVTRVVETGLPLVYLNMVGGQDDQVFDGASFVLNPHGRLMAQLPAFEEAL 248

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE----EADYNACVLSLRDYVQKNNFHKVI 296
                H D +       +D+    +  P+  +    EADY+A VLSLRDY++K+ F +V+
Sbjct: 249 V----HVDFE------ATDEGWRALPAPIVAQPDLWEADYHAMVLSLRDYLRKSGFSRVL 298

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL AAIA DALG E V+ +MLP ++TS  SLEDAAA A+ALGC+ D + I 
Sbjct: 299 LGLSGGIDSALVAAIAADALGPEAVRCVMLPSRFTSRPSLEDAAAVARALGCRLDEVGIG 358

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
                  + +    +    GI  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY 
Sbjct: 359 GPQEAVGAALGPLFEGTEPGITEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYC 418

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           T+YGDM+GG+NP+KDLYKT+VFQ+  WRN H      GP  EVIPP +++K PSAELR  
Sbjct: 419 TIYGDMNGGYNPIKDLYKTRVFQMCRWRNGHHRPWMKGPPGEVIPPRVIDKPPSAELRED 478

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q D++SLPPY  LD I++ +V+ EES      + +  ETV  +E L+ GSE+KR Q+  G
Sbjct: 479 QKDEDSLPPYATLDAILEGLVDREESVAELVARGFERETVARIERLILGSEWKRFQSAPG 538

Query: 536 TKITAKSFGRDRLYPISNKFRD 557
           T++T ++F  DR YP+ N++RD
Sbjct: 539 TRLTRRAFWLDRRYPMVNRWRD 560


>gi|146277632|ref|YP_001167791.1| NAD synthetase [Rhodobacter sphaeroides ATCC 17025]
 gi|145555873|gb|ABP70486.1| NH(3)-dependent NAD(+) synthetase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 554

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 251/563 (44%), Positives = 359/563 (63%), Gaps = 17/563 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M ++ ++ +AQLNP VGD+A N+A AR+A E A   G D++  TE+F++GY  +DLV ++
Sbjct: 1   MTERFRLTLAQLNPTVGDLAANVALARKAWEAARAAGSDMVALTEMFVTGYQTQDLVMRR 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++   +AI+ L +D  +G A I +G P  + + ++N   +L+ G + A   K +LPN 
Sbjct: 61  AFVRDAMAAIERLAADCAEGPA-IGIGGPCLEGDRLMNGYWLLEGGRVTATVFKHHLPNG 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F SG  + P     +R+GI ICED W + ++C+ L + GAE L   N SPY+
Sbjct: 120 EVFDEKRLFSSGEVHGPCRVGPLRIGIPICEDSW-HPDVCETLAETGAEILLVPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R  ++  ++    LP++Y+N VGGQD+ +FDGASF  +   +L  Q+  F E  
Sbjct: 179 REKLDVRVNLMVTRVVETGLPLVYLNMVGGQDDQVFDGASFVLNPHGRLMAQLPAFEEAL 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE----EADYNACVLSLRDYVQKNNFHKVI 296
                H D +       +D+    +  P+  +    EADY+A V+ LRDY+ K+ F +V+
Sbjct: 239 V----HVDFE------ATDEGWRALPAPIVAQPDLWEADYHAMVVGLRDYLGKSGFSRVL 288

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL AAIA DALG E V+ +MLP +YTS  SLEDAAA A+ALGC+ D + I 
Sbjct: 289 LGLSGGIDSALVAAIAADALGPEAVRCVMLPSRYTSRHSLEDAAAVARALGCRLDEVGIE 348

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
                  + +    +    GI  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY 
Sbjct: 349 GPQEAVGAALGPLFEGTAPGITEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYC 408

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           T+YGDM+GGFNP+KDLYKT+VFQ+  WRN+H      GP  EVIPP +++K PSAELR  
Sbjct: 409 TIYGDMNGGFNPIKDLYKTRVFQMCRWRNAHHRPWMKGPAGEVIPPRVIDKPPSAELREG 468

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q D++SLPPY  LD I++ +V+ EES      + ++ ETV  VE L++ SE+KR Q+  G
Sbjct: 469 QKDEDSLPPYATLDAILEGLVDREESAAELVARGFDRETVTKVERLIFLSEWKRFQSAPG 528

Query: 536 TKITAKSFGRDRLYPISNKFRDH 558
           T++T ++F  DR YP+ N++RD 
Sbjct: 529 TRLTRRAFWLDRRYPMVNRWRDE 551


>gi|56695341|ref|YP_165689.1| NAD synthetase [Ruegeria pomeroyi DSS-3]
 gi|56677078|gb|AAV93744.1| glutamine-dependent NAD(+) synthetase [Ruegeria pomeroyi DSS-3]
          Length = 552

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 248/559 (44%), Positives = 345/559 (61%), Gaps = 11/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I +AQLNP VGD+AGN AKAR A E     G DL+   E+F++GY  +DLV K 
Sbjct: 1   MADRFRITLAQLNPTVGDLAGNAAKARMAWEHGREAGADLVALPEMFVTGYNTQDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F  A  + I+ L  +  DG A + +G P  ++  + N+ +IL  G I++   K +LPN 
Sbjct: 61  VFHDAAIAMIEALAEECADGPA-LAIGGPLVEEGKLYNAYLILKGGKIVSRSLKTHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W + ++ + L + GAEFL   N SPYY
Sbjct: 120 TVFDEVRIFDAGPLGGPYSVGNTRIGSPICEDAW-HEDVAETLAETGAEFLLVPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K   R   +  ++    LP+IY+N VGGQD+ +FDG +F  +    LAF+M  F E  
Sbjct: 179 RDKYDMRINQMVARVVETGLPLIYLNMVGGQDDQVFDGGTFGLNPGGALAFRMPVFDEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE-EADYNACVLSLRDYVQKNNFHKVIIGL 299
            +T    ++    W  +  + A     PL +  E DY   V SLRDY++K  F KV++GL
Sbjct: 238 -ITHVDLERGSEGWQIVQGEVA-----PLPDAWEQDYRVMVESLRDYMRKTGFAKVLLGL 291

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGG+DSAL AAIA DALG ENV+ +MLP +YTS  SL+DA A A+ALG +YD +PI +  
Sbjct: 292 SGGVDSALVAAIATDALGPENVRCVMLPSEYTSRSSLDDAEAVAQALGVRYDYVPISESR 351

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
               + ++        G+  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+Y
Sbjct: 352 AAVTNTLAPLFAGTEPGLTEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYATIY 411

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVI PS+++K PSAELR  Q D
Sbjct: 412 GDMAGGYNPIKDLYKTRVFETCRWRNANHRLWMMGPAGEVIRPSVIDKPPSAELREDQKD 471

Query: 480 QESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
            +SLP YP LD I+  +V+ + S  +     ++ +  R VEHL+Y SEYKR QA  G ++
Sbjct: 472 SDSLPDYPELDAILDILVDQDGSIADCVAAGFDRDVARRVEHLIYISEYKRYQAAPGARL 531

Query: 539 TAKSFGRDRLYPISNKFRD 557
           T ++F  DR YPI N++RD
Sbjct: 532 TPRAFWLDRRYPIVNRWRD 550


>gi|260431460|ref|ZP_05785431.1| glutamine-dependent NAD(+) synthetase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415288|gb|EEX08547.1| glutamine-dependent NAD(+) synthetase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 570

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 255/561 (45%), Positives = 342/561 (60%), Gaps = 13/561 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    +I +AQLNP+VGDIAGN AKAR A E+    G DL+   E+FI+GY  +DLV K 
Sbjct: 19  MADHFRITLAQLNPIVGDIAGNAAKARSAWEQGRAAGADLVALPEMFITGYNTQDLVQKP 78

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F QA   A+  L +D  DG A + +G P  + + + N+ +IL+ G I++   K +LPN 
Sbjct: 79  VFHQAAMDAVRQLATDCADGPA-LAIGGPWAEGDKLYNAYLILNQGRIVSKVFKHHLPNE 137

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W + ++ + L + GAEFL   N SPY+
Sbjct: 138 TVFDEVRLFDAGPLGGPYAVGNTRVGSPICEDGW-HEDVAETLAETGAEFLLIPNGSPYF 196

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK   R   +  ++    LP+IY+N VGGQD+ +FDG SF  +    LAF+M  F E  
Sbjct: 197 RNKYDIRLNQMVARVVETGLPVIYLNMVGGQDDQVFDGGSFGLNPGGALAFRMPVFDEAV 256

Query: 241 FMTEWHYDQQLSQ--WNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
                H D Q  +  W  +    A          E DY A V +LRDY+ K  F K ++G
Sbjct: 257 T----HVDLQRGEQGWTIVPGAVAEQP----DAWEQDYRAMVQALRDYMAKTGFSKALLG 308

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGG+DSAL A IAVDALG ENV+ +MLP +YTS  SLEDA A AKALG +YD +PI   
Sbjct: 309 LSGGVDSALVATIAVDALGAENVRCVMLPSEYTSAASLEDAEAVAKALGVQYDYVPISQS 368

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
                  ++       + I  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+
Sbjct: 369 RAAVTETLAPLFAGRRADITEENIQSRLRGLLLMAISNKFGEMLLTTGNKSEVAVGYATI 428

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GG+NP+KDLYKT+VF+   WRN++      GP  EVI PS+++K PSAELR  Q 
Sbjct: 429 YGDMNGGYNPIKDLYKTRVFETCRWRNANHRDWMKGPAGEVIRPSVIDKPPSAELREDQK 488

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTK 537
           D +SLP YP+LD I++ +V+ + S  +      DE   R VEHL+Y SEYKR Q+  GT+
Sbjct: 489 DSDSLPDYPVLDGILEILVDRDGSIADCVAAGFDEADARRVEHLIYISEYKRFQSAPGTR 548

Query: 538 ITAKSFGRDRLYPISNKFRDH 558
           +T ++F  DR YPI N++RD 
Sbjct: 549 LTNRAFWLDRRYPIVNRWRDR 569


>gi|77462885|ref|YP_352389.1| NAD synthetase [Rhodobacter sphaeroides 2.4.1]
 gi|77387303|gb|ABA78488.1| NH(3)-dependent NAD(+) synthetase [Rhodobacter sphaeroides 2.4.1]
          Length = 554

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 251/562 (44%), Positives = 357/562 (63%), Gaps = 17/562 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M ++ ++ +AQLNP VGD+AGN A ARRA +EA   G D++  TE+F++GY  +DLV ++
Sbjct: 1   MTERFRLTLAQLNPTVGDLAGNAALARRAWDEARAAGSDMLALTEMFVTGYQTQDLVLRR 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++   + I+ L +D  +G A I +G P  +   ++N+  +L+ G + A   K +LPN 
Sbjct: 61  AFVEEAMATIERLAADCAEGPA-IGIGGPCLEDGRLMNAYWVLEGGRVSARVFKHHLPNA 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F SG  + P     +R+GI ICED W + ++C+ L + GAE L   N SPY+
Sbjct: 120 EVFDEKRVFSSGEVHGPCRVGPLRIGIPICEDSW-HPDVCETLAETGAEILLVPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R  ++  ++    LP++Y+N VGGQD+ +FDGASF  +   +L  Q+  F E  
Sbjct: 179 REKLDVRVNLMVTRVVETGLPLVYLNMVGGQDDQVFDGASFVLNPHGRLMAQLPAFEEAL 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE----EADYNACVLSLRDYVQKNNFHKVI 296
                H D +       +D+    +  P+  +    EADY+A VLSLRDY+ K+ F +V+
Sbjct: 239 V----HVDFE------AADEGWRALPAPIVAQPDLWEADYHAMVLSLRDYLGKSGFSRVL 288

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL AAIA DALG E V+ +MLP ++TS  SLEDAAA A+ALGC+ D + I 
Sbjct: 289 LGLSGGIDSALVAAIAADALGPEAVRCVMLPSRFTSQASLEDAAAVARALGCRLDEVGIG 348

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
                  + +    +    GI  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY 
Sbjct: 349 GPQEAVGAALGPLFEGTEPGITEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYC 408

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           T+YGDM+GG+NP+KDLYKT+VFQ+  WRN H      GP  EVIPP +++K PSAELR  
Sbjct: 409 TIYGDMNGGYNPIKDLYKTRVFQMCRWRNGHHRPWMKGPEGEVIPPRVIDKPPSAELRED 468

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q D++SLPPY  LD I++ +V+ EE       + +  ETV  +E L+ GSE+KR Q+  G
Sbjct: 469 QKDEDSLPPYATLDAILEGLVDREEGVAELVARGFERETVARIERLILGSEWKRFQSAPG 528

Query: 536 TKITAKSFGRDRLYPISNKFRD 557
           T++T ++F  DR YP+ N++RD
Sbjct: 529 TRLTRRAFWLDRRYPMVNRWRD 550


>gi|83310332|ref|YP_420596.1| NAD synthetase [Magnetospirillum magneticum AMB-1]
 gi|82945173|dbj|BAE50037.1| Glutamine-dependent NAD(+) synthetase [Magnetospirillum magneticum
           AMB-1]
          Length = 551

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 256/556 (46%), Positives = 345/556 (62%), Gaps = 10/556 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L IA+AQ+NPVVGDIAGN+A  R AR EA   G DL++F EL + GYPPEDLV K 
Sbjct: 1   MSDTLSIALAQINPVVGDIAGNMALIRAARAEAQVLGADLVVFGELTLCGYPPEDLVLKG 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+ A   A     +   +GG  ++VG P + ++ + N+ ++LD G + A R K +LPNY
Sbjct: 61  AFLDA-CEAAVEELAAETEGGPALLVGAPWRVKDRLHNAALLLDHGRVAATRLKHHLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F  G +  P+ FR +RLGI+ICED+W  +++ + L + GAE L   N SPY 
Sbjct: 120 GVFDEIRVFQPGPAPGPVSFRGVRLGIMICEDMWY-ADVAETLGESGAEILVVPNGSPYE 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K  KR +    ++    LP+IYVNQVGGQDEL+FDGASF  D     A  +  +  Q 
Sbjct: 179 MDKPTKRLDHARARVEETGLPLIYVNQVGGQDELVFDGASFVLDSDGATAASIAPWQSQV 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T W          +  D   +    P+   E  Y A V  LRDYV KN F  V++GLS
Sbjct: 239 ILTRWTRGSG----GWRCDGPKAP---PVSRLEGVYQALVTGLRDYVGKNRFPGVVLGLS 291

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+CAAIA DALG + V  +M+P  YTS +SLEDAA CA+ LG + D + I   + 
Sbjct: 292 GGIDSAICAAIAADALGPDKVWCVMMPSPYTSEESLEDAAECARLLGVRLDTVNIGPAMG 351

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F ++++     + + I  EN+QSR RG  LM +SN    M+L+T NKSE+S GY TLYG
Sbjct: 352 AFETMLAPLFAGKDADITEENLQSRSRGLTLMGISNKFGPMVLSTGNKSEMSCGYATLYG 411

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GG+  LKD+YKT VF L+SWRN       LGP   V+P  ++ K PSAEL+P Q DQ
Sbjct: 412 DMCGGYAVLKDVYKTTVFALSSWRNGQRPPGCLGPQGRVMPDRVITKPPSAELKPDQKDQ 471

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           ++LPPY  LD +++ ++E+E+S        Y++  VR V  +L  +EYKRRQAP G KIT
Sbjct: 472 DTLPPYDELDAMLEAMIEDEKSVAEIVAAGYDEAVVRRVWRMLDRAEYKRRQAPPGVKIT 531

Query: 540 AKSFGRDRLYPISNKF 555
           ++SFG+DR YPI+N F
Sbjct: 532 SRSFGKDRRYPITNAF 547


>gi|114762129|ref|ZP_01441597.1| NAD(+) synthase [Pelagibaca bermudensis HTCC2601]
 gi|114545153|gb|EAU48156.1| NAD(+) synthase [Roseovarius sp. HTCC2601]
          Length = 552

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 241/558 (43%), Positives = 344/558 (61%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ IAQLNP +GD+AGN A+A+ A E+A   G D++   E+FI+GY  +DL  K 
Sbjct: 1   MADRFRLTIAQLNPTMGDLAGNAAQAKDAWEQAKAAGADMVALPEMFIAGYNAQDLPMKH 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F   C +A+  L  D  DG + + +G P  +   + N+ +I   G ++    K +LPNY
Sbjct: 61  AFTLDCMAAVKALAEDCADGPS-LGIGCPWVEGTELYNAYIICRGGKMVTQVFKHHLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F SG    P    + R+G  ICED W   ++ + L + GAEFL   N SPY+
Sbjct: 120 NVFDELRIFDSGPIGGPYAVGNTRIGSPICEDAWYE-DVAETLAETGAEFLLVPNGSPYF 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK + R   +  ++    LP+IY+N VGGQD+ IFDG SF  +    +A Q+  F E  
Sbjct: 179 RNKYETRLNKMIARVVETGLPLIYLNMVGGQDDQIFDGGSFVLNPHGAVALQLPVFEEAI 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                H D + ++  + + +   T +    E+  DY+A VL+LRDY +K  F KV++G+S
Sbjct: 239 A----HVDLERTEDGWRALEGDFTTHPDAMEQ--DYHAMVLALRDYCRKTGFGKVLLGMS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL A IAVDALG ENV+ +MLP +YTS  SLEDA ACA+ LGC YD +PI    +
Sbjct: 293 GGVDSALVATIAVDALGAENVRCVMLPSEYTSEHSLEDAKACAENLGCHYDFVPITPGRD 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +   + +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITETLAPLFEGRDADLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DMSGG+NP+KDLYKT+VF +  WRN++     +GP    IP  I+ K PSAELR  Q D 
Sbjct: 413 DMSGGYNPIKDLYKTRVFDICRWRNANARPWMMGPEAAPIPERIITKPPSAELRDDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I++ +V+++ S  +     Y+    + VEHLLY SEYKR Q+  G +++
Sbjct: 473 DSLPDYPVLDGILQILVDDDGSIADCVAAGYDRADAKKVEHLLYISEYKRFQSAPGARLS 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 KRAFWLDRRYPIVNRWRD 550


>gi|260428890|ref|ZP_05782867.1| glutamine-dependent NAD(+) synthetase [Citreicella sp. SE45]
 gi|260419513|gb|EEX12766.1| glutamine-dependent NAD(+) synthetase [Citreicella sp. SE45]
          Length = 552

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 245/559 (43%), Positives = 337/559 (60%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ IAQLNPV+GD+AGN A+AR A E+    G D++   E+FI+GY P+DL  K 
Sbjct: 1   MADRFRLTIAQLNPVLGDLAGNAAQARDAWEQGKAAGADMVALPEMFIAGYSPQDLPSKN 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F   C +A+  L  D  DG   + +G P  +   + N+ VI   G I     K +LPNY
Sbjct: 61  AFTLDCMAAVRQLAEDCADGPT-LAIGTPWVEGTELYNAYVICRGGKITTQVFKHHLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R + SG    P    + R+G  +CED W   ++ + L + GAEFL   N SPY+
Sbjct: 120 EVFDELRIYDSGPIGGPYAVGNTRVGSPVCEDAWYE-DVAETLAETGAEFLLVPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K + R   +  ++    LP+IYVN  GGQD+ IFDG SF  +   Q+A Q+  F E  
Sbjct: 179 RDKYETRLNKMVARVIETGLPLIYVNMTGGQDDQIFDGGSFVLNPHGQVAVQLPVFEE-- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +      +  S W  +  D            E DYNA V++LRDY +K  F KV++GLS
Sbjct: 237 VVAHVDLGRTESGWRALEGDFTRHP----DSMEQDYNAMVVALRDYCRKTGFGKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL A IAVDALG  NV+ +MLP +YTS  SLEDA ACA+ALGC YD +PI    +
Sbjct: 293 GGIDSALVATIAVDALGAGNVRCVMLPSEYTSEHSLEDAKACAEALGCHYDFVPITPGRD 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++   +     +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITATLAPLFEGLKPDLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF +  WRN++      GP    IP  I+ K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFDICRWRNANHRGWMSGPGAAPIPERIITKPPSAELRADQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I+K +V+++ S  +     Y+    + VEHLLY SEYKR Q+  G +++
Sbjct: 473 DSLPDYPVLDGILKILVDDDGSIADCVAAGYDRADAKKVEHLLYISEYKRFQSAPGARLS 532

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++F  DR YPI N++RD+
Sbjct: 533 KRAFWLDRRYPIVNRWRDN 551


>gi|84499552|ref|ZP_00997840.1| NAD(+) synthase [Oceanicola batsensis HTCC2597]
 gi|84392696|gb|EAQ04907.1| NAD(+) synthase [Oceanicola batsensis HTCC2597]
          Length = 552

 Score =  461 bits (1187), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 249/558 (44%), Positives = 335/558 (60%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I + QLNP VGDIAGN A AR+A E     G DL+   E+F++GY  +DLV K 
Sbjct: 1   MTDRFRITLCQLNPTVGDIAGNAALARQAWETGKAAGADLVALPEMFVTGYQTQDLVGKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F QA  +AI+TL +D  DG A + +G P  +   + N   IL  G +I+   K NLPN 
Sbjct: 61  VFHQAALAAIETLAADCADGPA-LAIGGPALEGASLFNGYHILSGGRVISRILKHNLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R + S     P     +R+G  ICED W +S + + L + GAE L   N SPYY
Sbjct: 120 TVFDEVRLYGSAAPAGPYSIGGVRIGSPICEDAW-HSEVPETLAETGAEILLVPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K++ R+  +  ++    LP+IY+N  GGQD+ +FDG SF  +   ++AF M  F +Q 
Sbjct: 179 RGKMETRYNHMVARVVETGLPLIYLNMTGGQDDQVFDGGSFGLNPGGRMAFHMPVFDQQ- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T     +    W     D      +P  E E DY   V +LRDY +K  F KV++GLS
Sbjct: 238 -ITHVDLTRTPEGWRI---DEGEKAAMP-DEWEQDYRCMVEALRDYCRKTGFGKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A IA DALG ENV+ +MLP +YTS  SLEDA A A+ALGC+Y  LPI     
Sbjct: 293 GGIDSAIVATIAADALGPENVRCVMLPSEYTSDHSLEDARAVARALGCRYHDLPISQGRQ 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +     +  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITETLAPLFEGTDPDVTEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVIP  I+ K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFEQCRWRNANHRDWMMGPPGEVIPDRIITKPPSAELRADQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I+  +V+ + S  +     Y  E  + VE L+Y SEYKR Q+  GT++T
Sbjct: 473 DSLPDYPVLDAILNILVDLDGSVADCVAAGYRREDAKQVERLIYLSEYKRFQSAPGTRLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
             +F  DR YPI N++RD
Sbjct: 533 KHAFWLDRRYPIVNRWRD 550


>gi|56479437|ref|YP_161026.1| NAD synthetase [Aromatoleum aromaticum EbN1]
 gi|56315480|emb|CAI10125.1| Glutamine-dependent NAD+ synthetase [Aromatoleum aromaticum EbN1]
          Length = 538

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 243/559 (43%), Positives = 347/559 (62%), Gaps = 23/559 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M K L IA+AQLN  VGD+  N  +  RA ++A   G DL+L  EL +SGYPPEDL+ + 
Sbjct: 1   MDKTLAIAVAQLNFTVGDLTANADRIIRALDQARAAGADLLLTPELALSGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F +ACS  +  +    H  G  +V+G P + ++   N+  ++  G ++A   K  LPNY
Sbjct: 61  DFYRACSREVARIA--LHTDGITLVLGHPEERRDWRYNAASVIRDGEVLATYHKHLLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E+R F  G          ++LG+ IC D+W+ S   + ++ +GAE L  LNASPY+
Sbjct: 119 EVFDEERYFDRGLDACVFELNGVKLGVNICADLWE-SGPAELVRAEGAELLLGLNASPYH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NKL +R+E++ G+++   LP++Y N VGGQDEL+FDGASF  D   Q+ +Q   F E+ 
Sbjct: 178 MNKLARRYEVLRGRVADTGLPVVYCNMVGGQDELVFDGASFALDADGQVRYQAASFEER- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +   H+  +  +W       A     P++EE   Y A    +RDY+ KN F   IIGLS
Sbjct: 237 -LDVLHF--RGGRWEPGEIVPAR----PIEEEV--YEALKTGVRDYLGKNGFPGAIIGLS 287

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL   IAVDALG E V+ +M+P  YT+  SL+D+ A    LG +YD +PI   +N
Sbjct: 288 GGIDSALTLCIAVDALGPERVRAVMMPSPYTAQMSLDDSRALVANLGVRYDEIPIEPAMN 347

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F  L+++  +  P+    EN+QSRIRG ILMALSN + A++LTT NKSE++ GY TLYG
Sbjct: 348 TFADLLARQFEGLPADTTEENLQSRIRGMILMALSNKTGAIVLTTGNKSEMATGYATLYG 407

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  LKDLYKT VF+L+ WRN+         ++ V+P +I+ + PSAEL+P QTDQ
Sbjct: 408 DMAGGFAVLKDLYKTFVFRLSRWRNT---------VSPVMPENIITRPPSAELKPDQTDQ 458

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD II+  +E +ES      + + +  VR    +L  +EYKRRQ+PVG ++T
Sbjct: 459 DSLPPYDVLDAIIEAYMERDESPREIIARGFPEADVRRTVAMLKRNEYKRRQSPVGIRVT 518

Query: 540 AKSFGRDRLYPISNKFRDH 558
            + FGRD  YPI+++++D 
Sbjct: 519 RRGFGRDWRYPITSRYQDE 537


>gi|149915731|ref|ZP_01904256.1| NAD(+) synthase [Roseobacter sp. AzwK-3b]
 gi|149810313|gb|EDM70158.1| NAD(+) synthase [Roseobacter sp. AzwK-3b]
          Length = 552

 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 245/561 (43%), Positives = 340/561 (60%), Gaps = 15/561 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    ++ +AQ NP +GD+ GN   ARRA       G +L+   E+FI+GY  +DLV K 
Sbjct: 1   MADSFRLTLAQWNPTMGDLDGNADLARRAWRTGREAGANLVALPEMFITGYNTQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVL-NSVVILDAGNIIAVRDKINLPN 119
           +F  A  +AI++L  D  DG A + +G P   Q+GVL N+  IL  G I +   K +LPN
Sbjct: 61  AFHTAAIAAIESLARDCADGPA-LAIGGPAL-QDGVLYNAYYILQEGRIASRVFKHHLPN 118

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
            + F EKR + +G    P     +R+G  ICED W   ++ + L + GA+ L   N SPY
Sbjct: 119 ETVFDEKRIYAAGAVTGPYAVDGLRIGSPICEDSWYE-DVAETLAETGAQILLVPNGSPY 177

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           Y  KL  RH+I+  ++    LP+IY+N VGGQD+ +FDG SF  +    LA QM    E 
Sbjct: 178 YRQKLSHRHQIMVARVIETGLPLIYLNLVGGQDDQVFDGGSFALNPGGALALQMPLMQEA 237

Query: 240 NFMTEWHYDQQLSQ--WNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
                 H D   ++  W     D A    +P    E DY+A VLSLRDY++K  F KV++
Sbjct: 238 TA----HLDLTRTEDGWRITPSDLAP---VP-DAMEQDYHAMVLSLRDYLRKTGFRKVLL 289

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSAL A +AVDALG ENV+ +MLP  YTS  SL+DA   A+ LGC+YD +PI +
Sbjct: 290 GLSGGIDSALVACVAVDALGPENVRCVMLPSDYTSQASLDDAETLARTLGCRYDTVPIAE 349

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
                   ++   +     I  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T
Sbjct: 350 GRQAITRTLAPLFEGTAPDITEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYAT 409

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           +YGDM+GG+NPLKD+YKT+VF    WRN+      +GP+  VIP  ++++ PSAEL P Q
Sbjct: 410 IYGDMAGGYNPLKDMYKTRVFDTCRWRNTVHRDWMMGPVGAVIPQRVIDRPPSAELAPDQ 469

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            D++SLP Y +LD I++ +V+ + S  +     ++      VEHLLY SEYKR Q+  GT
Sbjct: 470 RDEDSLPAYSVLDGILEILVDQDGSIADCVAAGFDRADASRVEHLLYISEYKRFQSAPGT 529

Query: 537 KITAKSFGRDRLYPISNKFRD 557
           +++ ++F  DR YPI+N++RD
Sbjct: 530 RLSKRAFWLDRRYPIANRWRD 550


>gi|163743987|ref|ZP_02151356.1| NAD synthetase [Phaeobacter gallaeciensis 2.10]
 gi|161382747|gb|EDQ07147.1| NAD synthetase [Phaeobacter gallaeciensis 2.10]
          Length = 552

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 246/558 (44%), Positives = 341/558 (61%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGD+AGN  KAR A       G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MADRFRVTLAQLNPTVGDLAGNANKAREAWAAGRDAGADLVALPEMFITGYNTQDLVQKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F QA  + ++ L +D  DG A + VG P      + N+ +IL  G I     K +LPN 
Sbjct: 61  VFHQAAIAEVERLAADCADGPA-LAVGSPWVADGKLFNAYLILKGGKITTQVLKHHLPNA 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W   ++ + L + GAEFL   N SPY+
Sbjct: 120 TVFDEVRIFDAGPLGGPYAVGNTRIGSPICEDGWY-EDVAETLAETGAEFLLIPNGSPYF 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK+  R   +  +     LP+IY+N VGGQD+ +FDG SF  +    LA QM  F E  
Sbjct: 179 RNKMDVRFNHMVARAVETDLPVIYLNMVGGQDDQVFDGGSFVLNPGGALALQMPVFDE-- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                H D + +   + + D A    +P  E E DY+   LSLRDY++K  F KV++GLS
Sbjct: 237 --AIQHLDLERTAEGWRAVDGAKAS-LP-DEWEQDYHVMTLSLRDYMRKTGFKKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ A IAVDALG ENV+ +MLP +YTS +SL+DA A AKALG  YD +PI +   
Sbjct: 293 GGVDSAIVATIAVDALGAENVRCVMLPSEYTSQESLDDAEAVAKALGVHYDYVPIAEGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++        G+  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITNTLAPLFAGLDEGLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVI P++++K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFETCRWRNANHRDWMMGPEGEVIRPNVIDKPPSAELRDDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD +++ +V+ + S  +     ++ E  + VEHL+Y SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPELDALLEILVDRDGSIADCVAAGFSRENAKRVEHLIYISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 PRAFWLDRRYPIVNRWRD 550


>gi|310816658|ref|YP_003964622.1| glutamine-dependent NAD(+) synthetase [Ketogulonicigenium vulgare
           Y25]
 gi|308755393|gb|ADO43322.1| glutamine-dependent NAD(+) synthetase [Ketogulonicigenium vulgare
           Y25]
          Length = 554

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 247/559 (44%), Positives = 346/559 (61%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +  ++ +AQLNPVVGDI  N A+ARR   +A   G D I+  E+F+ GY  +DLV + 
Sbjct: 1   MGETFRLTLAQLNPVVGDIEANAARARRVFHDARAAGSDFIVLPEMFLIGYQAQDLVLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F +  ++A+  L  DT DGG  + +G P ++ + + N+  IL  G + A+  K  LPNY
Sbjct: 61  AFQRDAAAALAQLARDT-DGGPALGIGLPWREGDELFNAYAILSGGKVQAMVRKHELPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRD-IRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
             F E+R F +G  + P+ F    R+G+ ICED W   ++ + + + GAE L   N SPY
Sbjct: 120 GVFDERRYFAAGPISGPVAFEGGPRIGLPICEDAW-FPDVAEAMAESGAEILVVPNGSPY 178

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
              K   R + +  +++   LP++Y+N VGGQD+ +FDG SF       LA Q+  F+E 
Sbjct: 179 SRGKYDVRVQRMVSRVTENDLPLVYLNMVGGQDDQVFDGGSFVLGHGGGLAAQLPFFTE- 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
              T  H D    +        ++  ++P  E   DY A   +LRDYV+K+ F +V++GL
Sbjct: 238 ---TVSHIDFTRCETGGWQPQRSTLAHVP-DEHALDYQAMTTALRDYVRKSGFSRVLLGL 293

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL AAIAVDALG ENV+ +MLP +YTS  SLEDA  CA+ALG K D + I   V
Sbjct: 294 SGGIDSALVAAIAVDALGAENVRGVMLPSRYTSDHSLEDAEVCARALGIKLDTVEIAGPV 353

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
               + ++       + +  ENIQSR+RG +LMA SN    MLLTT NKSE+ VGY T+Y
Sbjct: 354 AAAEAALAPLFAGHDADLTEENIQSRMRGLLLMAQSNKFGEMLLTTGNKSEMCVGYATIY 413

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GG+NP+KDLYKT+VF +A+WRN++      GP  EVIP  I+ K PSAELRP Q D
Sbjct: 414 GDMNGGYNPIKDLYKTRVFAVAAWRNANHFDWMAGPAGEVIPTRIITKPPSAELRPDQKD 473

Query: 480 QESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           ++SLPPYP+LD I+  +V+ + S  +     YN ETV+ VEHL+  SEYKR Q+  G K+
Sbjct: 474 EDSLPPYPVLDAILDLMVDRDASVADCVAAGYNRETVKRVEHLVAISEYKRFQSAPGVKL 533

Query: 539 TAKSFGRDRLYPISNKFRD 557
           + ++   DR YPI N++RD
Sbjct: 534 SRRALWLDRRYPIVNRWRD 552


>gi|254477369|ref|ZP_05090755.1| glutamine-dependent NAD(+) synthetase [Ruegeria sp. R11]
 gi|214031612|gb|EEB72447.1| glutamine-dependent NAD(+) synthetase [Ruegeria sp. R11]
          Length = 554

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 247/558 (44%), Positives = 342/558 (61%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGDIAGN  KAR A       G DL+   E+FI+GY  +DL+ K 
Sbjct: 1   MADRFRVTLAQLNPTVGDIAGNADKARAAWAAGKEAGADLVALPEMFITGYNTQDLIQKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q+  + ++ L +D  DG A + +G P      + N+ +IL  G I A   K +LPN 
Sbjct: 61  IFHQSAIAEVERLAADCADGPA-LAIGSPWVRDGNLYNAYLILQGGKISAQVLKHHLPNA 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F SG    P     +R+G  ICED W   ++ + L + GAEFL   N SPYY
Sbjct: 120 TVFDEVRLFQSGPLGGPYAVGGVRIGSPICEDGWYE-DVAETLAETGAEFLLIPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK++ R  ++  +     LP+IY+N VGGQD+ +FDG SF  +    LA QM  F E  
Sbjct: 179 RNKMEVRQNLMVARTVETGLPVIYLNMVGGQDDQVFDGGSFVLNPGGALALQMPVFDEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     ++    W  +  + AS   +P    E DY     +LRDY++K  F KV++GLS
Sbjct: 238 -IQHLDLERTPDGWRAVEGEKAS---LP-DAWEQDYQVMTYALRDYMRKTGFKKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL AAIAVDALG ENV+ +MLP +YTS  SL+DA A AKALG  YD +PI +   
Sbjct: 293 GGVDSALVAAIAVDALGAENVRCVMLPSEYTSQGSLDDAEAVAKALGVHYDYVPISEGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++        G+  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITNTLAPLFAGLEEGLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVI PS+++K PSAELR  Q D 
Sbjct: 413 DMNGGYNPIKDLYKTRVFETCRWRNANHRPWMMGPEGEVIRPSVIDKPPSAELREDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD +++ +V+ E S  +     ++ E  + VEHL+Y SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPELDALLEMLVDQEASIADCVAAGFDREVAKRVEHLIYISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI+N++RD
Sbjct: 533 PRAFWLDRRYPIANRWRD 550


>gi|163736854|ref|ZP_02144272.1| NAD+ synthetase [Phaeobacter gallaeciensis BS107]
 gi|161389458|gb|EDQ13809.1| NAD+ synthetase [Phaeobacter gallaeciensis BS107]
          Length = 552

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 245/558 (43%), Positives = 339/558 (60%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGD+AGN  KAR A       G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MADRFRVTLAQLNPTVGDLAGNANKAREAWAAGRDAGADLVALPEMFITGYNTQDLVQKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F QA  + ++ L +D  DG A + VG P      + N+ +IL  G I     K +LPN 
Sbjct: 61  VFHQAAIAEVERLAADCADGPA-LAVGSPWVADGKLFNAYLILKGGKITTQVLKHHLPNA 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W   ++ + L + GAEFL   N SPY+
Sbjct: 120 TVFDEVRIFDAGPLGGPYAVGNTRIGSPICEDGWY-EDVAETLAETGAEFLLIPNGSPYF 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK+  R   +  +     LP+IY+N VGGQD+ +FDG SF  +    LA QM  F E  
Sbjct: 179 RNKMDVRFNHMVARAVETDLPVIYLNMVGGQDDQVFDGGSFVLNPGGALALQMPVFDEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     ++    W  +    AS   +P  E E DY+   LSLRDY++K  F KV++GLS
Sbjct: 238 -IQHLDLERTAEGWRAVEGPKAS---LP-DEWEQDYHVMTLSLRDYMRKTGFKKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ A IAVDALG ENV+ +MLP +YTS +SL+DA A AKALG  YD +PI +   
Sbjct: 293 GGVDSAIVATIAVDALGAENVRCVMLPSEYTSQESLDDAEAVAKALGVHYDYVPIAEGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++        G+  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITNTLAPLFAGLDEGLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN +     +GP  EVI P++++K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFETCRWRNDNHRDWMMGPEGEVIRPNVIDKPPSAELRDDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD +++ +V+ + S  +     ++ E  + VEHL+Y SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPELDALLEILVDRDGSIADCVAAGFSRENAKRVEHLIYISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 PRAFWLDRRYPIVNRWRD 550


>gi|103488420|ref|YP_617981.1| NAD synthetase [Sphingopyxis alaskensis RB2256]
 gi|98978497|gb|ABF54648.1| NH(3)-dependent NAD(+) synthetase [Sphingopyxis alaskensis RB2256]
          Length = 556

 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 252/562 (44%), Positives = 350/562 (62%), Gaps = 25/562 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L I ++Q+   VGD+A N    R  R  A  +  DLIL+ EL + GYPPEDLV K +  +
Sbjct: 8   LTIVLSQMTQAVGDLAANADAMRSVR--ARHRDADLILYPELQLIGYPPEDLVLKPALAE 65

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVL-NSVVILDAGNIIAVRDKINLPNYSEF 123
             ++ +  L +DT DGG  ++VG   +D +G L N V +LD G ++AVR K  LPNY  F
Sbjct: 66  RAATLLAELAADTADGGPAMLVGSVERDADGSLYNIVALLDGGRVVAVRRKHELPNYGTF 125

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            EKR F  G   D + +R ++LG+ ICED W    +  HL  QGAE L S+N SPY  +K
Sbjct: 126 DEKRVFAPGPLPDIVEWRGVKLGLPICEDGWL-PKVSAHLAAQGAELLISVNGSPYEIDK 184

Query: 184 LKKR-HEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
            ++R  ++   +++   LP+I++N++GGQDEL+FDG SF  +G    A ++         
Sbjct: 185 DERRLSQVFARRVAETGLPLIFLNRIGGQDELVFDGCSFVLNGDGTAAHRL--------- 235

Query: 243 TEWHYDQQLSQWN-----YMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVI 296
           T+W  ++++++W      +  D  A   +   +   AD Y+A +LSLRDYV +N F  V+
Sbjct: 236 TDWEAEERVTRWTKGAAGWACDAGAIAEW---EAHPADIYSAMILSLRDYVTRNRFPGVV 292

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSA+CAAIA DALG + V  +MLP ++TS  SL+DAA CA+ +GC+ D +PI 
Sbjct: 293 LGLSGGIDSAICAAIAADALGPDKVWCVMLPSRFTSQASLDDAAGCARMIGCRLDTIPIV 352

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
             V  F  +++    +    I  EN+QSRIRG  LMALSN    MLLTT NKSE+SVGY 
Sbjct: 353 PAVEAFDQMLAGSFADAEVDITEENVQSRIRGVTLMALSNKFGPMLLTTGNKSEMSVGYA 412

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           T+YGDM+GG+NPLKD YK  VF LA WRN H       P+  V+P +I+ K PSAELRP 
Sbjct: 413 TIYGDMAGGYNPLKDAYKMTVFALAKWRNEHVPRLSRNPVAPVMPDTIITKPPSAELRPD 472

Query: 477 QTDQESLPPYPILDDIIKRIVENEESF--INNDQEYNDETVRYVEHLLYGSEYKRRQAPV 534
           Q DQ+SLPPY  LD ++  +VE E     +     ++ + V  +E LL  +EYKRRQAP 
Sbjct: 473 QKDQDSLPPYEDLDRMLHMLVEEEAGVDDVVARHGFDRDAVARIERLLAIAEYKRRQAPP 532

Query: 535 GTKITAKSFGRDRLYPISNKFR 556
           G K++ ++FGRDR YPI++ FR
Sbjct: 533 GVKLSTRNFGRDRRYPITHGFR 554


>gi|254466900|ref|ZP_05080311.1| glutamine-dependent NAD(+) synthetase [Rhodobacterales bacterium
           Y4I]
 gi|206687808|gb|EDZ48290.1| glutamine-dependent NAD(+) synthetase [Rhodobacterales bacterium
           Y4I]
          Length = 552

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 253/558 (45%), Positives = 351/558 (62%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGD+AGN AKAR A EE  + G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MADRFRVTLAQLNPTVGDLAGNAAKARTAWEEGRKAGADLVALPEMFITGYNTQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F QA  + ++ L +D  DG A + VG P  +   + N+ +IL  G I +   K +LPN 
Sbjct: 61  VFHQAAIAEVEKLAADCADGPA-LAVGGPWVEGGRLYNAYLILKDGKIASRSLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W + ++ + L + GAEFL   N SPY+
Sbjct: 120 TVFDEVRLFEAGPLGGPYSVSNTRIGSPICEDGW-HEDVAETLAETGAEFLLIPNGSPYF 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK++ R  ++  +    HLP+IY+N VGGQD+ +FDG SF  +    LA QM  F E  
Sbjct: 179 RNKMEVRFNMMVARAVETHLPVIYLNMVGGQDDQVFDGGSFALNPGGALAVQMPLFDE-- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T+    +    W     + A   ++P  E E DY   V SLRDY+ K  F KV++GLS
Sbjct: 237 CITQVDLIRTGDGWRVEEGEKA---HLP-DEWEQDYRVMVDSLRDYMGKTGFKKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ AAIAVDALG ENV+ +MLP +YTS +SL+DA A AKALG +YD +PI +   
Sbjct: 293 GGVDSAIVAAIAVDALGAENVRCVMLPSEYTSRESLDDAEAVAKALGVRYDYVPISEARA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              S ++       + I  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITSTLAPLFAGLDADITEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++      GP  EVI P++++K PSAELR +Q D 
Sbjct: 413 DMNGGYNPIKDLYKTRVFETCRWRNANHRPWMKGPAGEVIRPNVIDKPPSAELRENQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD I++ +V+ E S  +     ++ +  + VEHLLY SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPELDAILEILVDLEGSIADCVAAGFSRDVAKRVEHLLYISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 PRAFWLDRRYPIVNRWRD 550


>gi|83953407|ref|ZP_00962129.1| NAD(+) synthase [Sulfitobacter sp. NAS-14.1]
 gi|83842375|gb|EAP81543.1| NAD(+) synthase [Sulfitobacter sp. NAS-14.1]
          Length = 552

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 243/558 (43%), Positives = 336/558 (60%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I + QLNP VGD+AGN   AR A  +    G DL+   E+F++GY  +DLV K+
Sbjct: 1   MTSRFRITLGQLNPTVGDLAGNADLAREAWAQGKEAGADLVALPEMFLAGYNAQDLVMKQ 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F     + ++ L +D  DG A + +G P  +   + N+ +IL  G I +   K NLPN 
Sbjct: 61  AFQLDVMTHLEALAADCADGPA-LAIGAPWVEGAKLYNAYLILRNGKIASRVFKHNLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F S     P    D R+G  ICED W + ++ + L + GAEFL   N SPYY
Sbjct: 120 TVFDEVRIFDSAPLGGPYAVGDTRIGSPICEDAW-HPDVAETLAETGAEFLLVPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R   +  ++    LP+IY+N VGGQD+ +FDGASF  +   +LAFQM  F  Q 
Sbjct: 179 RGKFETRLNHMVARVVETELPLIYLNMVGGQDDQVFDGASFALNPGGKLAFQMPAFDAQ- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     +Q    W  +  + A   ++P  + E DY   V  LRDY+ K  F KV++GLS
Sbjct: 238 -IAHVDLEQTPEGWRVVEGEKA---HMP-SDLEQDYRVMVQGLRDYMGKTGFKKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A IAVDALG +NV+ +MLP +YTS  SL+DA A AKALGC+YD +PI     
Sbjct: 293 GGIDSAIVATIAVDALGADNVRCVMLPSEYTSQASLDDAEAVAKALGCRYDYVPIAQGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +     +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITDTLAPLFEGTKPDLTEENIQSRLRGLLLMAVSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KD+YKT+VF    WRN +      GP  EVI P I++K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDMYKTRVFDSCRWRNENHRDWMKGPEGEVIAPRIIDKPPSAELREDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD ++  +V+++ S  +     ++ E  + VEHLLY SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPDLDAMLTILVDDDGSIADCVAAGFDREVAKKVEHLLYISEYKRFQSAPGPRLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
             +F  DR YPI N++RD
Sbjct: 533 KGAFWLDRRYPIVNRWRD 550


>gi|119383605|ref|YP_914661.1| NAD synthetase [Paracoccus denitrificans PD1222]
 gi|119373372|gb|ABL68965.1| NH(3)-dependent NAD(+) synthetase [Paracoccus denitrificans PD1222]
          Length = 556

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 248/564 (43%), Positives = 333/564 (59%), Gaps = 13/564 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    +I + QLNP VGD+ GN A AR A  +A   G +L+   E+FI+GY  +DLV K 
Sbjct: 1   MTDTFRITLGQLNPTVGDLPGNAAMAREAWAKAREAGANLLALPEMFITGYQTQDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q   + I  L  D  DG A I +G P  +++ + N+  IL+ G + A   K  LP+ 
Sbjct: 61  GFTQEAMAHIVDLARDCADGPA-IGIGGPYAEEDRLYNAYWILNGGRVAARVRKHELPHK 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F  G  + P     +R+G  ICED W    +C+ L + GAE L   N SPY+
Sbjct: 120 QLFDEWRLFNVGPISGPYSLDGLRIGSPICEDAWW-PEVCETLAETGAEILLVPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCF----DGQQQLAFQMKHF 236
            NKL  R   +  ++    LP+IY+N VGGQD+ I+DGASF      DG      Q+  F
Sbjct: 179 RNKLDLRMGHMVARVVETGLPLIYLNSVGGQDDQIYDGASFVLNPGEDGGVVKVMQLAPF 238

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E   +    + +    W      +   M     E E DY A  L LRDY++K+ F KV+
Sbjct: 239 DE--MLAHVDFTRTPQGWRA----APGRMDHQPDEWEQDYRAMTLGLRDYMRKSGFRKVV 292

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL A IA DA+G ENV+ +MLP +YTS  SL+DAA CA  LG + D + I 
Sbjct: 293 LGLSGGIDSALVATIASDAVGPENVRCVMLPSEYTSQASLDDAADCAGRLGTRLDTVHIE 352

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
              +     ++  +         ENIQSR+RG +LMALSN    +LLTT NKSE++VGY 
Sbjct: 353 GARDAVGDALAHLMAGTQPDATEENIQSRLRGVMLMALSNKFGELLLTTGNKSEVAVGYA 412

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           T+YGDM+GG+NP+KDLYKT+VFQ   WRN +     LG   EVIPP I+ K PSAELRP+
Sbjct: 413 TIYGDMAGGYNPIKDLYKTRVFQTCRWRNENHRDWMLGRAGEVIPPQIISKPPSAELRPN 472

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q DQ+SLPPY +LD I++ +VE + +  +   Q +  ETV+ VE LLYGSE+KR QA  G
Sbjct: 473 QKDQDSLPPYEVLDAILEGLVEKDLALKDLVAQGFEPETVKKVETLLYGSEWKRYQAAPG 532

Query: 536 TKITAKSFGRDRLYPISNKFRDHI 559
            +I+ K+F  DR YP+ N++RD +
Sbjct: 533 PRISTKAFWLDRRYPLVNRWRDRL 556


>gi|83944365|ref|ZP_00956820.1| NAD(+) synthase [Sulfitobacter sp. EE-36]
 gi|83844909|gb|EAP82791.1| NAD(+) synthase [Sulfitobacter sp. EE-36]
          Length = 552

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 242/558 (43%), Positives = 337/558 (60%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I + QLNP VGD+AGN   AR A  +    G DL+   E+F++GY  +DLV K+
Sbjct: 1   MTSRFRITLGQLNPTVGDLAGNADLAREAWAQGKEAGADLVALPEMFLAGYNAQDLVMKQ 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F     + ++ L +D  DG A + +G P  +   + N+ +IL  G I +   K NLPN 
Sbjct: 61  AFQLDVMTHLEALAADCADGPA-LAIGAPWVEGAKLYNAYLILRNGKIASRVFKHNLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F S     P    D R+G  ICED W + ++ + L + GAEFL   N SPYY
Sbjct: 120 TVFDEVRIFDSAPLGGPYAVGDTRIGSPICEDAW-HPDVAETLAETGAEFLLVPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R   +  ++    LP+IY+N VGGQD+ +FDGASF  +   +LAFQM  F  Q 
Sbjct: 179 RGKFETRLNHMVARVVETELPLIYLNMVGGQDDQVFDGASFALNPGGKLAFQMPAFDAQ- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     +Q    W  +  + A   ++P  + E DY   V  LRDY+ K  F KV++GLS
Sbjct: 238 -IAHVDLEQTPEGWRVVEGEKA---HMP-SDLEQDYRVMVQGLRDYMGKTGFKKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A IAVDALG +NV+ +MLP +YTS  SL+DA + AKALGC+YD +PI     
Sbjct: 293 GGIDSAIVATIAVDALGADNVRCVMLPSEYTSQASLDDAESVAKALGCRYDYVPIAQGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++         +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITNTLAPLFDGTKPDLTEENIQSRLRGLLLMAVSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KD+YKT+VF    WRN +     +GP  EVI P I++K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDMYKTRVFDSCRWRNENHRDWMMGPEGEVIAPRIIDKPPSAELREDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD ++  +V+++ S  +     ++ E  + VEHLLY SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPDLDAMLTILVDDDGSIADCVAAGFDREVAKKVEHLLYISEYKRFQSAPGPRLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
             +F  DR YPI N++RD
Sbjct: 533 KGAFWLDRRYPIVNRWRD 550


>gi|149201961|ref|ZP_01878935.1| NAD synthetase [Roseovarius sp. TM1035]
 gi|149145009|gb|EDM33038.1| NAD synthetase [Roseovarius sp. TM1035]
          Length = 555

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 245/558 (43%), Positives = 346/558 (62%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGD+AGN   AR A ++    G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MADRFRLTLAQLNPTVGDLAGNARLARDAWDKGRAAGADLVALPEMFITGYNTQDLVQKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F QA  +AI+ L  D  DG A + +G P  D   + N+  IL  G++ A   K +LPN 
Sbjct: 61  AFHQAAIAAIEALARDCADGPA-LAIGGPALDGVSLHNAYYILQGGSVRARVLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R + SG    P     +R+G  ICED W + ++ + L + GAE L   N SP+Y
Sbjct: 120 TVFDEVRLYDSGPVAGPYTVAGVRIGSPICEDAW-HEDVAETLAETGAEILLVPNGSPHY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K+  R  ++  ++    LP+IY+N VGGQD+ +FDG SF  +    LA Q+  F E  
Sbjct: 179 RDKMDLRQNMMVARVIETGLPLIYLNMVGGQDDQMFDGGSFVLNPGGALAVQLPMFQEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     ++    W  +  D A   ++P  + E DY A VLSLRDY++K+ F KV++GLS
Sbjct: 238 -VAHVDLERGPEGWRALPGDLA---HLP-DDMEQDYTAMVLSLRDYLRKSGFSKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ A IAVDA+G ENV+ +MLP +YTS +SLEDA A A+ LGC+YD +PI     
Sbjct: 293 GGVDSAIVATIAVDAVGAENVRCVMLPSEYTSAESLEDAKAVAENLGCRYDFVPIDAGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++         +  EN+QSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITATLAPLFDGRAPDLTEENLQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF++  WRN+      LGP   VIP  ++ K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFEICRWRNAQYRGWMLGPKGAVIPEQVISKPPSAELRADQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I++ +V+ + S  +     Y+    + VEHLLY SEYKR QA  GT+++
Sbjct: 473 DSLPDYPVLDGILEILVDQDGSISDCVAAGYDLADAKRVEHLLYISEYKRFQAAPGTRLS 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 KRAFWLDRRYPIVNRWRD 550


>gi|85703661|ref|ZP_01034765.1| NAD(+) synthase [Roseovarius sp. 217]
 gi|85672589|gb|EAQ27446.1| NAD(+) synthase [Roseovarius sp. 217]
          Length = 555

 Score =  452 bits (1162), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 240/562 (42%), Positives = 341/562 (60%), Gaps = 9/562 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGD+AGN   AR A +E    G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MGDRFRLTLAQLNPTVGDLAGNARMARAAWQEGRAAGADLVALPEMFITGYNTQDLVRKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +  QA  + I+ L  D  +G A + +G P  D  G+ N+  +L  G + A   K +LPN 
Sbjct: 61  ALHQAAIATIEALARDCAEGPA-LAIGGPALDGVGLFNAYYVLQGGAVRARVLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R + SG    P     +R+G  ICED W + ++ + L + GAE L   N SP+Y
Sbjct: 120 TVFDEVRLYESGPVAGPYTVAGVRIGSPICEDAW-HEDVAETLAETGAEILLVPNGSPHY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK+  R  ++  ++    LP+IY+N VGGQD+ +FDG SF  +    LA Q+  F E  
Sbjct: 179 RNKMDLRQNMMVARVIETGLPLIYLNMVGGQDDQMFDGGSFVLNPGGALAVQLPMFQEAV 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                H D +     + +       ++P  + E DY A VLSLRDY++K+   KV++GLS
Sbjct: 239 V----HVDLERGPEGWRAAPGV-LAHLP-DDLEQDYTAMVLSLRDYLRKSGLSKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ A IAVDA+G +NV+ +MLP ++TSP+SLEDA A A+ LGC+YD +PI     
Sbjct: 293 GGVDSAIVATIAVDAVGAKNVRCVMLPSEFTSPESLEDAKAVAENLGCRYDFVPIDAGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++         +  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITATLAPLFDGIEPDLTEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT++F++  WRN+      +G    VIP  +++K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRLFEICRWRNAQHRDWMMGGAGVVIPARVIDKPPSAELRADQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I+  +V+ + S  +     Y     + VEHLLY SEYKR QA  GT+++
Sbjct: 473 DSLPDYPVLDGILDILVDQDGSISDCVAAGYTLGDAKRVEHLLYISEYKRFQAAPGTRLS 532

Query: 540 AKSFGRDRLYPISNKFRDHISE 561
            ++F  DR YPI N++RD   E
Sbjct: 533 HRAFWLDRRYPIVNRWRDGSGE 554


>gi|284006754|emb|CBA72011.1| glutamine-dependent NAD( ) synthetase [Arsenophonus nasoniae]
          Length = 540

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 246/556 (44%), Positives = 345/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +  +    QG DLILF+EL ++GYPPEDL+F+ 
Sbjct: 1   MNRTLNIALAQLNWLVGDIEGNCERMLQEAKAQQLQGADLILFSELSLTGYPPEDLLFRS 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q CS  +D LK  + +    IVVG P Q  E   N++     G ++A   K  LPNY
Sbjct: 61  DFHQRCSKQLDRLKEASQN--IAIVVGHPWQQNEKCYNALSFFWQGQMVARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  + F+  +LG LICED+W +  +   +K  GA+ L  +NASPY 
Sbjct: 119 GVFDEKRYFYAGHESCVLSFKGYKLGFLICEDVWFDEPV-DRIKALGADVLIIINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R  ++       HLPI+Y+NQVGGQDELIFDG S  F+GQ ++   +  F+EQ 
Sbjct: 178 REKLHIRTRLLKSHSQRTHLPIVYLNQVGGQDELIFDGGSKVFNGQGEITHYLAQFAEQV 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              +++  + L   N ++   +ST  +        Y A V++ RDY+ KN F  VI+GLS
Sbjct: 238 IQCKFNDGEPLPVAN-LAKTLSSTAQV--------YEALVMATRDYINKNGFSGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+NVQ +M+P+KYT+  S+ DA   A  LG ++ ++ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDNVQAVMMPFKYTAEISIHDAREQATLLGIEFAIVSIEAMYD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + +S    +       EN+Q+R R  ILMA+SN S  ++LTTSNKSE +VGY +LYG
Sbjct: 349 AFMAGLSPLFADMAPDTTEENLQARCRAIILMAISNKSGRLVLTTSNKSESAVGYTSLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  LKD+ KT VF+LA +RN+         ++  IP  ++E+ P+AEL P Q DQ
Sbjct: 409 DMAGGFAVLKDVPKTLVFELAKYRNT---------ISPNIPQRVIERPPTAELAPGQLDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDE-TVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPYP+LD I++  VE ++S         DE TVR V  L+  +EYKRRQAP+G +IT
Sbjct: 460 DSLPPYPVLDAILEGYVEQDKSVSELVAAGFDEVTVRKVIKLVDINEYKRRQAPIGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
            ++F +DR YPI++ F
Sbjct: 520 IRNFNKDRRYPITSAF 535


>gi|238796754|ref|ZP_04640260.1| NAD+ synthase [Yersinia mollaretii ATCC 43969]
 gi|238719485|gb|EEQ11295.1| NAD+ synthase [Yersinia mollaretii ATCC 43969]
          Length = 540

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 238/556 (42%), Positives = 348/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNWLVGDIEGNTERMLQTLNEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++ T      ++VG P ++   + N++ +   G ++A   K  LPNY
Sbjct: 61  DFYQRCEAQLDRLQAATQH--IAVLVGHPWREAGHLYNALSLFSEGKLLARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  +  +D RLG+LICED+W +  +    K  GAE L S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHESCVVALKDYRLGLLICEDLWFDGPV-DAAKAAGAEVLLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    L  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKAFDAAGNLTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +       QL++   +   + +    PL +    Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 TLL------QLNECEVVPMMAPAAELPPLAQV---YEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPMFANTARDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   +  DET VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVADGFDETIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|83592026|ref|YP_425778.1| NAD synthetase [Rhodospirillum rubrum ATCC 11170]
 gi|83574940|gb|ABC21491.1| NH(3)-dependent NAD(+) synthetase [Rhodospirillum rubrum ATCC
           11170]
          Length = 558

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 253/558 (45%), Positives = 343/558 (61%), Gaps = 14/558 (2%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           ++L +A+ Q+NP VGD++GN+ + R AR EA R G +L+L TEL ++GYPPEDLV + SF
Sbjct: 8   ERLTLALCQINPWVGDLSGNLERLRAARAEAARLGAELVLATELALTGYPPEDLVLRDSF 67

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFP-RQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           +      + TL +DT DGG G++VG P R +  G  N+ ++LD G I  +  K +LPNY 
Sbjct: 68  MAQAREVVATLAADTADGGPGVIVGVPWRSEAGGRHNAALLLDNGAIAGMVFKHHLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F EKR F  G    P++FR  RLG++ICED+W   ++   L   GAE L   N SP+  
Sbjct: 128 VFDEKRVFDPGPKPAPLIFRGWRLGVMICEDMW-FPDVAAALVAGGAEILLVPNGSPFDL 186

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ-N 240
            K + R +    +++   LP++YVNQV GQDEL+FDGASF   G   L   +  + E  +
Sbjct: 187 EKTEARLDHARARVTESGLPLVYVNQVCGQDELVFDGASFVMGGDGALRMTVAPWREAVS 246

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
            +     D ++        D+ +    P     AD Y A VL LRDYV KN F  VI+GL
Sbjct: 247 PVVFTRKDGRV--------DTPAQPIPPPPPVAADIYQAMVLGLRDYVTKNGFPGVILGL 298

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL AA+AVDALG E V  +M+P  YTS +SLEDAAACA+ LG + D + I   +
Sbjct: 299 SGGIDSALSAAVAVDALGAERVWCVMMPSPYTSAESLEDAAACARLLGTRLDTIDIGPAM 358

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F +++        + I  EN+QSR RG  LMALSN    M+L+T NKSE+SVGY TLY
Sbjct: 359 AAFGAMLEPHFAGRAADITEENLQSRARGLTLMALSNKFGPMVLSTGNKSEMSVGYATLY 418

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GG++ LKD+YKT VF ++ WRN++     LGP   V+P  ++ K+PSAELRP Q D
Sbjct: 419 GDMCGGYSVLKDVYKTAVFAVSRWRNANHPEGALGPEGPVMPERVITKAPSAELRPDQKD 478

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQEYN--DETVRYVEHLLYGSEYKRRQAPVGTK 537
           ++SLPPY  LD ++  ++E +        E       V  V  LL  +EYKRRQAP G K
Sbjct: 479 EDSLPPYVDLDRVLHLLIEEQRGIAAATAESGLPRPLVERVWTLLQRAEYKRRQAPPGVK 538

Query: 538 ITAKSFGRDRLYPISNKF 555
           I+A +FGRDR YPI++ +
Sbjct: 539 ISALAFGRDRRYPITHAY 556


>gi|83949870|ref|ZP_00958603.1| NAD(+) synthase [Roseovarius nubinhibens ISM]
 gi|83837769|gb|EAP77065.1| NAD(+) synthase [Roseovarius nubinhibens ISM]
          Length = 552

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 243/559 (43%), Positives = 338/559 (60%), Gaps = 11/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLN  VGDI GN  KARRA +E    G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MSDRFRLTLAQLNATVGDIEGNAEKARRAWQEGRDAGADLVALPEMFITGYNTQDLVRKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q   +AID L  D  DG A + +G P  +   + N+  IL  G +     K +LPN 
Sbjct: 61  VFHQHAIAAIDQLARDCADGPA-LAIGGPWLEGAELHNAYHILQGGQVSRRVLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R + S     P     +R+G  ICED W + ++ + L++ GAE L   N SPYY
Sbjct: 120 TVFDEVRLYGSAPIGGPYAVDGLRIGSPICEDAW-HEDVTETLEETGAELLLIPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK++ R  ++  ++    LP++Y+N VG QD+ +FDG SF  +   +LA QM  F E  
Sbjct: 179 RNKMETRQNLMVSRVIETGLPLVYLNLVGAQDDQVFDGGSFVLNPGGELALQMPLFQEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE-EADYNACVLSLRDYVQKNNFHKVIIGL 299
            +         + W     D A     PL +  E DYNA VLSLRDY+ K  F KV++GL
Sbjct: 238 -IAHLDLVDTGAGWRAEKGDLA-----PLPDAWEQDYNAMVLSLRDYMGKTGFKKVLLGL 291

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSA+ A IA DA+G +NV+ +MLP +YTS  SL+DA A A+ LGC YD +PI    
Sbjct: 292 SGGIDSAIVATIAADAIGADNVRCVMLPSEYTSQASLDDAKALAENLGCSYDFVPISQSR 351

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
                 ++   +     +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+Y
Sbjct: 352 QAVTETLAPLFEGHAPDLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIY 411

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GG+NP+KDLYKT+VF+   WRN++     +GP   VIP +I+ K PSAELR  Q D
Sbjct: 412 GDMAGGYNPIKDLYKTRVFETCRWRNANHRDWMMGPAGAVIPENIITKPPSAELRDDQKD 471

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
            +SLP YP+LD I++ +V+ + S  +  +  ++ +  + VEHL+Y SEYKR Q+  GT++
Sbjct: 472 SDSLPDYPVLDAILEILVDQDGSIEDCVRAGFDRDVAKRVEHLIYISEYKRFQSAPGTRL 531

Query: 539 TAKSFGRDRLYPISNKFRD 557
           T  +F  DR YPI N++RD
Sbjct: 532 TKGAFWLDRRYPIVNRWRD 550


>gi|238897451|ref|YP_002923128.1| NAD synthetase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229465206|gb|ACQ66980.1| NAD synthetase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 538

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 240/556 (43%), Positives = 341/556 (61%), Gaps = 23/556 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN  VGDI GN        +E   Q  DL+LF+EL +SGYPPED +F+ 
Sbjct: 1   MSRSLSIALAQLNFCVGDIKGNTELILNVLQEQKNQA-DLVLFSELALSGYPPEDWLFRD 59

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F  +C + +  L+  +H+     ++G P ++++ + N++ +   G ++A   K  LPN+
Sbjct: 60  DFYHSCETQLLRLQKASHE--VSFLLGHPFREKDRLYNALSVFSEGKLLARYYKQCLPNH 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F SG +   + F+  RLG+LICED+W    +    K  GAE L S+NASPY 
Sbjct: 118 GVFDEARYFSSGKTTQILAFKGYRLGLLICEDLWHEGPV-DSAKAAGAEILLSINASPYD 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K ++R  +++       LP+IY+NQVGGQDELIFDG S   +   +   ++  FSE+ 
Sbjct: 177 QKKYQRRQNMLSQHCLRTDLPLIYLNQVGGQDELIFDGRSQVLNKTGETVLELPAFSEKT 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + EW   +           + S    P +    +Y A V++LRDYVQKN F  V++GLS
Sbjct: 237 LLCEWTETRI---------KTKSLKVNPPEPFAEEYQALVMALRDYVQKNGFQGVLMGLS 287

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK  V+  M+P +YT   S+  A   AK LG  +++L I  +  
Sbjct: 288 GGIDSALTLAIAVDALGKSKVRAYMMPSRYTPSDSVMYAQTQAKHLGVTFEILSIEPIFE 347

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F S +   L+E+   I  EN+Q+R RG +LM LSN    ++LTTSNKSE +VGY TLYG
Sbjct: 348 AFLSSLKGLLKEDLKDITKENLQARCRGMLLMGLSNQLGDLVLTTSNKSETAVGYSTLYG 407

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFN LKD+ KT VF LA +RN+         L+EVIP  ++ + PSAEL+P+Q D 
Sbjct: 408 DMAGGFNVLKDVPKTWVFSLAKYRNT---------LSEVIPKKVISRPPSAELKPNQLDT 458

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE + S ++  +E + +E VR+V  L+  +EYKRRQ+PVG +IT
Sbjct: 459 DSLPPYAILDAILEGYVERDRSVVSLIEEGFEEEVVRHVISLVDRNEYKRRQSPVGPRIT 518

Query: 540 AKSFGRDRLYPISNKF 555
           A++F +DR YPI++ F
Sbjct: 519 ARNFSKDRRYPITSGF 534


>gi|307825849|ref|ZP_07656065.1| NAD+ synthetase [Methylobacter tundripaludum SV96]
 gi|307733157|gb|EFO04018.1| NAD+ synthetase [Methylobacter tundripaludum SV96]
          Length = 536

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 240/554 (43%), Positives = 334/554 (60%), Gaps = 24/554 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSFI 63
           LKIA+AQ N +VGDIA N+    RA   A  + G D+++F EL I+GYP EDL+ +  FI
Sbjct: 3   LKIALAQTNFLVGDIAANVDNIARAAIHARDELGADMVVFPELTITGYPAEDLLLRADFI 62

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
            A ++A+  L       G  +VVGFP  D + + NS  +L  G I+A   K  LPNY  F
Sbjct: 63  TAANNALYQLADRV--AGIALVVGFPEHDGDKLYNSAAVLHQGAILACYRKRALPNYGVF 120

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F +G       F    +G+ ICED+W+   I +  K+ GAE L +LNASP+   K
Sbjct: 121 DEQRYFTAGSQPCVFEFNGTFIGLTICEDVWRQ-GIIEDNKQAGAELLLTLNASPFNSGK 179

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
           + +R  I+  Q+    +P++YVNQ+GGQDELIFDGASF  D    + F+   F EQ  + 
Sbjct: 180 IHQREAIICSQVKAAQIPLVYVNQIGGQDELIFDGASFVVDADGGIVFRAAEFKEQISVV 239

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
           E+  ++ +           +T      E  ++Y A VL ++DYV+KN F   I+GLSGGI
Sbjct: 240 EFDGNKPVK----------TTCAPSYNEVSSEYQALVLGIKDYVRKNGFQGAILGLSGGI 289

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL  A+AVDALG + V+ ++LP +YT   S EDA   A+ALG K+ ++PI   VN F 
Sbjct: 290 DSALVLALAVDALGADKVEAVLLPSRYTQDMSNEDAMLEAEALGVKHHIIPIEPAVNAFT 349

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
            +++            ENIQ+R RG +LMALSN    +LLTT NKSE+SVGY TLYGDMS
Sbjct: 350 GMLADIFAGTAKDATEENIQARCRGVVLMALSNKQGKLLLTTGNKSEMSVGYATLYGDMS 409

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF P+KD+ K  ++QLA +RNS         L+  IP  ++ + PSAEL P Q D +SL
Sbjct: 410 GGFAPIKDVPKLLIYQLAHYRNS---------LSPAIPERVITRPPSAELAPDQVDADSL 460

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           PPY +LD I++R +E ++S        +  E V     L+  +EYKRRQ+P G +ITA++
Sbjct: 461 PPYDVLDPILERYIEKDQSAAEIIAAGFRREDVARAISLVDRNEYKRRQSPPGIRITARA 520

Query: 543 FGRDRLYPISNKFR 556
           FGRDR YPI++ ++
Sbjct: 521 FGRDRRYPITSGYK 534


>gi|110678543|ref|YP_681550.1| NAD synthetase [Roseobacter denitrificans OCh 114]
 gi|109454659|gb|ABG30864.1| glutamine-dependent NAD(+) synthetase [Roseobacter denitrificans
           OCh 114]
          Length = 552

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 243/559 (43%), Positives = 333/559 (59%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I + Q+NP VGD+AGN A AR   E     G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MADRFRITLGQMNPTVGDLAGNAALAREVWEAGKTAGADLVALPEMFITGYNAQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F    +  +D L  D  DG   + +G P  +   + N+ +IL  G I++   K +LPN 
Sbjct: 61  AFQLDVARHVDRLAQDCADGPT-LAIGAPWVEGTRLYNAYLILKGGKIVSQVLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W + ++ + L + GAEFL   N SPYY
Sbjct: 120 TVFDEVRIFDAGPLGGPYSVGNSRVGSPICEDAW-HEDVAETLAETGAEFLLVPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R   +  ++    LP+IY+N VGGQD+ +FDGASF  +    LA Q+  F E  
Sbjct: 179 RGKFDTRLNHMVARVIETELPLIYLNMVGGQDDQVFDGASFGLNPGGNLAVQLPVFDEAV 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              +     Q   W  +  + A   + P    E DY   V +LRDY +K  F KV++GLS
Sbjct: 239 AHVDLERGPQ--GWRIVEGEKA---HHP-DAWEQDYRVMVQALRDYCRKTGFGKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL AAIAVDALG +NV+ +MLP +YTS +SLEDA A AKALGC YD +PI +   
Sbjct: 293 GGVDSALVAAIAVDALGAQNVRCVMLPSEYTSAESLEDAEAVAKALGCHYDYVPITEGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +   + +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AIEQTLAPLFEGRGADLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN        GP  EVI P +++K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFETCRWRNKTHRDWMKGPQGEVITPRVIDKPPSAELRADQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD +++ +V+   S  +     +D ET R +EHL+Y SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPELDRLLEILVDRNGSIEDCVAAGSDVETARKIEHLIYISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRDH 558
             +F  DR YPI N++RD 
Sbjct: 533 KGAFWLDRRYPIVNRWRDR 551


>gi|320539255|ref|ZP_08038925.1| putative NAD+ synthetase [Serratia symbiotica str. Tucson]
 gi|320030647|gb|EFW12656.1| putative NAD+ synthetase [Serratia symbiotica str. Tucson]
          Length = 540

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 239/556 (42%), Positives = 348/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +  +E    G DLI+FTEL + GYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNLLVGDIEGNTERMLQIAQEQQEAGADLIMFTELALCGYPPEDLLYRN 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C++ +  L+    D    I+VG P ++ + + N++ +   G ++    K  LPNY
Sbjct: 61  DFYQRCAAQLQRLQQAASD--VAILVGHPWREGDKLYNALSLFAEGRLLTRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G     +  +  RLG+LICED+W    +    K  GAE + S+NASPY+
Sbjct: 119 GVFDEKRYFHAGSETCVVELKGYRLGLLICEDLWFPEPM-DAAKAAGAELILSINASPYH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
           + K   R+ ++ G     HLP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 YEKPYIRNTLMVGHCQRTHLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFTEQV 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              E++      + + +   + +T    L +    Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 AQLEFN------ELDVVPMSAPATQLPQLAQV---YAALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK++VQ +M+P++YT+  S+ DA   A+ LG ++D++ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDSVQALMMPFRYTADISIADAKEEAEILGVEFDIVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +S            EN+Q+R RG ILMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFIGQLSPMFAGTERDTTEENLQARCRGVILMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN          ++ VIP  ++E+ PSAEL P Q+DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNG---------VSYVIPQRVIERPPSAELAPDQSDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   E  DE  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEGDKSVADLVAEGFDEAIVRQVIRLVDINEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|114797585|ref|YP_761267.1| glutamine-dependent NAD(+) synthetase [Hyphomonas neptunium ATCC
           15444]
 gi|114737759|gb|ABI75884.1| glutamine-dependent NAD(+) synthetase [Hyphomonas neptunium ATCC
           15444]
          Length = 555

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 258/561 (45%), Positives = 345/561 (61%), Gaps = 14/561 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L+I  AQLNPVVGDI GN+A AR A  EA  +G  L++ +E F+ GYP EDLV K 
Sbjct: 4   MSNNLRILAAQLNPVVGDIKGNLALAREAYGEARAKGAHLLVLSEHFLLGYPAEDLVLKP 63

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S ++    A+  L  +T DG A I++G P  ++  + NS   L  G I A  DK  LPNY
Sbjct: 64  SAVEQSMDAVRALAQETKDGPA-ILIGTPWSEEGRLYNSACFLGGGLIKARYDKRELPNY 122

Query: 121 SEFHEKRTFISGYSNDPIV--FRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
             F EKR +  G    P+V     +R+G+ ICEDIW    + +     GAE L   NASP
Sbjct: 123 GVFDEKRHYTPG-EGPPLVVELHGVRVGVAICEDIWLE-RVPRATHAAGAELLIVPNASP 180

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ-QLAFQMKHFS 237
           +      +R      + + + LP ++VNQ+GGQDEL+FDGASF  +G   +    +  F 
Sbjct: 181 WRRAIQAERANAFD-RWADLKLPYLFVNQMGGQDELVFDGASFATNGTHGERCGLVGQFE 239

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
               + E  +D    Q++ +    A+     L+   A+Y A +  L DYV+KN F  V++
Sbjct: 240 TGTALVE--FDPSTKQFSGLGQSCAAD----LEGWPAEYRAAMQGLGDYVRKNRFPGVVL 293

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           G+SGGIDSA+ AAIA DALG + V  +M+P KYTS  SLEDA ACA+ALGC+YD + IH 
Sbjct: 294 GMSGGIDSAITAAIAADALGPDKVWCVMMPSKYTSNDSLEDAKACAQALGCRYDTINIHP 353

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
            V    +++      + + I  ENIQSR+R   LMALSN    M++TT NKSE++VGY T
Sbjct: 354 GVEALDTMLGDVFAGKKADITEENIQSRLRAVTLMALSNKFGQMVVTTGNKSEMAVGYAT 413

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM GG+N LKD YKT+VF+L+ WRN+      L P  EVIP  I+ K PSAELR  Q
Sbjct: 414 LYGDMCGGYNALKDFYKTEVFELSKWRNAVHPKDALAPAGEVIPERIITKPPSAELREDQ 473

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGT 536
            D++SLPPY +LDDI++ +V+ EE   +     +D  TVR +EHL+Y +EYKRRQAP G 
Sbjct: 474 KDEDSLPPYEVLDDILRGLVDLEEDVDDILARGHDAATVRRIEHLVYIAEYKRRQAPPGV 533

Query: 537 KITAKSFGRDRLYPISNKFRD 557
           K+  K+FGRDR YPI+N+FRD
Sbjct: 534 KVGGKNFGRDRRYPITNRFRD 554


>gi|126730056|ref|ZP_01745868.1| NAD synthetase [Sagittula stellata E-37]
 gi|126709436|gb|EBA08490.1| NAD synthetase [Sagittula stellata E-37]
          Length = 562

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 244/559 (43%), Positives = 337/559 (60%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGD+AGN AKAR A EE   QG DL+   E+FI+GY  +DL+ K 
Sbjct: 11  MTDRFRLTMAQLNPTVGDLAGNAAKARAAWEEGRAQGADLVALPEMFITGYQAQDLIVKP 70

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+ A    I+ L     DG A + +G P  +   + NS  +L  G + AV  K  LPN+
Sbjct: 71  AFVNAAVREIEALAKACADGPA-LAIGGPCPEGAKLHNSYYVLQGGKVAAVTHKYFLPNF 129

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F       P+    +R+G+ +CED W   ++ + +++ GAE L   N SPY+
Sbjct: 130 NVFDEVRLFSRDQLQGPVSINGVRVGMPVCEDAWY-PDVVEAMEESGAEILVVPNGSPYF 188

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK + R   +  ++    LP+ Y+N VGGQD+ +FDG SF  + + +LA Q+  F E  
Sbjct: 189 RNKYETRLNKMIARVVESGLPLAYLNMVGGQDDQVFDGGSFVMNPRARLAVQLPVFEE-- 246

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
             T   + +    W         T        E DYN  VL+LRDY +K  F KV++G+S
Sbjct: 247 VTTTVDFVRGDEGWTA----EEGTFVTHPDAWEQDYNVMVLALRDYCRKTGFGKVLLGMS 302

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL A IAVDALG ENV+ +MLP +YTS  SLEDA ACA ALGC+YD +PI    +
Sbjct: 303 GGVDSALVATIAVDALGAENVRCVMLPSEYTSEHSLEDAKACANALGCRYDFVPIGKGRD 362

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +     +  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 363 AITETLAPLFEGTQPDLAEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYATIYG 422

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++      GP  EVIP  I+ K PSAELR  Q D 
Sbjct: 423 DMAGGYNPIKDLYKTRVFETCRWRNANHRGWMKGPEGEVIPERIITKPPSAELRADQKDS 482

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I+  +V+ + +  +     Y+ E    V+HLLY SEYKR Q+  G ++T
Sbjct: 483 DSLPDYPVLDAILDILVDQDGAVSDCVAAGYSREDAMRVQHLLYISEYKRFQSAPGARLT 542

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++F  DR YPI N++RD 
Sbjct: 543 NRAFWLDRRYPIVNRWRDE 561


>gi|166064263|gb|ABY79062.1| NAD(+) synthase [endosymbiont of Ridgeia piscesae]
          Length = 553

 Score =  448 bits (1152), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 237/559 (42%), Positives = 336/559 (60%), Gaps = 8/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  K ++ +AQLNP VG +A N A A  A ++    G D++  TE+FI+GY  +DLV K 
Sbjct: 1   MSDKFRLTLAQLNPTVGALADNAALALDAWQQGRAAGADMVALTEMFITGYQVQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F     + I+ L  D  DG A + +G P  D + + N+  IL+ G I A   K  LPN 
Sbjct: 61  AFTADAMAHIEQLAKDCADGPA-LGIGGPFADGDKLYNAYYILEGGKIAARVLKQKLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R +  G    P     +R+G  ICED W    +C+ L + GAE L   N SPYY
Sbjct: 120 TVFDEVRLYDVGPEQGPYQVGPLRIGSPICEDAWHAEEVCETLAETGAEILLVPNGSPYY 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +KL  R   +  ++    LP++Y+N VGGQD+ +FDGASF  +    LA QM  F    
Sbjct: 180 RDKLAVRMNHMVARVVETDLPLVYLNMVGGQDDQVFDGASFVLNRGGALALQMPAFD--T 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +    + +  + W     D A    +     E DY   VL LRDY++K  F K+++G+S
Sbjct: 238 AIAHVDFTRTDAGWQAKVGDMAPQPDV----WEQDYRTMVLGLRDYMRKTGFRKILLGMS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A IA DALG +NV+ +MLP +YTS  SL DA   A+ LGC+YD +PI +   
Sbjct: 294 GGIDSAIVATIATDALGADNVRCVMLPSEYTSEDSLNDAKEIAQNLGCRYDFVPISEGRA 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++   +   + +  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 354 AITNTLAPLFEGTKADVTEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYATIYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KD+YKT+VF+   WRN++     +GP  E+IPP +++K P+AELR  Q D 
Sbjct: 414 DMAGGYNPIKDMYKTRVFETCRWRNANKRDWMMGPSGEIIPPRVIDKPPTAELREDQRDD 473

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I+  +V++E+S      + +  + V+ VEHLLY SEYKR Q+  G ++T
Sbjct: 474 DSLPPYDVLDAILTGLVDDEKSVAELVADGFARDVVKKVEHLLYISEYKRFQSAPGPRLT 533

Query: 540 AKSFGRDRLYPISNKFRDH 558
            +SF  DR YPI N++RD 
Sbjct: 534 MRSFWLDRRYPIVNRWRDQ 552


>gi|123441385|ref|YP_001005372.1| NAD synthetase [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|122088346|emb|CAL11137.1| putative glutamine-dependent NAD [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 540

 Score =  448 bits (1152), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 236/556 (42%), Positives = 347/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRKLSIALAQLNWLVGDIEGNTERMLQTLHEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++ T      ++VG P +++  + N++ +   G ++    K  LPNY
Sbjct: 61  DFYQRCEAQLDRLQAATQQ--TAVLVGHPWREEGNLYNALSLFADGKLLGRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+    +  +  RLG+LICED+W +  +   +K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHDTCVVELKGYRLGLLICEDLWFDGPV-DAVKAAGAEIVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +       Q ++   +   + +    PL +    Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 TLL------QFNECEVVPMMAPAAELPPLAQV---YEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +S            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLSPMFAGTARDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   E  DET VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVAEGFDETIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|238795120|ref|ZP_04638711.1| NAD+ synthase [Yersinia intermedia ATCC 29909]
 gi|238725568|gb|EEQ17131.1| NAD+ synthase [Yersinia intermedia ATCC 29909]
          Length = 540

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 236/556 (42%), Positives = 347/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +   E  + G  L++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNWLVGDIEGNTERMLQTLNEQQKAGASLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++ T      ++VG P +++  + N++ +   G ++    K  LPNY
Sbjct: 61  DFYQRCEAQLDRLQAATQQ--TAVLVGHPWREEGNLYNALSLFAEGKLLGRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  +     RLG+LICED+W +  +    K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHESCVVELNGYRLGLLICEDLWFDGPV-DAAKAAGAEVILSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++ G      LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAGHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            M       QL++ N +   + +    PL +    Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 TML------QLNECNVVPMTAPAAELPPLAQV---YEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F S ++            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMSQLAPMFAGTGRDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   +  DE  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVADGFDEAIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|331004931|ref|ZP_08328344.1| NAD synthetase [gamma proteobacterium IMCC1989]
 gi|330421255|gb|EGG95508.1| NAD synthetase [gamma proteobacterium IMCC1989]
          Length = 547

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 242/556 (43%), Positives = 350/556 (62%), Gaps = 19/556 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSFI 63
           + + +AQ+NP+VGDI GN+AK   +   + +Q   DL++F EL + GYPPEDL+ + S  
Sbjct: 4   VNVVMAQINPLVGDIEGNVAKVIESTITSQQQHNADLVVFPELTLCGYPPEDLLLRSSMD 63

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
              + A+  L S +    A IVVG+P+++     N V +L  G  IA   K +LPNY  F
Sbjct: 64  VRIADALLLLASQSFT--ATIVVGYPKREGGAHYNMVGVLQQGQWIAEYAKQHLPNYQVF 121

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            EKR F +G +     F  I   + ICEDIW +  + +  K  GA  L ++NASP++ +K
Sbjct: 122 DEKRYFEAGKAATVFDFHGIPTALSICEDIWHDEPLLQA-KAAGANLLININASPFHQSK 180

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
            ++R ++++ +     + I+YVNQVGGQDEL+FDG SF  +   Q   Q   + E  F+ 
Sbjct: 181 QQERVDLLSHRAKQGDMAIVYVNQVGGQDELVFDGGSFVVNADGQCPVQAPLYEEGLFLA 240

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
           +      +S+ ++M  +S  ++  P+ +    Y A VL LRDYV KN F KV++GLSGGI
Sbjct: 241 QCACVPNMSEVSFM--ESVDSVAPPMCDLSVIYQALVLGLRDYVNKNCFQKVVLGLSGGI 298

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL  AIAVDALG + V  IM+P+ YTS  S EDAA  AK LG +YD + I  + + F 
Sbjct: 299 DSALTLAIAVDALGADKVTAIMMPFLYTSELSKEDAAEQAKRLGVQYDSIAIEGVYSAFM 358

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S + Q     P+ +  +N+Q+R RG +LMA+SN +  ++LTT NKSE++VGY TLYGDM+
Sbjct: 359 SSLEQQFSGLPTDLAEQNLQARCRGVLLMAISNKTGCLVLTTGNKSELAVGYSTLYGDMA 418

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+ KT VF+LA +RNS G         EVIP S++E+ PSAEL P Q D+++L
Sbjct: 419 GGFDALKDVPKTMVFELAKYRNSMG--------DEVIPLSVIERPPSAELAPDQKDEDNL 470

Query: 484 PPYPILDDIIKRIVENEES---FINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           PPY +LD I++R +E+++S    +N    ++ ETV  V  L+  +EYKRRQ+PVG +I+ 
Sbjct: 471 PPYEVLDQILERYIEHDQSADAIVNAG--FDKETVYRVIRLVDINEYKRRQSPVGVRISK 528

Query: 541 KSFGRDRLYPISNKFR 556
           K FGRDR YPI+N ++
Sbjct: 529 KGFGRDRRYPITNGWK 544


>gi|114770388|ref|ZP_01447926.1| NAD(+) synthase [alpha proteobacterium HTCC2255]
 gi|114549225|gb|EAU52108.1| NAD(+) synthase [alpha proteobacterium HTCC2255]
          Length = 552

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 254/559 (45%), Positives = 343/559 (61%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M K+ K+ +AQLN  VGD  GN+ KAR A   A ++G D++ F E+F++GY  +DLV K 
Sbjct: 1   MTKEFKLTMAQLNASVGDFDGNLNKARDAYSIACKEGADMLAFPEMFLTGYQTQDLVQKS 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++   S +     +  DG   I +G P QD + V N+  IL  G II    K +LPNY
Sbjct: 61  AFVEDAQSKLIEFAKECSDGPT-IGIGVPLQDGDKVYNAYAILQNGKIITQIRKHHLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F SG  + P V   +R+G  ICED W   ++C+ L++ GAE L S N SPYY
Sbjct: 120 KVFDEKRVFDSGEIHGPYVVNGVRIGSPICEDAWF-PDVCETLEETGAEILISPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  KR  ++  +    +LP+ Y+N VGGQD+ +FDG SF  +    LA QM  F E+N
Sbjct: 179 RGKFDKRISLMVSRAVENNLPMAYLNLVGGQDDQVFDGGSFVINSDGALALQMPLF-EEN 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
             T   + +   +W       AS    P   E+ DY+  VL+LRDY++K  F K ++G+S
Sbjct: 238 IET-ITFKRTQDRWVAQEGKKAS---YPDHWEQ-DYHVMVLALRDYMKKTGFKKALLGMS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL AAIA DALG ENV+ +MLP KYTS  SL+DAA CA  L  K   +PI D  N
Sbjct: 293 GGIDSALVAAIACDALGSENVRLVMLPSKYTSQNSLDDAANCANLLKAKIQTIPISDSFN 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                +    +        ENIQSR+RG +LM LSN    MLLTT NKSE+SVGY T+YG
Sbjct: 353 SVLKTLEPIFEGLDEDTTEENIQSRLRGLLLMGLSNKFNEMLLTTGNKSEVSVGYSTIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNP+KDLYK +VF+ + WRN++  +   G   EVIP  I++K P+AELR  Q D 
Sbjct: 413 DMAGGFNPIKDLYKVRVFETSRWRNNNYFSWMKGSRGEVIPNEIIQKPPTAELRNDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y ILD I++ +++N+ S  +     Y    V++VE LLY SEYKR Q+  GT+++
Sbjct: 473 DSLPDYEILDGILEMLMDNDASVADCVVAGYELSDVKHVEKLLYLSEYKRFQSAPGTRLS 532

Query: 540 AKSFGRDRLYPISNKFRDH 558
            K+F  DR YPI+NK+RD+
Sbjct: 533 LKAFWLDRRYPIANKWRDN 551


>gi|270264765|ref|ZP_06193030.1| hypothetical protein SOD_i01820 [Serratia odorifera 4Rx13]
 gi|270041448|gb|EFA14547.1| hypothetical protein SOD_i01820 [Serratia odorifera 4Rx13]
          Length = 540

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 237/556 (42%), Positives = 343/556 (61%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +  +E  + G DL++FTEL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNLLVGDIEGNTERMLQTVQEQQKAGADLVMFTELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +  L+  + D    I+VG P ++ + + N++ +   G ++A   K  LPNY
Sbjct: 61  DFYQRCDAQLHRLQQASTD--VAILVGHPWREGDKLYNALSLFSEGQLLARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G     +  +  RLG+LICED+W    +    K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFHAGNETCVVNLKGYRLGLLICEDLWFPEPV-DAAKAAGAEMILSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++ G     HLP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAGHCQRTHLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQ- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                     L ++N +     +     L +    Y A VL++RDYV KN F   ++GLS
Sbjct: 237 --------VTLLRFNELDVVPMTAPAAELPQLAQVYEALVLAVRDYVTKNGFKGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++D++ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGVEFDIVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLTPMFAGTERDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVIDRPPSAELAPDQVDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   E  DE  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVERDKSVADLVAEGFDEAIVRKVIRLVDINEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|153947276|ref|YP_001400135.1| NAD synthetase [Yersinia pseudotuberculosis IP 31758]
 gi|170023507|ref|YP_001720012.1| NAD synthetase [Yersinia pseudotuberculosis YPIII]
 gi|152958771|gb|ABS46232.1| NAD+ synthetase family protein [Yersinia pseudotuberculosis IP
           31758]
 gi|169750041|gb|ACA67559.1| NAD+ synthetase [Yersinia pseudotuberculosis YPIII]
          Length = 540

 Score =  446 bits (1147), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 237/556 (42%), Positives = 346/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNWLVGDIEGNTERMLQTLNEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C   ++ L++ T      ++VG P ++ + + N++ +   G ++    K  LPNY
Sbjct: 61  DFYQRCEVQLERLQAATPH--IAVLVGHPWREGDKLYNALSLFAQGKLLGRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  +  +  RLG+LICED+W +  I   +K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHQSCVVELKGYRLGLLICEDLWLDGPI-DAVKAAGAEVVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQVGGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQVGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +       QL++ N +   +      PL +    Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 TLL------QLNECNVIPMTAPVAELPPLAQV---YEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG K+DV+ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGVKFDVMSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++    +       EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPMFADTGRDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLAEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S      +  DE  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVAELVADGFDEAIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A+SFG+DR YPI++ F
Sbjct: 520 ARSFGKDRRYPITSGF 535


>gi|238759702|ref|ZP_04620862.1| NAD+ synthase [Yersinia aldovae ATCC 35236]
 gi|238702130|gb|EEP94687.1| NAD+ synthase [Yersinia aldovae ATCC 35236]
          Length = 540

 Score =  446 bits (1146), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 235/556 (42%), Positives = 350/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRKLSIALAQLNWLVGDIEGNTERMLQTLHEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++ T      ++VG P ++   + N++ +   G ++    K  LPNY
Sbjct: 61  DFYQRCKTQLDRLQAATQH--TAVLVGHPWREAGKLYNALSLFAEGKLLGRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G  +  +  +  RLG+LICED+W +  +   +K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGDKSCVVELKGYRLGLLICEDLWFDGPV-DAVKAAGAEIVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + +++  + +         +A    +P   +   Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 TLLQFNGCEVVPM-------TAPVAELPPLAQV--YEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F S +S            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMSQLSPMFAGTARDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD+I++  VE+++S  +   +  DET VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDEILEGYVEHDKSVTDLVADGFDETIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|22125216|ref|NP_668639.1| NAD synthetase [Yersinia pestis KIM 10]
 gi|45442325|ref|NP_993864.1| NAD synthetase [Yersinia pestis biovar Microtus str. 91001]
 gi|51597189|ref|YP_071380.1| NAD synthetase [Yersinia pseudotuberculosis IP 32953]
 gi|108808346|ref|YP_652262.1| NAD synthetase [Yersinia pestis Antiqua]
 gi|108811388|ref|YP_647155.1| NAD synthetase [Yersinia pestis Nepal516]
 gi|145599529|ref|YP_001163605.1| NAD synthetase [Yersinia pestis Pestoides F]
 gi|149365369|ref|ZP_01887404.1| putative glutamine-dependent NAD [Yersinia pestis CA88-4125]
 gi|162418452|ref|YP_001607954.1| NAD synthetase [Yersinia pestis Angola]
 gi|165928256|ref|ZP_02224088.1| NAD+ synthetase family protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165939227|ref|ZP_02227777.1| NAD+ synthetase family protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166008048|ref|ZP_02228946.1| NAD+ synthetase family protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212501|ref|ZP_02238536.1| NAD+ synthetase family protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167398909|ref|ZP_02304433.1| NAD+ synthetase family protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167421435|ref|ZP_02313188.1| NAD+ synthetase family protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167423380|ref|ZP_02315133.1| NAD+ synthetase family protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167469238|ref|ZP_02333942.1| NAD+ synthetase family protein [Yersinia pestis FV-1]
 gi|186896284|ref|YP_001873396.1| NAD synthetase [Yersinia pseudotuberculosis PB1/+]
 gi|218929969|ref|YP_002347844.1| NAD synthetase [Yersinia pestis CO92]
 gi|229838496|ref|ZP_04458655.1| putative glutamine-dependent NAD [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229895500|ref|ZP_04510671.1| putative glutamine-dependent NAD [Yersinia pestis Pestoides A]
 gi|229899066|ref|ZP_04514210.1| putative glutamine-dependent NAD [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229901639|ref|ZP_04516761.1| putative glutamine-dependent NAD [Yersinia pestis Nepal516]
 gi|270489830|ref|ZP_06206904.1| NAD+ synthetase [Yersinia pestis KIM D27]
 gi|294504529|ref|YP_003568591.1| NAD(+) synthase [Yersinia pestis Z176003]
 gi|21958083|gb|AAM84890.1|AE013734_5 putative NH3-dependent NAD(+) synthetase [Yersinia pestis KIM 10]
 gi|45437189|gb|AAS62741.1| putative glutamine-dependent NAD [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51590471|emb|CAH22111.1| putative glutamine-dependent NAD [Yersinia pseudotuberculosis IP
           32953]
 gi|108775036|gb|ABG17555.1| glutamine-dependent NAD [Yersinia pestis Nepal516]
 gi|108780259|gb|ABG14317.1| putative glutamine-dependent NAD [Yersinia pestis Antiqua]
 gi|115348580|emb|CAL21522.1| putative glutamine-dependent NAD [Yersinia pestis CO92]
 gi|145211225|gb|ABP40632.1| glutamine-dependent NAD [Yersinia pestis Pestoides F]
 gi|149291782|gb|EDM41856.1| putative glutamine-dependent NAD [Yersinia pestis CA88-4125]
 gi|162351267|gb|ABX85215.1| NAD+ synthetase family protein [Yersinia pestis Angola]
 gi|165912827|gb|EDR31454.1| NAD+ synthetase family protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165919763|gb|EDR37096.1| NAD+ synthetase family protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165992430|gb|EDR44731.1| NAD+ synthetase family protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206432|gb|EDR50912.1| NAD+ synthetase family protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166960924|gb|EDR56945.1| NAD+ synthetase family protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167051413|gb|EDR62821.1| NAD+ synthetase family protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057550|gb|EDR67296.1| NAD+ synthetase family protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|186699310|gb|ACC89939.1| NAD+ synthetase [Yersinia pseudotuberculosis PB1/+]
 gi|229681568|gb|EEO77662.1| putative glutamine-dependent NAD [Yersinia pestis Nepal516]
 gi|229688011|gb|EEO80083.1| putative glutamine-dependent NAD [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229694862|gb|EEO84909.1| putative glutamine-dependent NAD [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229701306|gb|EEO89334.1| putative glutamine-dependent NAD [Yersinia pestis Pestoides A]
 gi|262362479|gb|ACY59200.1| NAD(+) synthase [Yersinia pestis D106004]
 gi|262366517|gb|ACY63074.1| NAD(+) synthase [Yersinia pestis D182038]
 gi|270338334|gb|EFA49111.1| NAD+ synthetase [Yersinia pestis KIM D27]
 gi|294354988|gb|ADE65329.1| NAD(+) synthase [Yersinia pestis Z176003]
 gi|320016055|gb|ADV99626.1| putative glutamine-dependent NAD [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 540

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 236/556 (42%), Positives = 346/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNWLVGDIEGNTERMLQTLNEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C   ++ L++ T      ++VG P ++ + + N++ +   G ++    K  LPNY
Sbjct: 61  DFYQRCEVQLERLQAATPH--IAVLVGHPWREGDKLYNALSLFAQGKLLGRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  +  +  RLG+LICED+W +  I   +K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHQSCVVELKGYRLGLLICEDLWLDGPI-DAVKAAGAEVVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +       QL++ N +   +      PL +    Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 TLL------QLNECNVIPMTAPVAELPPLAQV---YEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG K+DV+ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGVKFDVMSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++    +       EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPMFADTGRDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLAEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S      +  DE  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVAELVADGFDEAIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A+SFG+DR YPI++ F
Sbjct: 520 ARSFGKDRRYPITSGF 535


>gi|238750370|ref|ZP_04611871.1| NAD+ synthase [Yersinia rohdei ATCC 43380]
 gi|238711301|gb|EEQ03518.1| NAD+ synthase [Yersinia rohdei ATCC 43380]
          Length = 540

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 236/556 (42%), Positives = 346/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRKLSIALAQLNWLVGDIEGNTERMLQTLHEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++ +      ++VG P +++  + N++ +   G + A   K  LPNY
Sbjct: 61  DFYQRCEAQLDRLQAASM--ATAVLVGHPWREEGNLYNALSLFANGKLQARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+    +  +  RLG+LICED+W +  +   +K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHDTCVVELKGYRLGLLICEDLWFDGPV-DAVKAAGAEVVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGTMTHRLAAFVEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            M       QL++   +   + +    PL +    Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 TML------QLNECEVVPMAAPAAELPPLAQV---YEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +S            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLSPMFAGTARDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   +  DE  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVADGFDEAIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|238788204|ref|ZP_04631999.1| NAD+ synthase [Yersinia frederiksenii ATCC 33641]
 gi|238723791|gb|EEQ15436.1| NAD+ synthase [Yersinia frederiksenii ATCC 33641]
          Length = 540

 Score =  445 bits (1144), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 236/556 (42%), Positives = 346/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRKLSIALAQLNWLVGDIEGNTERMLQTLHEQQKAGADLVMFSELALSGYPPEDLLYRN 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++        ++VG P +++  + N++ +   G + A   K  LPNY
Sbjct: 61  DFYQRCEAQLDRLQAAAQQ--TAVLVGHPWREEGNLYNALSLFADGKLQARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+    +  +  RLG+LICED+W +  I   +K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHDTCVVELKGYRLGLLICEDLWFDGPI-DAVKAAGAEVVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYVRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +       Q ++   +   + +    PL +    Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 TLL------QFNECEVVPMMAPAAELPPLAQV---YEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +S            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLSPMFAGTARDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   +  DET VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILQGYVEQDKSVADLVADGFDETIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|332162672|ref|YP_004299249.1| NAD synthetase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318606778|emb|CBY28276.1| nad synthetase; Glutamine amidotransferase chain of NAD synthetase
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325666902|gb|ADZ43546.1| NAD synthetase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 540

 Score =  445 bits (1144), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 235/556 (42%), Positives = 346/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRKLSIALAQLNWLVGDIEGNTERMLQTLHEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++ T      ++VG P +++  + N++ +   G ++    K  LPNY
Sbjct: 61  DFYQRCEAQLDRLQAATQQ--TAVLVGHPWREEGNLYNALSLFADGKLLGRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+    +  +  RLG+LICED+W +  +   +K   AE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHDTCVVELKGYRLGLLICEDLWFDGPV-DAVKAARAEIVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +       Q ++   +   + +    PL +    Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 TLL------QFNECEVVPMMAPAAELPPLAQV---YEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +S            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLSPMFAGTARDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   E  DET VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVAEGFDETIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|254511880|ref|ZP_05123947.1| glutamine-dependent NAD(+) synthetase [Rhodobacteraceae bacterium
           KLH11]
 gi|221535591|gb|EEE38579.1| glutamine-dependent NAD(+) synthetase [Rhodobacteraceae bacterium
           KLH11]
          Length = 552

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 245/560 (43%), Positives = 343/560 (61%), Gaps = 11/560 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    +I +AQLNP+VGDI GN AKA+ A ++      DL+   E+FI+GY  +DLV K 
Sbjct: 1   MADGFRITLAQLNPIVGDIEGNAAKAKAAWQQGRTAQADLVALPEMFITGYNTQDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F  A   A+  L  D  DG A + +G P  +   + N+ +IL  G I++   K +LPN 
Sbjct: 61  AFHHAAMDAVQALARDCADGPA-LAIGGPWFEDGKLYNAYLILKGGRIVSKALKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R + +G    P    +IR+G  ICED W + ++ + L++ GAEFL   N SPY+
Sbjct: 120 TVFDEVRLYDAGPMGGPYAVGNIRIGSPICEDGW-HEDVAETLEETGAEFLLIPNGSPYF 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K   R   +  +     LP+IY+N VGGQD+ +FDGA+F  +   +LAF+M  F E  
Sbjct: 179 RDKYDIRLNHMVARTVETGLPVIYLNMVGGQDDQVFDGATFGLNPGGELAFRMPVFDEAV 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE-EADYNACVLSLRDYVQKNNFHKVIIGL 299
              +   ++    W     +      +P  +  E DY A V SLRDY+ K  F KV++GL
Sbjct: 239 CTID--LERGDDGWRITPAE-----VVPQPDTWEQDYRAMVQSLRDYMGKTGFGKVVLGL 291

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGG+DSAL AAIAVDA+G  NV+ +MLP +YTS  SL+DA A AKALG  YD +PI +  
Sbjct: 292 SGGVDSALVAAIAVDAIGAGNVRCVMLPSEYTSQSSLDDAEAVAKALGVHYDFVPISEGR 351

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
               + ++     +   +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+Y
Sbjct: 352 AAVTNTLAPLFAGQDEDLTEENIQSRLRGLLLMAISNKFGEMLLTTGNKSEVAVGYATIY 411

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVI PS+++K PSAELR  Q D
Sbjct: 412 GDMNGGYNPIKDLYKTRVFETCRWRNANHRDWMMGPAGEVIRPSVIDKPPSAELREDQKD 471

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKI 538
            +SLP YP+LD I+  +V+ + S  +      DE   R VEHL+Y SEYKR Q+  GT++
Sbjct: 472 SDSLPDYPVLDAILDILVDQDGSIADCVAAGFDEVEARRVEHLIYISEYKRFQSAPGTRL 531

Query: 539 TAKSFGRDRLYPISNKFRDH 558
           T ++F  DR YPI N++RD 
Sbjct: 532 TPRAFWLDRRYPIVNRWRDR 551


>gi|238753908|ref|ZP_04615268.1| NAD+ synthase [Yersinia ruckeri ATCC 29473]
 gi|238707896|gb|EEQ00254.1| NAD+ synthase [Yersinia ruckeri ATCC 29473]
          Length = 549

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 237/556 (42%), Positives = 342/556 (61%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 10  MSRSLSIALAQLNLLVGDIEGNTERMLQTLHEQQKAGADLVMFSELSLSGYPPEDLLYRS 69

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F   C + ++ L++ +      ++VG P ++ + + N++ +  AG ++    K  LPNY
Sbjct: 70  DFYLRCEAQLERLRAASQT--VAVLVGHPWREGDKLYNALSLFSAGKLLGRYFKQQLPNY 127

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G  +  +  +  RLG+LICED+W +  +    K  GAE L S+NASPY 
Sbjct: 128 GVFDEKRYFTPGDKSCVVELKGYRLGLLICEDLWFSEPV-DAAKAAGAELLLSINASPYN 186

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        +P++Y+NQVGGQDELIFDG S  FD +  +  ++  F+EQ 
Sbjct: 187 REKPYIRKTLMASHCQRTQMPLVYLNQVGGQDELIFDGCSKVFDSKGNMTHRLAAFAEQT 246

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +       QL         + +    PL E    Y A VL++RDYV KN F   ++GLS
Sbjct: 247 TLC------QLQDLVVEPMAAPAADLSPLAEV---YEALVLAVRDYVTKNGFKGAVLGLS 297

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGKE VQ +M+P++YT+  S+ DA   A+ LG ++D+L I  + +
Sbjct: 298 GGIDSALTLAIAVDALGKEKVQALMMPFRYTADISIADAKEEAEILGIEFDLLSIEPMFD 357

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 358 AFMGQLAPMFAGTEKDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 417

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VFQL  +RN+         ++ VIP  ++++ PSAEL P Q DQ
Sbjct: 418 DMAGGFDVLKDVPKTLVFQLCEYRNT---------VSYVIPQRVIDRPPSAELAPDQLDQ 468

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE++ES  +      DE+ VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 469 DSLPPYDILDAILEGYVEHDESVADLVANGFDESIVRKVIRLVDINEYKRRQSAVGPRIT 528

Query: 540 AKSFGRDRLYPISNKF 555
           A+SFG+DR YPI++ F
Sbjct: 529 ARSFGKDRRYPITSGF 544


>gi|288940531|ref|YP_003442771.1| NAD+ synthetase [Allochromatium vinosum DSM 180]
 gi|288895903|gb|ADC61739.1| NAD+ synthetase [Allochromatium vinosum DSM 180]
          Length = 536

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 237/559 (42%), Positives = 334/559 (59%), Gaps = 35/559 (6%)

Query: 6   KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQA 65
           +I I Q+NP+VGD+AGN  +   A   A+  G+DL++  EL ++GYPPEDL+ +  FI  
Sbjct: 4   RIEILQMNPLVGDVAGNAERLIAAARRAHASGIDLLVCPELALTGYPPEDLLLRPEFIAR 63

Query: 66  CSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHE 125
             +A++ L+S+    G  +V G+PR    G+ N   ++  G +IA   K +LPNYS F E
Sbjct: 64  VETALERLQSEIR--GITLVFGYPRASVGGLFNVAGVIRDGTLIAEYAKQHLPNYSVFDE 121

Query: 126 KRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLK 185
           KR F  G          +R G+ +CEDIW      +   + GA+ L +LNASP++  K+ 
Sbjct: 122 KRYFQPGTGATVFEQCGLRFGLSVCEDIWWEEP-TREAAEAGAQVLLNLNASPFHGGKIA 180

Query: 186 KRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEW 245
           +R  +V  +     L I+Y N VGGQDEL+FDGASF  D   ++  +   F+E     + 
Sbjct: 181 EREALVARRARAHGLTILYANLVGGQDELVFDGASFVVDPDGRITHRAGLFTETTLALKL 240

Query: 246 HYD--------QQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
             D        + L+ W                EEE  Y A VL +RDYV+KN F   ++
Sbjct: 241 DADGVPVRAGTEPLTDWP--------------GEEETIYEALVLGVRDYVRKNGFEGAVL 286

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSAL  AIAVDALG + V+ +++P +YT+  S EDA   A+ LG    V+PI  
Sbjct: 287 GLSGGIDSALTLAIAVDALGADRVEAVLMPSRYTADMSNEDALEQARRLGVSTRVIPIEP 346

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
             + F  ++      +P  +  ENIQ+R RG ILMA+SN S  +LLTT NKSE++VGY T
Sbjct: 347 AFHAFLDMLEPVFAGQPVDVTEENIQARCRGIILMAISNKSGRILLTTGNKSEMAVGYAT 406

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGF P+KD+ K  V++LA +RN           + VIP  ++E++PSAELRP Q
Sbjct: 407 LYGDMAGGFAPIKDVPKMLVYRLARYRNGR---------SPVIPERVIERAPSAELRPDQ 457

Query: 478 TDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           TDQ+SLPPY +LD I+KR +E++ES  +   Q Y  + VR V  L+  +EYKRRQAP G 
Sbjct: 458 TDQDSLPPYDLLDAILKRYIEDDESVEDIVAQGYPADVVRRVARLVDRNEYKRRQAPPGV 517

Query: 537 KITAKSFGRDRLYPISNKF 555
           +I+ ++FGRDR YPI++ F
Sbjct: 518 RISRRAFGRDRRYPITSGF 536


>gi|157371885|ref|YP_001479874.1| NAD synthetase [Serratia proteamaculans 568]
 gi|157323649|gb|ABV42746.1| NAD+ synthetase [Serratia proteamaculans 568]
          Length = 540

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 236/556 (42%), Positives = 346/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +  +E  + G DL++FTEL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNLLVGDIEGNTERMLQTVQEQQKAGADLVMFTELALSGYPPEDLLYRN 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +  L+  + +    I+VG P ++ + + N++ +   G ++A   K  LPNY
Sbjct: 61  DFYQRCDAQLQRLQQASAE--VAILVGHPWREGDKLYNALSLFSEGQLLARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G     +  +  +LG+LICED+W    +    K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFQAGSETCVVELKGYQLGLLICEDLWFPGPV-DAAKAAGAEMILSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++ G     HLP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAGHCQRTHLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLTAFAEQV 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + E +  + +     M+  +A      L +    Y A VL++RDYV KN F   ++GLS
Sbjct: 238 TLLELNELEVVP----MTAPAAE-----LPQLAQVYEALVLAVRDYVTKNGFKGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++D++ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDIVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLTPMFAGTERDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVIDRPPSAELAPDQLDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   E  DE  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVERDKSVADLVAEGFDEAIVRKVIRLVDINEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|238784206|ref|ZP_04628219.1| NAD+ synthase [Yersinia bercovieri ATCC 43970]
 gi|238714915|gb|EEQ06914.1| NAD+ synthase [Yersinia bercovieri ATCC 43970]
          Length = 540

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 235/556 (42%), Positives = 347/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L +A+AQLN +VGDI GN  +  +   E  + G  L++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSVALAQLNWLVGDIEGNTERMLQTLNEQQKAGASLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++ T      ++VG P ++   + N++ +   G ++A   K  LPNY
Sbjct: 61  DFYQRCEAQLDRLQAATQH--IAVLVGHPWREAGNLYNALSLFSEGKLLARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  +  +  RLG+LICED+W +  +    K  GAE L S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHDSCVVELKGYRLGLLICEDLWFDGPV-DAAKAAGAEVLLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    L  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNLTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +       QL++   +   + +    PL +    Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 TLL------QLNECEVVPMMAPAAELPPLAQV---YEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPMFAGTARDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+++RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSAYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   +  DET VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVADGFDETIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|238762815|ref|ZP_04623784.1| NAD+ synthase [Yersinia kristensenii ATCC 33638]
 gi|238699120|gb|EEP91868.1| NAD+ synthase [Yersinia kristensenii ATCC 33638]
          Length = 540

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 234/556 (42%), Positives = 347/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNWLVGDIEGNTERMLQTLHEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + ++ L++ T      ++VG P ++Q  + N++ +   G +     K  LPNY
Sbjct: 61  DFYQRCEAQLNRLQAATQQ--TAVLVGHPWREQGELYNALSLFADGKLQGRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  +  +  RLG+LICED+W +  +   +K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHQSCVVELKGYRLGLLICEDLWFDGPV-DAVKAAGAEIVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +       Q ++ + +   + +    PL +    Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 TLL------QFNECDVVPMTAPAAELPPLAQV---YEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +S            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLSPMFAGSKRDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   +  DET VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVADGFDETIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|304319845|ref|YP_003853488.1| NAD(+) synthase [Parvularcula bermudensis HTCC2503]
 gi|303298748|gb|ADM08347.1| NAD(+) synthase [Parvularcula bermudensis HTCC2503]
          Length = 555

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 245/557 (43%), Positives = 336/557 (60%), Gaps = 15/557 (2%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           +L IA+A LNP VGD+AGNI + + A +EA     DL++ +EL +SGYPPEDLV    + 
Sbjct: 5   RLSIALAVLNPTVGDVAGNIERIKAAHKEAT--DCDLVVCSELCVSGYPPEDLVLHAPYA 62

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFP---RQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             C  A+D L   T DG A +VVG P      Q    N+ V+L  G +  V  K  LP Y
Sbjct: 63  IRCREAVDALAQVTADGPA-LVVGTPWPAEGRQRKPYNASVLLADGKVQTVAYKRYLPEY 121

Query: 121 SEFHEKRTFISGYS-NDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
             F E RTF +  +  D  +   +RLG++ CED+W  +     L ++GAE   + + SP+
Sbjct: 122 GVFDEPRTFSASTAIPDLGIVAGVRLGLMTCEDMWYPTP-AADLAERGAEIFVAPHGSPF 180

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
                 +R      ++     P+++ NQVGGQDEL+FDG +F  D + +  ++   F+  
Sbjct: 181 RLTAHAERLFHAKARVRETGRPLVFTNQVGGQDELVFDGGAFAVD-RDEGVYRGPLFARG 239

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
              T W  D+      ++  ++  +   P+ EE   Y A V   RDYV+K+ F  V++GL
Sbjct: 240 ITRTVWRRDEA----GHLRFETGPSEDWPV-EEPLIYPALVTGTRDYVRKSGFSSVVLGL 294

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSA+ AAIAVDALG +NV+ +MLP +YTS +SL+DAAACAKALG   D + I  ++
Sbjct: 295 SGGIDSAMVAAIAVDALGPDNVRCVMLPSRYTSTESLDDAAACAKALGVTLDRVEIEPMI 354

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F   ++       + +  EN+QSRIRG  LMALSN    +LL+T NKSE++ GY TLY
Sbjct: 355 AVFTDSLAPLFAGRSADVTEENLQSRIRGTALMALSNKFGCLLLSTGNKSEMATGYATLY 414

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+G +NPLKD+YK+ VF+LA WRN++  + GLGP  EVIP  I+ K PSAELR  Q D
Sbjct: 415 GDMNGAYNPLKDVYKSVVFRLARWRNANHPSGGLGPRGEVIPERIITKPPSAELRADQRD 474

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKI 538
            +SLP Y ILDDI+  +VE + S        +D   V  V  LL  SEYKRRQAP G KI
Sbjct: 475 DQSLPAYDILDDILSGLVEEDLSPKAVAARGHDPALVTKVRRLLLLSEYKRRQAPPGPKI 534

Query: 539 TAKSFGRDRLYPISNKF 555
           T ++FGRDR YP+ N++
Sbjct: 535 TVRNFGRDRRYPLLNRW 551


>gi|126737475|ref|ZP_01753210.1| NAD synthetase [Roseobacter sp. SK209-2-6]
 gi|126722060|gb|EBA18763.1| NAD synthetase [Roseobacter sp. SK209-2-6]
          Length = 552

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 244/559 (43%), Positives = 349/559 (62%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I++AQLNP VGD+ GN AKAR+A  E  +   DL+   E+F++GY  +DLV K 
Sbjct: 1   MADRFRISLAQLNPTVGDLDGNAAKARQAWTEGRKAKADLVALPEMFLTGYNAQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F  A  +  + L  D  DG A + +G P  +   + N+ +IL  G I +   K +LPN 
Sbjct: 61  VFHLAAMAKAEELAKDCADGPA-LAIGCPWVEDGKLYNAYLILKDGKIASRCLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W + ++ + L++ GAEFL   N SPY+
Sbjct: 120 TVFDEVRIFDAGPLGGPYAVGNTRIGSPICEDGW-HEDVAETLEETGAEFLLIPNGSPYF 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK++ R   +  +     LP+IY+N VGGQD+ +FDG SF  +    LA QM  F E  
Sbjct: 179 RNKMEVRQNHMVARAVETGLPVIYLNMVGGQDDQVFDGGSFVLNPNGALALQMPVFDE-- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            MT+   ++    W  +  + A   ++P  E E DY   V +LRDY++K+ F KV++GLS
Sbjct: 237 CMTQLDLERAPEGWRAIEGEKA---HLP-DEWEQDYRVMVEALRDYLRKSGFQKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ AAIAVDA+G ENV+ +MLP +YTS +SL+DA A A+ALG  YD +PI +   
Sbjct: 293 GGVDSAIVAAIAVDAIGAENVRCVMLPSEYTSRESLDDAEAVAEALGVHYDYVPITEGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++   +   + +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITNTLAPLFEGRDADLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN +     +GP  EVI P++++K PSAELR  Q D 
Sbjct: 413 DMNGGYNPIKDLYKTRVFETCRWRNDNHRPWMMGPAGEVIRPNVIDKPPSAELRDDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD I++ +V+ + S  +     +  ET + VEHL+Y SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPELDAILEILVDQDGSIADCVAAGFEAETAKRVEHLVYISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++F  DR YPI N+FRD 
Sbjct: 533 PRAFWLDRRYPIVNRFRDQ 551


>gi|317493146|ref|ZP_07951569.1| NAD synthase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918806|gb|EFV40142.1| NAD synthase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 540

 Score =  442 bits (1136), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 237/556 (42%), Positives = 344/556 (61%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +      E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNWLVGDIEGNTERMLNTLCEQRKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F   C + +D L+  + D    ++VG P ++ E + N++ +   G ++A   K  LPNY
Sbjct: 61  DFYLRCQAQLDRLQQASTD--IAVLVGHPWREGEHLYNALSLFSEGQLVARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  +  +  RLG+LICED+W +  +   +   GAE L S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHESCVVELKGYRLGLLICEDLWFDGPV-DAVAAAGAEVLLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++T       LP++Y+NQVGGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLLTSHCQRTGLPLVYLNQVGGQDELIFDGCSKGFDASGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +   H D Q+     M   +AS     L E    Y A VL++ DYV KN F   ++GLS
Sbjct: 238 ALFNLH-DMQVEP---MVAPAAS-----LPELAQIYEALVLAVHDYVTKNGFQGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++D++ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQAMMMPFRYTADISIADAKEEAEILGVEFDIVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  + ++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPMFAGTERDTTEENLQARCRGVVLMALSNKRRRLVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVIDRPPSAELAPDQLDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +     +++  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVAAGFDEAVVRKVIRLVDINEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|259416895|ref|ZP_05740815.1| glutamine-dependent NAD+ synthetase [Silicibacter sp. TrichCH4B]
 gi|259348334|gb|EEW60111.1| glutamine-dependent NAD+ synthetase [Silicibacter sp. TrichCH4B]
          Length = 552

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 243/558 (43%), Positives = 344/558 (61%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    +I +AQLNP VGD+AGN AKA  A +E    G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MADSFRITLAQLNPTVGDLAGNAAKALSAWQEGRESGADLVALPEMFITGYNTQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F QA  + ++ L + T +G A + +G P  +   + N+ +IL  G I +   K +LPN 
Sbjct: 61  AFHQAAIAEVEALAAATAEGPA-LAIGSPWVEDGKLFNAYLILKGGKIASKCLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W + ++ + L++ GAEFL   N SPYY
Sbjct: 120 TVFDEVRIFDAGPLGGPYSVGNTRIGSPICEDGW-HEDVAETLEETGAEFLLIPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K++ R+  +  +     LP+IY+N VGGQD+ +FDG +F  +    LA QM  F E  
Sbjct: 179 RGKMETRYNHMVARAVETGLPVIYLNMVGGQDDQVFDGGTFALNPHGALAVQMPVFDE-- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + +   ++    W     + A   ++P    E DY   VLSLRDY+ K  F K ++GLS
Sbjct: 237 CIAQLDLERTADGWRIKEGEKA---HLP-DAWEQDYRTMVLSLRDYMGKTGFKKALLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ AAIAVDALG +NV+ +MLP +YTS  SLEDA A AKALG  YD +PI +   
Sbjct: 293 GGVDSAIVAAIAVDALGAQNVRCVMLPSEYTSKDSLEDAEAVAKALGVHYDYVPISEGRE 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++       + +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITNTLAPLFAGRDADLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVI P++++K PSAELR  Q D 
Sbjct: 413 DMNGGYNPIKDLYKTRVFETCRWRNANHRDWMMGPSGEVIRPNVIDKPPSAELREDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD I+  +V+ + S  +     ++ +  + VEHLLY SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPELDAILDILVDQDGSIADCVAAGFDRDVAKRVEHLLYISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 KRAFWLDRRYPIVNRWRD 550


>gi|293394849|ref|ZP_06639139.1| NAD(+) synthase [Serratia odorifera DSM 4582]
 gi|291422600|gb|EFE95839.1| NAD(+) synthase [Serratia odorifera DSM 4582]
          Length = 540

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 236/556 (42%), Positives = 347/556 (62%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +  +E  + G DL++FTEL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNLLVGDIEGNSERMLQIVQEQQKAGADLVMFTELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C   ++ L+  +  G   I+VG P ++ + + N++ +   G + A   K  LPNY
Sbjct: 61  DFYQRCDLQLNRLQQAS--GEVAILVGHPWREGDKLYNALSLFADGELRARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G  +  +  +  RLG+LICED+W    I    K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFHAGQESCVVELKGYRLGLLICEDLWFPEPI-DAAKAAGAEIVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++ G     +LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAGHCRRTNLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQV 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + +++  + +     M+  +A      L +    Y A VL++RDYV KN F   ++GLS
Sbjct: 238 TLLQFNEREVVP----MTAPAAE-----LPQLAQIYEALVLAVRDYVNKNGFKGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGKE VQ +M+P++YT+  S+ DA   A+ LG ++DV+ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKEKVQALMMPFRYTADISIADAKEEAEILGVEFDVVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPMFAGTERDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVIDRPPSAELAPDQVDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE + S ++     +++  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVERDMSVVDLVAAGFDEAIVRKVIRLVDINEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|269138134|ref|YP_003294834.1| NAD synthase [Edwardsiella tarda EIB202]
 gi|267983794|gb|ACY83623.1| NAD synthase [Edwardsiella tarda EIB202]
 gi|304558179|gb|ADM40843.1| NAD synthetase / Glutamine amidotransferase chain of NAD synthetase
           [Edwardsiella tarda FL6-60]
          Length = 540

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 235/556 (42%), Positives = 341/556 (61%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +      +  + G D+++F+EL + GYPPEDL+++ 
Sbjct: 1   MSRTLSIALAQLNLLVGDIEGNAERMLAPLAQQQQAGADVVMFSELALCGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C   +  L+  + +    ++VG P +D E + N++ +   G ++A   K  LPNY
Sbjct: 61  DFHQRCQRQLARLQQASAE--IAVIVGHPWRDGECLYNALSVFAEGRLLARYYKQCLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G +   +  +  RLG+LICED+W ++ +   L   GAE L ++NASPY 
Sbjct: 119 GVFDEKRYFSAGDTPCTVTLKGYRLGLLICEDVWFDAPV-DALAAAGAEVLLTINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R+ ++        LP++Y+NQVGGQDEL+FDG S  FD +  L  ++  F EQ 
Sbjct: 178 REKPYIRNTLLADHCRRTGLPLLYLNQVGGQDELVFDGCSKAFDARGALTHRLAAFDEQ- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T+   D        +   S +    PL +    Y A VL++RDYV KN F   ++GLS
Sbjct: 237 -VTQVRLDD----GRLLPMASPAAELPPLAQI---YQALVLAVRDYVGKNGFQGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK  VQ +M+P++YT+  S+ DA A A A+G ++D+L I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKAQVQAVMMPFRYTADISVADAQAQALAMGVEFDILSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  + ++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPMFAGTERDTTEENLQARCRGVVLMALSNKRRRLVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VFQLA +RN+         L+  IP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFQLARYRNT---------LSPAIPQRVIDRPPSAELAPDQVDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S      + +++  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILQGYVEQDKSVAQLVADGFDEAVVRKVIRLVDINEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|99082118|ref|YP_614272.1| NAD synthetase [Ruegeria sp. TM1040]
 gi|99038398|gb|ABF65010.1| NAD+ synthetase [Ruegeria sp. TM1040]
          Length = 553

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 245/558 (43%), Positives = 342/558 (61%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    +I +AQLNP VGD+AGN AKA  A +E      DL+   E+FI+GY  +DLV K 
Sbjct: 2   MADSFRITLAQLNPTVGDLAGNAAKALSAWQEGRAADADLVALPEMFITGYNTQDLVMKP 61

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F QA  + ++ L   T +G A + +G P  +   + N+ +IL  G I +   K +LPN 
Sbjct: 62  AFHQAAIAEVEALAKATAEGPA-LAIGSPWVEDGKLYNAYLILKGGKIASKCLKHHLPNE 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W + ++ + L++ GAEFL   N SPYY
Sbjct: 121 TVFDEVRIFDAGPLGGPYSVGNTRIGSPICEDGW-HEDVAETLEETGAEFLLIPNGSPYY 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K++ R   +  +     LP+IY+N VGGQD+ +FDG SF  +    LA QM  F E  
Sbjct: 180 RGKMETRINHMVARAVETGLPVIYLNMVGGQDDQVFDGGSFALNPHGALAVQMPVFDE-- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + +   ++    W     + A   ++P    E DY   VLSLRDY+ K  F K ++GLS
Sbjct: 238 CIAQLDLERTADGWRIKEGEKA---HLP-DAWEQDYRTMVLSLRDYMGKTGFKKALLGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ AAIAVDALG ENV+ +MLP +YTS +SLEDA A AKALG  YD +PI +   
Sbjct: 294 GGVDSAIVAAIAVDALGAENVRCVMLPSEYTSKESLEDAEAVAKALGVHYDYVPISEGRE 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++       + +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 354 AITNTLAPLFAGRDADLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVI P++++K PSAELR  Q D 
Sbjct: 414 DMNGGYNPIKDLYKTRVFETCRWRNANHRDWMMGPEGEVIRPNVIDKPPSAELREDQKDS 473

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD I+  +V+ E S  +     ++ +  + VEHLLY SEYKR Q+  G ++T
Sbjct: 474 DSLPDYPELDAILDILVDQEGSIADCVAAGFDRDVAKRVEHLLYISEYKRFQSAPGARLT 533

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 534 KRAFWLDRRYPIVNRWRD 551


>gi|294635169|ref|ZP_06713677.1| NAD(+) synthase [Edwardsiella tarda ATCC 23685]
 gi|291091431|gb|EFE23992.1| NAD(+) synthase [Edwardsiella tarda ATCC 23685]
          Length = 540

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 237/559 (42%), Positives = 343/559 (61%), Gaps = 28/559 (5%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +   A  +  + G D+++F+EL + GYPPEDL+++ 
Sbjct: 1   MSRTLSIALAQLNLLVGDIEGNAERMLAAMAQQQQAGADIVMFSELALCGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C S ++ L+  +  G   ++VG P +++  + N++ +   G + A   K  LPNY
Sbjct: 61  DFHQRCQSQLERLRQAS--GSIAVIVGHPWREKGALYNALSLFADGQLQARYYKQRLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F +G +   +  +  RLG+LICED+W N  +   +   GAE L ++NASPY 
Sbjct: 119 GVFDEMRYFSAGDTPCVVTLKGYRLGLLICEDVWFNEPV-DAVAAAGAEILLTINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R+ ++        LP++Y+NQVGGQDEL+FDG S  FD Q QL  ++  F    
Sbjct: 178 REKPYMRNTLLADHCRRTGLPLLYLNQVGGQDELVFDGCSKVFDAQGQLTHRLAAF---- 233

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEA---DYNACVLSLRDYVQKNNFHKVII 297
                  D+Q++Q   + +     M  P  E  A    Y A VL++RDYV KN F   ++
Sbjct: 234 -------DEQVTQVQ-LVETRPQPMRDPASELPALAQIYRALVLAVRDYVGKNGFQGAVL 285

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSAL  AIAVDALGKE VQ +M+P++YT+  S+ DA   A+ +G ++D+L I  
Sbjct: 286 GLSGGIDSALTLAIAVDALGKERVQALMMPFRYTADISVADAQEQAQTMGVEFDILSIEP 345

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           + + F   ++            EN+Q+R RG +LMALSN  + ++LTT NKSE++VGY T
Sbjct: 346 MFDAFMGQLAPLFAGTERDTTEENLQARCRGVVLMALSNKRRRLVLTTGNKSEMAVGYAT 405

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGF+ LKD+ KT VFQLAS+RN+ G          VIP  ++++ PSAEL P Q
Sbjct: 406 LYGDMAGGFDVLKDVPKTLVFQLASYRNTLGY---------VIPQRVIDRPPSAELAPDQ 456

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGT 536
            DQ+SLPPY +LD I++  VE ++S      + +++  VR V  L+  +EYKRRQA VG 
Sbjct: 457 VDQDSLPPYDVLDAILQGYVEQDKSVAQLVADGFDEAVVRKVIRLVDINEYKRRQAAVGP 516

Query: 537 KITAKSFGRDRLYPISNKF 555
           +ITA++FG+DR YPI++ F
Sbjct: 517 RITARNFGKDRRYPITSGF 535


>gi|254490943|ref|ZP_05104125.1| NAD synthase family [Methylophaga thiooxidans DMS010]
 gi|224463852|gb|EEF80119.1| NAD synthase family [Methylophaga thiooxydans DMS010]
          Length = 546

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 235/558 (42%), Positives = 338/558 (60%), Gaps = 23/558 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKK 60
           +  + + + Q+NPVVGD+AGN+ K   +  +A  Q G DL++F EL ++GYPPEDL+ + 
Sbjct: 1   MNDVTLVMGQINPVVGDVAGNVVKIITSAHQARDQFGADLVVFPELTLTGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQD-QEGVLNSVVILDAGNIIAVRDKINLPN 119
             ++  + A+DTL+   H  G  I++G P  + ++ + N+  ++  GN +A   K  LPN
Sbjct: 61  GLLKRVNKALDTLQK--HVEGVAIIIGHPDGEVRKELYNAASMIVDGNRVATYFKHKLPN 118

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           YS F EKR F+ G     + F+ IR G+ +CEDIW     C+     GAE L +LNASPY
Sbjct: 119 YSVFDEKRYFVEGKEACVVDFKGIRFGLTLCEDIWFTEPACQA-ADAGAEILINLNASPY 177

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
              K + R   V  ++    LP++YVNQVGGQDEL+FDG SF  D + +   +   F   
Sbjct: 178 RMGKWQLREAEVKKRVLETGLPVVYVNQVGGQDELVFDGCSFALDHRGEKVARAPAFESG 237

Query: 240 NF-MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
            + +T    +  + Q +         M I   E    Y A    LRDY++KN+F  V+IG
Sbjct: 238 LYPLTVNRSENGIVQIH-------GQMAIKENEHAMIYKALTTGLRDYIEKNHFPGVVIG 290

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL  A+AVDA+G E V  +M+P +YT+  SL+DA A A  LG  Y V+ I  +
Sbjct: 291 LSGGIDSALTLALAVDAIGAEKVHAVMMPTRYTAQISLDDAKAMADGLGVHYSVMSIEPV 350

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
              F + +S      P     ENIQ+R RG ILMALSN + +M+L T NKSE++VGY TL
Sbjct: 351 FESFLTTLSDQFTGLPVDTTEENIQARCRGIILMALSNKTGSMVLATGNKSEMAVGYSTL 410

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GG++PLKD+YKT V+QL+ +RN+  +         VIP  I+ + PSAEL   Q 
Sbjct: 411 YGDMAGGYSPLKDVYKTMVYQLSHYRNTRSM---------VIPERIITRPPSAELAADQL 461

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLPPY +LD I++R + ++  F +   E Y+ E V  V  ++  +EYKRRQAP G +
Sbjct: 462 DQDSLPPYELLDKILERYIADDSCFEDLVAEGYDAEVVARVIKMVDRNEYKRRQAPPGIR 521

Query: 538 ITAKSFGRDRLYPISNKF 555
           I++++FGRDR YPI++ +
Sbjct: 522 ISSRAFGRDRRYPITSGY 539


>gi|83648563|ref|YP_436998.1| NAD synthase [Hahella chejuensis KCTC 2396]
 gi|83636606|gb|ABC32573.1| NAD synthase [Hahella chejuensis KCTC 2396]
          Length = 546

 Score =  438 bits (1127), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 237/557 (42%), Positives = 341/557 (61%), Gaps = 20/557 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEA-NRQGMDLILFTELFISGYPPEDLVFKK 60
           + +LK+A AQ++ +VGDI GN+ K   A E A  +   DL++F EL ++GYPPEDL+ + 
Sbjct: 5   MTQLKVAFAQIDCLVGDIPGNVDKVIEAAETAKTKYNADLVIFPELTLTGYPPEDLLLRA 64

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S       A++ +     D    +V+GFP ++Q  + N    +D G I A   K  LPNY
Sbjct: 65  SLQVRVEKALERILYTVKD--IALVIGFPWREQGKLFNCAAFIDGGEIKAKYRKKCLPNY 122

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G     + +R   LG+ ICED+W+   I        A+F+ ++NASPY 
Sbjct: 123 QVFDEKRYFEPGSDTVVLPWRGFNLGVSICEDVWEEEPIAATAAAG-ADFIVNINASPYD 181

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL++R  +V  +     +PI+YVN +GGQDELIFDG SF  +   ++ F    F E  
Sbjct: 182 IAKLQQRRTLVQSRAVTNSVPILYVNMIGGQDELIFDGGSFAVNRHGRVCFSAPQFEEGI 241

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           F+ E   +  +      + + A TM +    E + Y A V  +RDYV KN F  V+IGLS
Sbjct: 242 FLLE--LNDVIHGEGQETAEPAPTMAV----EASIYKALVTGVRDYVNKNRFKSVVIGLS 295

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+  A+AVDA+G + V+ +M+P++YTS  SLEDA A AKALG +Y+V+PI  + +
Sbjct: 296 GGIDSAVTLAVAVDAIGADRVRAVMMPFRYTSQMSLEDAEAEAKALGVQYEVVPIEPIYD 355

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            ENIQ+RIRG ILM +SN + A++LTT NKSE++VGY TLYG
Sbjct: 356 QFMGALNPLFAGLDRDTTEENIQARIRGVILMGISNKTGALVLTTGNKSEMAVGYATLYG 415

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG++ LKD++KT VF+LA +RN+         L+ VIP  ++ + PSAEL P Q D+
Sbjct: 416 DMAGGYDVLKDVFKTMVFRLAWYRNT---------LSPVIPERVITRPPSAELAPDQKDE 466

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD+I+   VE++ S      + ++ ETV  V  L+  +EYKRRQAP+G +IT
Sbjct: 467 DSLPPYEILDEILSLYVEHDVSADGIVAKGFDKETVYRVVRLVDINEYKRRQAPIGARIT 526

Query: 540 AKSFGRDRLYPISNKFR 556
            + FGRDR YPI++ ++
Sbjct: 527 MRGFGRDRRYPITSGWK 543


>gi|294084249|ref|YP_003551007.1| glutamine-dependent NAD(+) synthetase [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663822|gb|ADE38923.1| Glutamine-dependent NAD(+) synthetase [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 561

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 247/565 (43%), Positives = 346/565 (61%), Gaps = 27/565 (4%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           K + IA+AQLN  +G+IA N+     ARE+AN  G D+I+  E+F+SGYP +DLV +  F
Sbjct: 4   KPISIALAQLNSHLGNIAANVECLIDAREKANAGGADIIVTPEMFLSGYPCDDLVLRSDF 63

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG----VLNSVVILDAGNIIAVRDKINLP 118
           +   ++ I  L   T DGGA I+VG P ++Q+G    + NSV +LD G II  RDK+NLP
Sbjct: 64  MHEVAAGIARLTQVTADGGAAIIVGAPYREQDGDVVRIYNSVFVLDDGKIIGRRDKVNLP 123

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           NY  F +KR F +G    P++ R ++LG+ +CEDIW   ++ + L++ GA+ + SLNASP
Sbjct: 124 NYGVFDDKRNFTAGAMPGPVLVRGLKLGLPVCEDIW-TPDVVECLQESGADMIVSLNASP 182

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           +   K  +R      +     LP++YVN +GGQDEL+FDG SF  +    LA  +  FS 
Sbjct: 183 FDSRKNDQRMAHAVSRTIESSLPLLYVNLIGGQDELVFDGGSFALNADGNLATHLPSFS- 241

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMY----IPLQEEEADYNACVLSLRDYVQKNNFHK 294
                     Q + Q    SD  A ++      P ++  A Y   +L +RDYVQKN F  
Sbjct: 242 ----------QAVVQVQVKSDFGALSLTGQITPPDEDLAAIYRGLMLGVRDYVQKNGFPG 291

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
           V++GLSGGIDSAL AAIA DALG + V  +M+P  YTS +SLEDAA  A   G + D + 
Sbjct: 292 VVLGLSGGIDSALVAAIAADALGADAVHAVMMPSPYTSDESLEDAADLASRFGMRLDTIS 351

Query: 355 IHDLVNHFFSLMS-QFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISV 413
           I   +     +++ QF  ++P  I  ENIQSR+RG ILM +SN + AM++ T NKSE + 
Sbjct: 352 IGPAMAAMDEMLADQFAGKDPD-IAEENIQSRLRGTILMGISNKNGAMVMATGNKSEYAA 410

Query: 414 GYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAEL 473
           GY TLYGDM GGF P+KD++K QVF L  WRN++      GP  EVIP  I++K PSAEL
Sbjct: 411 GYSTLYGDMCGGFAPIKDVWKVQVFDLCHWRNANLPRGAAGPEGEVIPKRIIDKPPSAEL 470

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRR 530
           RP Q D +SLPPY  LD I++ + E+    ++ +   Q Y+ + V     LL+ +E+KR 
Sbjct: 471 RPDQKDTDSLPPYERLDAIMQALTEDAADIDAIVA--QGYDIKEVAQASQLLFRAEFKRF 528

Query: 531 QAPVGTKITAKSFGRDRLYPISNKF 555
           QA  G K+T+ +FGRDR  P+++ F
Sbjct: 529 QAAPGPKMTSIAFGRDRRLPLTSGF 553


>gi|296136241|ref|YP_003643483.1| NAD+ synthetase [Thiomonas intermedia K12]
 gi|295796363|gb|ADG31153.1| NAD+ synthetase [Thiomonas intermedia K12]
          Length = 560

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 243/570 (42%), Positives = 333/570 (58%), Gaps = 31/570 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L++A+ Q NP VGD+AGN A+  R   +A  QG  +++  EL ++GYPPEDL+ + +F+Q
Sbjct: 3   LQLAVIQCNPTVGDLAGNAAQIARLTRQAYAQGARVVVTPELALTGYPPEDLLLRPAFLQ 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFP------------RQDQEGVLNSVVILDAGNIIAV 111
           A ++A+  L  D  D     +VVG P               Q    N+  +L  G + A 
Sbjct: 63  ASAAALKQLAHDLSDLPELALVVGHPLGLAAAEAPRIASTQQAVACNAASLLRGGVVEAT 122

Query: 112 RDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAE 169
             K  LPNY  F E+R F  G  + P+VF       GI ICED W   +  +  +  GA+
Sbjct: 123 YCKHELPNYQVFDERRYFAPG--DQPVVFEAGGTHFGINICEDAWL-PHAPRMARAAGAQ 179

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            L  LNASPY+  K  +R  ++  +     + ++    VGGQDE++FDGASF  D   +L
Sbjct: 180 VLLVLNASPYHRGKTAERERVMRERCLENGMALVASQMVGGQDEIVFDGASFVLDHAGEL 239

Query: 230 AFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQ 288
             +   F E     +    + L Q              PL+ + A+ Y A VL +RDY+ 
Sbjct: 240 VARSPQFVEDILRVDVTGGEVLKQ--------TPAHVAPLKSDHAEVYAALVLGVRDYLG 291

Query: 289 KNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGC 348
           KN F   +IGLSGG DSAL  AIAVDALG E V+ +M+P +YT+  SL+DAA  A+ LG 
Sbjct: 292 KNGFPGALIGLSGGADSALVLAIAVDALGAEKVRAVMMPSQYTAQISLDDAAEMAQRLGV 351

Query: 349 KYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNK 408
           +YDVLPI  L   F + ++  L E P     ENIQ+RIRG +LM LSN+S  ++LTT NK
Sbjct: 352 QYDVLPITPLFETFRTTLAPLLHEHPGDTTLENIQARIRGTLLMGLSNNSGRIVLTTGNK 411

Query: 409 SEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKS 468
           SE+++GY TLYGDM+GGF  +KD+ KT V++LA WRN+H    G     EVIP  I+ ++
Sbjct: 412 SEMAMGYATLYGDMAGGFAVIKDVTKTLVWELARWRNAHAAAMG---EAEVIPQRIITRA 468

Query: 469 PSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEY 527
           PSAELR  QTDQ+SLPPY +LD I++R +E +E         Y    V  V HLL  SEY
Sbjct: 469 PSAELRADQTDQDSLPPYDVLDGILQRYMEQDERVETVLAAGYARADVERVVHLLKLSEY 528

Query: 528 KRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           KRRQAP G ++T ++FGRD  YPI++KFR+
Sbjct: 529 KRRQAPPGIRVTHRAFGRDWRYPITSKFRE 558


>gi|308048511|ref|YP_003912077.1| NAD+ synthetase [Ferrimonas balearica DSM 9799]
 gi|307630701|gb|ADN75003.1| NAD+ synthetase [Ferrimonas balearica DSM 9799]
          Length = 539

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 239/556 (42%), Positives = 334/556 (60%), Gaps = 23/556 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M K+L +A+AQLN  VG I  N  K      +A +QG DL+LF EL ++GYPPEDL+ + 
Sbjct: 1   MSKQLVVALAQLNLTVGAIEDNAQKCLEWAAKAEQQGADLVLFPELALTGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
                   A+  L++  + G   I+VG P   +EG+ N   ++  G I+   DK  LPNY
Sbjct: 61  DCQARVDEALAQLQA--YSGDIAILVGHPAMTEEGLRNRASLIHQGAILGHVDKQRLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E+R F     +  I F+  +LG+LICEDIW    + K +  QGA+ L +LNASP+ 
Sbjct: 119 RVFDEERYFEPADHSAVIPFKGHQLGVLICEDIWHPEPV-KQVTDQGADLLLTLNASPFD 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +KL +R +++    +   L ++Y+NQV GQDELIFDG S   D    +  ++  F E  
Sbjct: 178 MSKLTERLDVLEACTAESGLAVVYLNQVCGQDELIFDGHSLVMDATGHICHELPQFEES- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                    QL ++     D      +P Q+ +  YNA VL++RDYV KN F   ++GLS
Sbjct: 237 --------LQLVRFTDGQPDQGERHPLPSQDAQV-YNALVLAVRDYVGKNGFKGAVLGLS 287

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIA DALG + VQ +M+P+KYTS  S+EDA A A+ALG  YDV+ I  + +
Sbjct: 288 GGIDSALTLAIAADALGADKVQAVMMPFKYTSSMSVEDARAQAEALGVTYDVVSIEPMFD 347

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++   +        EN+Q+R RG +LMALSN S  +LLTT NKSE++VGY TLYG
Sbjct: 348 AFMGQLAPMFEGTQKDTTEENLQARARGVLLMALSNKSGKILLTTGNKSEMAVGYCTLYG 407

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF  +KDL K  V++L+ +RN+         L+EVIP  ++ + PSAEL P Q DQ
Sbjct: 408 DMCGGFAVIKDLPKLLVYRLSRYRNT---------LSEVIPERVITRPPSAELAPDQVDQ 458

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LDDI++R VE ++S        + +  VR V  L   +EYKRRQA VG ++T
Sbjct: 459 DSLPPYDVLDDILERYVERDQSLEEIVAAGHREADVRRVIRLTDINEYKRRQAAVGPRVT 518

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 519 PRAFGKDRRYPITSGF 534


>gi|86139281|ref|ZP_01057851.1| NAD(+) synthase [Roseobacter sp. MED193]
 gi|85824125|gb|EAQ44330.1| NAD(+) synthase [Roseobacter sp. MED193]
          Length = 552

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 246/558 (44%), Positives = 347/558 (62%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQ+NP VGD+AGN AKAR A  E      DL+   E+F++GY  +DLV K 
Sbjct: 1   MADRFRVTLAQMNPTVGDLAGNAAKARTAWAEGRAASADLVALPEMFLTGYNTQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F QA  +A + L  D  DG A + +G P  +   + N+ +IL  G I +   K +LPN 
Sbjct: 61  VFQQAAMAAAEQLALDCADGPA-LAIGCPWAEGGKLYNAYLILKDGKIASRCLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    D R+G  ICED W + ++ + L++ GAEFL   N SPYY
Sbjct: 120 TVFDEVRIFDAGPLGGPYAVGDTRIGSPICEDGW-HEDVAETLEETGAEFLLIPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK++ R   +  +     LP+IY+N VGGQD+ +FDG +F  +    LA QM  F E  
Sbjct: 179 RNKMEVRQNHMVARAVETGLPVIYLNLVGGQDDQVFDGGTFVLNPNGALALQMPVFDEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T+    +    W  +  D A   ++P   E+ DY   V SLRDY+ K  F K ++GLS
Sbjct: 238 -VTQLDLHRTPEGWRAVEGDKA---HLPDVWEQ-DYRTMVESLRDYMGKTGFKKALLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ AAIAVDA+G ENV+ +MLP +YTS +SL+DA A A+ALG  YD +PI +  +
Sbjct: 293 GGVDSAIVAAIAVDAIGAENVRCVMLPSEYTSRESLDDAEAVAEALGVHYDYVPIAEGRD 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++         +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITNTLAPLFNGREEDLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVI P++++K PSAELR  Q D 
Sbjct: 413 DMNGGYNPIKDLYKTRVFETCRWRNANHRPWMMGPAGEVIRPNVIDKPPSAELRDDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD I++ +V+ E S  +   + +  ETV+ VEHL+Y SEYKR Q+  G +++
Sbjct: 473 DSLPDYPELDAILEILVDQEGSVADCVAKGFARETVKRVEHLIYISEYKRFQSAPGARLS 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N+FRD
Sbjct: 533 PRAFWLDRRYPIVNRFRD 550


>gi|220933990|ref|YP_002512889.1| NAD+ synthetase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995300|gb|ACL71902.1| NAD+ synthetase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 546

 Score =  434 bits (1117), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 236/565 (41%), Positives = 341/565 (60%), Gaps = 34/565 (6%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKAR----RAREEANRQGMDLILFTELFISGYPPEDL 56
           M   LKIA+AQ++ +VGD+ GN  + R    +AR+E    G DL+LF EL I+GYPPEDL
Sbjct: 1   MTDTLKIALAQVDLLVGDVEGNAERIRDWVFKARDEL---GADLVLFPELAITGYPPEDL 57

Query: 57  VFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKIN 116
           + + S       A+  L  +    G  +V+G P QD+ G+ NS ++L  G I A  DK  
Sbjct: 58  LLRASLHARVERALHRLAHEVR--GIDVVLGAPMQDERGLHNSALLLRDGAIAARYDKQI 115

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LPNYS F EKR F+ G+    I  R + LG+ +CEDIW+     +  +   A  + ++NA
Sbjct: 116 LPNYSVFDEKRYFVPGHGACVIQVRGVPLGLTVCEDIWQPEPAARAREAG-ARLILNINA 174

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY+  K ++R + +  ++    L ++Y+N VGGQDEL+FDG S    G  ++       
Sbjct: 175 SPYHRGKREERLQTLRARVRETGLSVLYLNLVGGQDELVFDGQSLVMGGDGEV------- 227

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSA----STMYIPLQEEEAD-YNACVLSLRDYVQKNN 291
             +  +  WH    L   +  + D+     +    PL +E A+ Y A V  +RDYV KN 
Sbjct: 228 --RQSLPAWHEALSLVSVDCPAGDAPLQPRAGEQAPLADEAAELYQALVTGVRDYVSKNG 285

Query: 292 FHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYD 351
           F   ++GLSGGIDSAL   IAVDALG + V+ +M+PY+YT+  S+EDA + A++LG +Y 
Sbjct: 286 FRGAVLGLSGGIDSALTLCIAVDALGADAVEAVMMPYRYTASMSVEDARSQAQSLGVRYR 345

Query: 352 VLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEI 411
            +PI  +V  F + ++   +  P     ENIQ+R RG ILMA+SN +  MLLTT NKSE+
Sbjct: 346 EIPIEPMVEAFMTGLAPEFEGLPRDTTEENIQARCRGVILMAISNKTGRMLLTTGNKSEM 405

Query: 412 SVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSA 471
           +VGY TLYGDM+GGF PLKD+ K  VF+LA +RN+ G           IP  ++E+ PSA
Sbjct: 406 AVGYATLYGDMAGGFAPLKDVSKLWVFRLAEYRNTLGAA---------IPRRVIERPPSA 456

Query: 472 ELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRR 530
           EL P Q D +SLPPY +LD I++R VE ++S     +  +++ TV+ V  L+  +EYKRR
Sbjct: 457 ELAPGQQDSDSLPPYEVLDPILERFVEQDQSVEQIVRAGFDEATVQRVATLVLRNEYKRR 516

Query: 531 QAPVGTKITAKSFGRDRLYPISNKF 555
           QAP G ++T + FG+DR YPI++ +
Sbjct: 517 QAPPGVRVTRRGFGKDRRYPITSGY 541


>gi|197285726|ref|YP_002151598.1| NAD synthetase [Proteus mirabilis HI4320]
 gi|194683213|emb|CAR43877.1| glutamine-dependent NAD(+) synthetase [Proteus mirabilis HI4320]
          Length = 538

 Score =  434 bits (1117), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 242/562 (43%), Positives = 339/562 (60%), Gaps = 30/562 (5%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAK---ARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           M +KLK+A+AQLN VVGDI GN  +     +A+E+A     DL+LF+EL + GY PEDL+
Sbjct: 1   MSRKLKLALAQLNWVVGDIEGNCERMLATVKAQEDA-----DLVLFSELALCGYSPEDLL 55

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
           F+  F Q C   +  L+  +      IVVG P      + N++     G + A   K  L
Sbjct: 56  FRPDFQQRCEEQLVRLEQASKK--TAIVVGHPWWQNGTIYNALSFFYQGELQARYFKQQL 113

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           PNY  F EKR F  G     + F+   LG+LICEDIW N  I   LK+ GA+ + S+NAS
Sbjct: 114 PNYGVFDEKRYFQQGNERCVVPFKGYHLGLLICEDIWINEPI-DALKQAGADLVLSINAS 172

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY   K   R +++       HLP++Y+NQ+GGQDEL+FDG S  FD +  +  ++  F 
Sbjct: 173 PYSREKPHIRTQLIKEHCQRTHLPVVYLNQIGGQDELVFDGCSKVFDERGTITHRLAAFD 232

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           EQ  + E+       +   +    A+    PL +    Y A VL+ RDYV KN F   I+
Sbjct: 233 EQVAVVEF------DELTIVPMQDAAPELSPLAQV---YQALVLATRDYVTKNGFKGAIL 283

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDS L  AIAVDALGKE+VQ +M+P++YTS  S+ DA   A  LG ++D + I  
Sbjct: 284 GLSGGIDSGLTVAIAVDALGKESVQAVMMPFRYTSEMSIHDAKEQANLLGVEFDTVSIEP 343

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           + + F   +S   +        EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY T
Sbjct: 344 MFDAFMDQLSPMFKGSAVDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYST 403

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGF+ LKD+ KT VF+LA +RN+         L+  IP  ++++ PSAEL P Q
Sbjct: 404 LYGDMAGGFDVLKDVPKTLVFELAKYRNT---------LSPAIPQRVIDRPPSAELAPGQ 454

Query: 478 TDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           TDQ++LPPY ILD +++  VE ++S  +     +++  VR V  L+  +EYKRRQAPVG 
Sbjct: 455 TDQDNLPPYDILDALLEGYVEQDKSVSDLVAAGFDEAIVRKVVKLVDINEYKRRQAPVGP 514

Query: 537 KITAKSFGRDRLYPISNKFRDH 558
           +IT+++FG+DR YPI++ F  H
Sbjct: 515 RITSRNFGKDRRYPITSGFGRH 536


>gi|227356237|ref|ZP_03840626.1| glutamine-dependent NAD(+) synthetase [Proteus mirabilis ATCC
           29906]
 gi|227163701|gb|EEI48617.1| glutamine-dependent NAD(+) synthetase [Proteus mirabilis ATCC
           29906]
          Length = 538

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 242/562 (43%), Positives = 339/562 (60%), Gaps = 30/562 (5%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAK---ARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           M +KLK+A+AQLN VVGDI GN  +     +A+E+A     DL+LF+EL + GY PEDL+
Sbjct: 1   MSRKLKLALAQLNWVVGDIEGNCERMLATVKAQEDA-----DLVLFSELALCGYSPEDLL 55

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
           F+  F Q C   +  L+  +      IVVG P      + N++     G + A   K  L
Sbjct: 56  FRPDFQQRCEEQLVRLEQASKK--TAIVVGHPWWQNGTIYNALSFFYQGELQARYFKQQL 113

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           PNY  F EKR F  G     + F+   LG+LICEDIW N  I   LK+ GA+ + S+NAS
Sbjct: 114 PNYGVFDEKRYFQQGNERCVVPFKGYHLGLLICEDIWINEPI-DALKQAGADLVLSINAS 172

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY   K   R +++       HLP++Y+NQ+GGQDEL+FDG S  FD +  +  ++  F 
Sbjct: 173 PYSREKPHIRTQLIKEHCQRTHLPVVYLNQIGGQDELVFDGCSKVFDERGTITHRLAAFD 232

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           EQ  + E+       +   +    A+    PL +    Y A VL+ RDYV KN F   I+
Sbjct: 233 EQVAVVEF------DELTIVPMQDAAPELSPLAQV---YQALVLATRDYVTKNGFKGAIL 283

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDS L  AIAVDALGKE+VQ +M+P++YTS  S+ DA   A  LG ++D + I  
Sbjct: 284 GLSGGIDSGLTVAIAVDALGKESVQAVMMPFRYTSEMSIHDAKEQADLLGVEFDTVSIEP 343

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           + + F   +S   +        EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY T
Sbjct: 344 MFDAFMDQLSPMFKGSAIDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYST 403

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGF+ LKD+ KT VF+LA +RN+         L+  IP  ++++ PSAEL P Q
Sbjct: 404 LYGDMAGGFDVLKDVPKTLVFELAKYRNT---------LSPAIPQRVIDRPPSAELAPGQ 454

Query: 478 TDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           TDQ++LPPY ILD +++  VE ++S  +     +++  VR V  L+  +EYKRRQAPVG 
Sbjct: 455 TDQDNLPPYDILDALLEGYVEQDKSVSDLVAAGFDEAIVRKVVKLVDINEYKRRQAPVGP 514

Query: 537 KITAKSFGRDRLYPISNKFRDH 558
           +IT+++FG+DR YPI++ F  H
Sbjct: 515 RITSRNFGKDRRYPITSGFGRH 536


>gi|294340476|emb|CAZ88857.1| Glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) [Thiomonas sp. 3As]
          Length = 560

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 241/570 (42%), Positives = 332/570 (58%), Gaps = 31/570 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L++A+ Q NP VGD+AGN A+  R   +A  QG  +++  EL ++GYPPEDL+ + +F+Q
Sbjct: 3   LQLAVIQCNPTVGDLAGNAAQIARLTRQAYAQGARVVVTPELALTGYPPEDLLLRPAFLQ 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFP------------RQDQEGVLNSVVILDAGNIIAV 111
           A ++A+  L  D  D     +VVG P               Q    N+  +L  G + A 
Sbjct: 63  ASAAALKQLAHDLSDLPELALVVGHPLGLAAAEAPRIASTQQAVACNAASLLRGGVVEAT 122

Query: 112 RDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAE 169
             K  LPNY  F E+R F  G  + P+VF       GI ICED W   +  +  +  GA+
Sbjct: 123 YCKHELPNYQVFDERRYFAPG--DQPVVFEAGGTHFGINICEDAWL-PHAPRMARAAGAQ 179

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            L  LNASPY+  K  +R  ++  +     + ++    VGGQDE++FDGASF  D   +L
Sbjct: 180 VLLVLNASPYHRGKTAERERVMRERCLENGMALVASQMVGGQDEIVFDGASFVLDRAGEL 239

Query: 230 AFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQ 288
             +   F E     +    + L Q              PL+ + A+ Y A VL + DY+ 
Sbjct: 240 VARSPQFVEDILRVDVTGGEVLKQ--------TPAHVAPLKSDHAEVYAALVLGVHDYLG 291

Query: 289 KNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGC 348
           KN F   +IGLSGG DSAL  AIAVDALG + V+ +M+P +YT+  SL+DAA  A+ LG 
Sbjct: 292 KNGFPGALIGLSGGADSALVLAIAVDALGADKVRAVMMPSQYTAQMSLDDAAEMAQRLGV 351

Query: 349 KYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNK 408
           +YDVLPI  L   F + ++  L E P     ENIQ+RIRG +LM LSN+S  ++LTT NK
Sbjct: 352 RYDVLPITPLFETFRTTLAPLLHEHPGDTTLENIQARIRGTLLMGLSNNSGRIVLTTGNK 411

Query: 409 SEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKS 468
           SE+++GY TLYGDM+GGF  +KD+ KT V++LA WRN+H    G     EVIP  I+ ++
Sbjct: 412 SEMAMGYATLYGDMAGGFAVIKDVTKTLVWELARWRNAHAAAMG---EAEVIPQRIITRA 468

Query: 469 PSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEY 527
           PSAELR  QTDQ+SLPPY +LD I++R +E +E         Y    V  V HLL  SEY
Sbjct: 469 PSAELRADQTDQDSLPPYDVLDGILQRYMEQDERVETVLAAGYARADVERVVHLLKLSEY 528

Query: 528 KRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           KRRQAP G ++T ++FGRD  YPI++KFR+
Sbjct: 529 KRRQAPPGIRVTHRAFGRDWRYPITSKFRE 558


>gi|71906925|ref|YP_284512.1| NAD synthetase [Dechloromonas aromatica RCB]
 gi|71846546|gb|AAZ46042.1| NH(3)-dependent NAD(+) synthetase [Dechloromonas aromatica RCB]
          Length = 538

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 234/557 (42%), Positives = 334/557 (59%), Gaps = 24/557 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQ N  VGD+ GN+ +  +   EA  +G  ++L  EL + GYPPEDL+ +  F +
Sbjct: 2   LRIAVAQFNATVGDLTGNVERIIKCASEAKVRGAQVLLTPELALCGYPPEDLLLRPDFYR 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+D L S     G  +VVG P + +    N+  +++ G   AV  K+ LPNY  F 
Sbjct: 62  ACQRALDNLVSRVE--GIAVVVGHPEEHEGRCYNAATVIENGRSKAVYRKMRLPNYEVFD 119

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G     +    +R GI IC DIW+ +   +   + GAE L  LNASP +  K 
Sbjct: 120 EKRYFEPGTEACVVTLAGVRCGINICADIWE-AGAAELAHEAGAELLLVLNASPCHLEKH 178

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           ++R +++  +I    +P +Y N VGGQDEL+FDGASF  D ++    ++  F E   + +
Sbjct: 179 QQRIQVLGDRIDATGIPAVYCNLVGGQDELVFDGASFALDARKNCCMRLPQFEEALGIVD 238

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           +            SDD A  + +   E EA Y A V+ +RDY+ K  F   IIGLSGGID
Sbjct: 239 F------DAGRLHSDDMADELSL---EAEA-YKALVVGVRDYIGKTGFKGAIIGLSGGID 288

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL   +AVDALG + V+ +M+P  YT+  SL+D+    + LG +YD + I   +  + +
Sbjct: 289 SALTLCVAVDALGADKVRAVMMPSPYTAQMSLDDSREMIRVLGVQYDEIAIAPAMEVYGA 348

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
           ++       P+    ENIQ+RIRGNILMALSN + A++LTT NKSE++VGY TLYGDM+G
Sbjct: 349 MLDPLFAGLPADTTEENIQARIRGNILMALSNKTGALVLTTGNKSEMAVGYCTLYGDMAG 408

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF  +KD+YKT V++L+ +RN+  +  G      VIP +I+ + PSAEL+P QTDQ+SLP
Sbjct: 409 GFAVIKDVYKTLVYRLSVYRNT--LCQG----DPVIPENIIVRPPSAELKPDQTDQDSLP 462

Query: 485 PYPILDDIIKRIVENEES---FINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           PY ILD I++  +E + S    I    +  D  VR V  LL  +EYKRRQAP+G +IT +
Sbjct: 463 PYEILDAIVRAYMEEDRSPREIIAAGLQEAD--VRRVVRLLRIAEYKRRQAPIGIRITPR 520

Query: 542 SFGRDRLYPISNKFRDH 558
            FG+D  YPI+N++ D 
Sbjct: 521 GFGKDWRYPITNRYADE 537


>gi|163735249|ref|ZP_02142684.1| NAD synthetase [Roseobacter litoralis Och 149]
 gi|161391463|gb|EDQ15797.1| NAD synthetase [Roseobacter litoralis Och 149]
          Length = 541

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 235/548 (42%), Positives = 327/548 (59%), Gaps = 9/548 (1%)

Query: 12  LNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAID 71
           +NP VGD+AGN A AR         G DL+   E+FI+GY  +DLV K +F       I+
Sbjct: 1   MNPTVGDLAGNAAIAREVWAAGKAAGADLVALPEMFIAGYNAQDLVMKPAFQLDAMRHIE 60

Query: 72  TLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFIS 131
            L  D  DG   + +G P  +   + N+ +IL  G I++   K +LPN + F E R F +
Sbjct: 61  ALAQDCADGPT-LAIGSPWVEGTKLYNAYLILKGGKIVSQVLKHHLPNETVFDEVRIFDA 119

Query: 132 GYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIV 191
           G    P    + R+G  ICED W + ++ + L + GAEFL   N SPYY  K + R   +
Sbjct: 120 GPLGGPYSVGNSRVGSPICEDAW-HEDVAETLAETGAEFLLVPNGSPYYRGKFETRLNHM 178

Query: 192 TGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQL 251
             ++    LP+IY+N VGGQD+ +FDGASF  +    LA Q+  F E   +     ++  
Sbjct: 179 VARVIETELPLIYLNMVGGQDDQVFDGASFGLNPGGNLAVQLPAFDEA--VAHVDLERGP 236

Query: 252 SQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAI 311
             W  +  + A   + P    E DY   V +LRDY +K  F KV++GLSGG+DSAL A I
Sbjct: 237 EGWRIVEGEKA---HHP-DAWEQDYRVMVQALRDYCRKTGFGKVLLGLSGGVDSALVATI 292

Query: 312 AVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQ 371
           AVDA G +NV+ +MLP +YTS +SLEDA A AKALGC YD +PI +        ++   +
Sbjct: 293 AVDAFGAQNVRCVMLPSEYTSAESLEDAEAVAKALGCHYDYVPITEGRAAVEQTLAPLFE 352

Query: 372 EEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKD 431
              + +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YGDM+GG+NP+KD
Sbjct: 353 GHDADLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYGDMAGGYNPIKD 412

Query: 432 LYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDD 491
           LYKT+VF+   WRN +  +   GP  EVI P +++K PSAELR  Q D +SLP YP LD 
Sbjct: 413 LYKTRVFETCRWRNKNHRSWMEGPDGEVITPRVIDKPPSAELREDQKDSDSLPDYPELDR 472

Query: 492 IIKRIVENEESFINNDQEYND-ETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYP 550
           +++ +V+   S  +     +D ET + +EHL+Y SEYKR Q+  G ++T  +F  DR YP
Sbjct: 473 LLEILVDRNGSIEDCVAAGSDAETAKKIEHLIYISEYKRFQSAPGARLTKGAFWLDRRYP 532

Query: 551 ISNKFRDH 558
           I N++RD 
Sbjct: 533 IVNRWRDR 540


>gi|297537993|ref|YP_003673762.1| NAD+ synthetase [Methylotenera sp. 301]
 gi|297257340|gb|ADI29185.1| NAD+ synthetase [Methylotenera sp. 301]
          Length = 537

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 244/555 (43%), Positives = 333/555 (60%), Gaps = 29/555 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQ+N +VGDIAGN+AK       A + G  L++  EL + GYPPEDL+ ++ F+Q
Sbjct: 1   MKIAIAQMNCLVGDIAGNVAKIMANAALAKQHGATLMVTPELSLCGYPPEDLLLREDFLQ 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC +A++ L +   D    ++VG PRQ  +   N+  +L  G + A   K  LPNYS F 
Sbjct: 61  ACDAALEKLSTALTD--ITVIVGHPRQVGDECFNAASVLKDGEVFATYHKHALPNYSVFD 118

Query: 125 EKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           EKR F +G   +P+VF    +++G+LIC D+W+  N     K  GAE L +LNASP++  
Sbjct: 119 EKRYFTAG--GEPLVFEHCGVQIGVLICADVWE-PNPATLAKAAGAEVLIALNASPFHME 175

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K   R EI+  + S   L IIY N VGGQDEL+FDGASF  +    L  Q+  F      
Sbjct: 176 KQSTRLEILRERASETDLAIIYTNMVGGQDELVFDGASFVLNSNGDLTQQLPAF------ 229

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIP-LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
                D  L    +M          P L  E + Y A  L L+DYV+KN F  V++GLSG
Sbjct: 230 -----DAALEIVEFMGLQPIPAAVTPQLSIEASVYTALKLGLQDYVRKNGFPGVVLGLSG 284

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           G+DSAL  AIAVDALG E VQ +M+P ++T+  S+ DAA  AK LG KY  +PI +L   
Sbjct: 285 GVDSALTMAIAVDALGAEKVQAVMMPSEFTADISVNDAAEMAKLLGVKYSQMPIANLYES 344

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F   ++   +  P     EN+Q+RIRG +LMA+SN   ++++TT NKSE +VGY TLYGD
Sbjct: 345 FRVALADEFKGLPFDTTEENLQARIRGMLLMAISNKFGSIVVTTGNKSETAVGYCTLYGD 404

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGF  LKD+ KT V++L  +RNS         L+  IP  I+ + PSAELR +Q DQ+
Sbjct: 405 MAGGFALLKDVPKTLVYRLCDYRNS---------LSRAIPQRIITRPPSAELRANQLDQD 455

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPY +LD II+  VE+  S  +     Y+   V  V  L+  +EYKRRQ+PVG +IT 
Sbjct: 456 SLPPYDVLDVIIEAYVEDNLSARDIIAMGYSSTDVNRVITLIDRNEYKRRQSPVGVRITH 515

Query: 541 KSFGRDRLYPISNKF 555
           + FG+DR +PI+ K 
Sbjct: 516 RGFGKDRRHPITVKL 530


>gi|290476027|ref|YP_003468924.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Xenorhabdus bovienii
           SS-2004]
 gi|289175357|emb|CBJ82160.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Xenorhabdus bovienii
           SS-2004]
          Length = 540

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 235/556 (42%), Positives = 336/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L I +AQLN +VGDI GN  +  +  +E  ++G DL++F+EL +SGY PEDL+F+ 
Sbjct: 1   MSRTLNIVLAQLNWLVGDIEGNSERMLQTVQEQQKKGADLVMFSELALSGYFPEDLLFRA 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
              Q C   +  L+  +      I+VG P Q      N++ +   G IIA   K  LPNY
Sbjct: 61  DLHQRCREQLVRLQEASSQ--VAILVGHPWQQDGKTYNALSLFWKGEIIARYFKQLLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F +G  +  + F+   LG+LICED+W ++ I   LK+ G++ + SLNASPY 
Sbjct: 119 GVFDEDRYFKAGDQSCVVPFKGYNLGLLICEDLWFDAPI-DALKQAGSDIILSLNASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LPIIY+NQVGGQD+LIFDG S  FD   ++  +M  F EQ 
Sbjct: 178 REKPNIRSTLIQSHCQRTQLPIIYLNQVGGQDQLIFDGCSKVFDANGKITHRMAAFEEQI 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                    +  ++N M+ +  + +   L      Y A VLS+RDYV KN F   ++GLS
Sbjct: 238 ---------EQCRFNEMNIEPMANLIPQLSPLAQIYKALVLSVRDYVHKNGFKGALLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDALGK++VQ +M+P++YTS  S+ DA   A+ LG ++DV+ I  + +
Sbjct: 289 GGIDSGLTLAIAVDALGKDHVQAVMMPFRYTSEMSIHDAREQAELLGVEFDVVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + +             EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 349 AFMAQLEPMFAGTEKDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFN LKD+ KT VF L+ +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFNALKDVPKTMVFALSKYRNT---------VSPAIPQRVIDRPPSAELAPDQLDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I++  VE ++S  +   Q +++  VR V  L+  +EYKRRQAP+G +IT
Sbjct: 460 DSLPPYDMLDAILEGYVEKDKSVADLVAQGFDEAIVRKVIRLVDINEYKRRQAPIGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
            + FG+DR YPI++ F
Sbjct: 520 ERDFGKDRRYPITSGF 535


>gi|126724772|ref|ZP_01740615.1| NAD synthetase [Rhodobacterales bacterium HTCC2150]
 gi|126705936|gb|EBA05026.1| NAD synthetase [Rhodobacterales bacterium HTCC2150]
          Length = 552

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 241/563 (42%), Positives = 328/563 (58%), Gaps = 17/563 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +K +I +AQLNP +GD+  N  KAR A         D +   E+F++GY  +DL  + 
Sbjct: 1   MAEKFRITLAQLNPTLGDLTQNATKAREAWAAGKAANADFVALPEMFLTGYQLQDLAMRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+   +  +  L +D  DG A + +G P        N  +IL  G I     K +LP  
Sbjct: 61  AFLADVADVLKGLAADVADGPA-LGIGAPMIVDGKRHNCYLILQNGEIATQVLKHHLPID 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F SG  + P     +R+G  ICED W +     H  + GAE LF  N SPY 
Sbjct: 120 DVFDEARIFASGDVSGPYRIGPLRIGSPICEDAWFDDVTETH-AESGAEILFVPNGSPYM 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++  ++    LP+IY+N VGGQD+ +FDGASF  +    LA QMK   E  
Sbjct: 179 RAKQDHRIALMVARVVETGLPLIYLNLVGGQDDQVFDGASFALNRGGALAAQMKTLDEDI 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQ----EEEADYNACVLSLRDYVQKNNFHKVI 296
                H D +L       D+  +    PL+    E E DYN  V +LRDY+ K  F KV+
Sbjct: 239 C----HLDLELG------DEGWTIKQGPLEPRPDEYEQDYNVMVTALRDYMGKTGFKKVL 288

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +G+SGGIDSAL A IAVDALG ENV+ +MLP +YTS  SLEDA   A+ALG + D LPI 
Sbjct: 289 LGMSGGIDSALVATIAVDALGPENVRCVMLPSEYTSSHSLEDAEKAARALGVRMDTLPIA 348

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
                    ++   +     +  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY 
Sbjct: 349 GPRAAVTEALAPLFEGTKPDLTEENIQSRLRGLMLMALSNKFGEMLLTTGNKSEVAVGYA 408

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           T+YGDM+GG+NP+KDLYK +VFQ   WRN +     LGP  EVIP  I++K PSAELR  
Sbjct: 409 TIYGDMAGGYNPIKDLYKMRVFQTCRWRNENHRDWMLGPQAEVIPQRIIDKPPSAELRDD 468

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q D++SLPPY +LD I++ +V+ + S  +     ++ ETV+ +EHL+Y SE+KR Q+  G
Sbjct: 469 QKDEDSLPPYEVLDAILEMLVDQDFSVADVVAAGFDRETVKRIEHLIYISEHKRFQSAPG 528

Query: 536 TKITAKSFGRDRLYPISNKFRDH 558
            ++T ++F  DR YPI N++RD+
Sbjct: 529 ARLTGRAFWLDRRYPIVNRWRDN 551


>gi|148653679|ref|YP_001280772.1| NAD+ synthetase [Psychrobacter sp. PRwf-1]
 gi|148572763|gb|ABQ94822.1| NAD+ synthetase [Psychrobacter sp. PRwf-1]
          Length = 552

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 240/552 (43%), Positives = 331/552 (59%), Gaps = 19/552 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           LK A+AQ + +VGDI  NI K R    EA   G D+I+F EL + GYPPEDL+ + S   
Sbjct: 15  LKFAMAQSHFMVGDIQTNIDKMRSLAIEARDNGADVIVFPELALLGYPPEDLLLRPSLSD 74

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
              +A+ +L SD +D    +++G+P  D  G  NS  I+  G       K  LPNY  F 
Sbjct: 75  RVKAALSSL-SDIND--IVMIIGYPHVDYHGTFNSAAIIQNGQQKGFYHKQYLPNYGVFD 131

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E+R F  G +     ++ + +G+LICED+W+   I K LK QGA+ + ++NASP+   K 
Sbjct: 132 ERRYFDKGRNQVLFDYQGVTIGLLICEDLWQEEPI-KALKDQGADLVVTINASPFEAGKQ 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R  ++  + +   LPIIYVN VGGQD+L+FDG S        +A +   F E   M  
Sbjct: 191 HTRQALLNKRATDNQLPIIYVNAVGGQDDLVFDGGSMAIQANGDVAHEAPRFLEH--MLY 248

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
             YD +   +     DS +   + L  E   Y A V+ LRDYV  + F  VI+GLSGGID
Sbjct: 249 ATYDIKNHTF-----DSQTKAPLQLSSESETYQALVVGLRDYVNHSGFEGVIVGLSGGID 303

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL   +AVDALG + V  +M+PY+YTS  SLEDA A A+ L   Y V PIHD V+    
Sbjct: 304 SALTLCVAVDALGSDKVYAVMMPYEYTSQISLEDAQAQARRLNVSYTVCPIHDAVDGMRH 363

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++    +  +    ENIQ+R RG +LMALSN    +++TT NKSE++VGY TLYGDM+G
Sbjct: 364 TLAPLFSKAKADTTEENIQARARGMVLMALSNKFGHLVITTGNKSEMAVGYATLYGDMAG 423

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF+ LKD+YKTQV+ LA++RN    T+       VIP  ++ + PSAELRP Q DQ+SLP
Sbjct: 424 GFDVLKDVYKTQVYALANYRNRLEDTN-------VIPERVITRPPSAELRPDQVDQDSLP 476

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
            Y +LD I+K  ++N+  F     + ++ E VR+V  L+  SEYKRRQA +GTKI+ K+F
Sbjct: 477 DYDLLDAILKDYIDNDLGFNEITAKGFDPEVVRHVIKLVDRSEYKRRQAAIGTKISHKAF 536

Query: 544 GRDRLYPISNKF 555
           GR+R YP+ N +
Sbjct: 537 GRERRYPLVNGW 548


>gi|332970488|gb|EGK09478.1| NAD synthetase [Psychrobacter sp. 1501(2011)]
          Length = 557

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 238/556 (42%), Positives = 339/556 (60%), Gaps = 23/556 (4%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           K LK A+AQ + +VGDI  NI K R    EA   G ++I+F EL + GYPPEDL+ + S 
Sbjct: 17  KSLKFALAQSHFMVGDIQTNIEKMRSLAIEARDNGANIIIFPELALLGYPPEDLLLRPSL 76

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
                +A+ +L +D +D    +++G+P  D  G  NS  I+  G       K  LPNY  
Sbjct: 77  SDRVKAALSSL-NDIND--IVMIIGYPHVDYHGTFNSAAIIQNGQQKGFYHKQYLPNYGV 133

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F E+R F  G +     ++ I +G+LICED+W++  I K LK QGA+ + ++NASP+   
Sbjct: 134 FDERRYFDKGRNQVLFDYQGITIGLLICEDLWQDEPI-KALKDQGADLVVTINASPFEAG 192

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K   R  +++ + +  +LPI+YVN VGGQD+L+FDG S       ++A +   F E   M
Sbjct: 193 KQHTRQALLSKRATDNNLPIVYVNAVGGQDDLVFDGGSMAVQANGKVAHEAPRFLEH--M 250

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
              +++ +  Q+     D+ +   + L  E   Y A V+ LRDYV  + F  VI+GLSGG
Sbjct: 251 LYANFNVESGQF-----DTQTKAPLQLSAESETYQALVVGLRDYVNHSGFEGVIVGLSGG 305

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL   IAVDALG + V  +M+PY+YTS  SLEDA A A+ L   Y V PIHD V+  
Sbjct: 306 IDSALTLCIAVDALGSDKVYAVMMPYEYTSQISLEDAQAQARRLNVSYTVCPIHDAVDGM 365

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
              ++    +  +    ENIQ+R RG +LMALSN    +++TT NKSE++VGY TLYGDM
Sbjct: 366 RHTLAPLFSKAKADTTEENIQARARGMVLMALSNKFGHLVITTGNKSEMAVGYSTLYGDM 425

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF+ LKD+YKTQV+ LA++RN           T+VIP  ++ + PSAELRP Q DQ+S
Sbjct: 426 AGGFDVLKDVYKTQVYALANYRNRL-------EDTDVIPERVITRPPSAELRPDQKDQDS 478

Query: 483 LPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           LP Y ILD I+K  ++N+  F  N+   + ++ +TVR    ++  SEYKRRQA +GTKI+
Sbjct: 479 LPDYDILDAILKDYIDNDLGF--NEIVAKGFDPDTVRQTIRMVDRSEYKRRQAAIGTKIS 536

Query: 540 AKSFGRDRLYPISNKF 555
            K+FGR+R YP+ N +
Sbjct: 537 HKAFGRERRYPLVNGW 552


>gi|257093881|ref|YP_003167522.1| NAD synthetase [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257046405|gb|ACV35593.1| NAD+ synthetase [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
          Length = 536

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 232/555 (41%), Positives = 326/555 (58%), Gaps = 25/555 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           LKIAIAQ+N  VGD AGN  +     E A  QG DL+L  EL + GYPPEDL+ +  F  
Sbjct: 3   LKIAIAQINATVGDFAGNAQRILDFAERARAQGADLLLTPELSLCGYPPEDLLLRDDFCA 62

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC   +  L S     G  ++VG P +      N+  ++  G  +A   K  LP+Y  F 
Sbjct: 63  ACEHELALLASRV--AGIAVLVGHPEKRAAHCYNAATLITDGTRVATYYKQRLPSYEVFD 120

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E+R F SG     +  + +R G+ IC D+W+ +      +  GAE L  LNASPY+  K 
Sbjct: 121 EERYFDSGEGPCVLTLKGVRCGVNICADVWE-AGAADLARNAGAEVLLVLNASPYHIGKR 179

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           ++R E++  +I+   LP++Y N  GGQDEL+FDG SF  D +  L  Q+  F E      
Sbjct: 180 ERRTEVLRQRIASTGLPVVYANLAGGQDELVFDGGSFVLDSRGTLCCQLPQFEEA----- 234

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGLSGGI 303
                 L   +++  +  +    P    EA+ Y A VL +RDY+ KN F   IIGLSGGI
Sbjct: 235 ------LGIVDFVDGEPQAAAIAPAPCLEAEVYQALVLGVRDYLGKNGFPGAIIGLSGGI 288

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IAVDALG + V+ +M+P  YT+  SL ++    + LG +YD + I   +  F 
Sbjct: 289 DSALTLCIAVDALGADKVRAVMMPSPYTAELSLAESREMVRLLGIRYDEIAIEPAMQTFA 348

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           +++ Q     P+    EN+Q+RIRG ILMA+SN + +++LTT NKSE++VGY TLYGDM+
Sbjct: 349 AMLEQQFAGLPADTTEENLQARIRGMILMAISNKTGSLVLTTGNKSEMAVGYCTLYGDMA 408

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF  +KD+ KT V++L+ WRN+          +  IP  I+ + PSAEL+P QTDQ+SL
Sbjct: 409 GGFAVIKDIAKTLVYRLSRWRNTR---------SYAIPERIISRPPSAELKPDQTDQDSL 459

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           PPY +LD I++  +E + S      Q + +  VR V HLL  SEYKRRQAPVG ++T + 
Sbjct: 460 PPYEVLDAIVEAYMEKDLSPRQIIAQGHAEADVRRVVHLLKISEYKRRQAPVGIRVTQRG 519

Query: 543 FGRDRLYPISNKFRD 557
           FG+D  YPI+N++RD
Sbjct: 520 FGKDWRYPITNRYRD 534


>gi|254487562|ref|ZP_05100767.1| glutamine-dependent NAD(+) synthetase [Roseobacter sp. GAI101]
 gi|214044431|gb|EEB85069.1| glutamine-dependent NAD(+) synthetase [Roseobacter sp. GAI101]
          Length = 552

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 242/558 (43%), Positives = 337/558 (60%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I + QLNP VGD+AGN   AR A  +    G DL+   E+FI+GY  +DLV K+
Sbjct: 1   MTSRFRITLGQLNPTVGDLAGNADLARDAWAKGKAAGADLVALPEMFITGYNAQDLVMKR 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F     + I+ L +D  DG A + +G P  +   + N+ +IL  G + +   K NLPN 
Sbjct: 61  AFQLDVMTHINALAADCADGPA-LAIGAPWVEGAELYNAYLILKGGKVASRAFKHNLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F S     P    D R+G  ICED W + ++ + L + GAEFL   N SPYY
Sbjct: 120 TVFDEVRVFDSAPLAGPYSVGDTRIGSPICEDAW-HPDVAETLAETGAEFLLVPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R   +  ++    LP+IY+N VGGQD+ +FDGASF  +   +LAFQM  F  + 
Sbjct: 179 RGKFETRLNNMVARVVETELPLIYLNMVGGQDDQVFDGASFGLNPGGKLAFQMPTFDAE- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     +Q    W  +    A   ++P  E E DY   V  LRDY++K  F KV++GLS
Sbjct: 238 -IAHVDLEQGSEGWRIVDGPKA---HLP-SEYEQDYRVMVQGLRDYMRKTGFKKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ AAIAVDALG + V+ +MLP +YTS  SL+DA A AKALGC+YD +PI     
Sbjct: 293 GGIDSAIVAAIAVDALGADKVRCVMLPSEYTSQASLDDAEAVAKALGCRYDYVPIKQGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +     +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITETLAPLFEGMKPDLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN +     +GP  +VI P I++K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFETCRWRNENHRDWMMGPAGKVITPRIIDKPPSAELREDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD ++  +V+ + S  +     ++ +  + VEHL+Y SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPDLDAMLDILVDQDGSIADCVAAGFDRDVAKKVEHLIYISEYKRFQSAPGPRLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
             +F  DR YPI N++RD
Sbjct: 533 KGAFWLDRRYPIVNRWRD 550


>gi|119897651|ref|YP_932864.1| NAD synthetase [Azoarcus sp. BH72]
 gi|119670064|emb|CAL93977.1| NAD(+) synthase (glutamine-hydrolyzing) [Azoarcus sp. BH72]
          Length = 538

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 240/563 (42%), Positives = 335/563 (59%), Gaps = 31/563 (5%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L IA+AQLN  VGD+ GN  +   A   A  +G  L++  EL +SGYPPEDL+ + 
Sbjct: 1   MNTALSIAVAQLNFTVGDLVGNADRIIEAISAARERGAGLLITPELALSGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F + C+  +  +     D    +V+G P +      N+  ++  G +IA   K  LPNY
Sbjct: 61  DFYRGCAREVRRIAGHCRD--FCLVLGHPTERGGVYYNAASVIRDGEVIATYHKHLLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
             F E+R F SG +  P VF    +R+G+ IC D+W+ S   +  +  GAE L SLNASP
Sbjct: 119 EVFDEERYFESGVA--PCVFEHGGVRIGVNICADVWE-SGPAEVARAAGAEVLVSLNASP 175

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           ++ +K + R+ ++  ++    LP++Y N VGGQDEL+FDGASF  D    +A+Q + F+ 
Sbjct: 176 FHIDKQQLRYAVLRDRVRETRLPVLYCNMVGGQDELVFDGASFALDRDGTVAYQSEAFAA 235

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
              +    ++Q   +W      S      P   E   Y A V  +RDY+ KN F   IIG
Sbjct: 236 --CIDVLRFEQ--GRW------SGGGHAAPKGTEADIYAALVCGVRDYLGKNGFPGAIIG 285

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL  A+AVDALG + V  +M+P  YT+  SL+D+    K LG +YD + I   
Sbjct: 286 LSGGIDSALTLAVAVDALGADRVHAVMMPSPYTAQMSLDDSREMVKRLGVRYDEIAIEPA 345

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           +N F  L++       +    EN+QSRIRG ILMALSN + A++LTT NKSE++ GY TL
Sbjct: 346 MNVFADLLAPQFAGLAADTTEENLQSRIRGMILMALSNKTGAIVLTTGNKSEMATGYATL 405

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGF  LKDLYKT V++LA+WRNS G         EVIP +I+++ PSAEL+P Q 
Sbjct: 406 YGDMAGGFAVLKDLYKTTVYRLAAWRNSVG---------EVIPQNIIDRPPSAELKPDQK 456

Query: 479 DQESLPPYPILDDIIKRIVENEES---FINNDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           DQ+SLPPY +LD II+  +E++ES    I       D  VR    +L  +EYKRRQAPVG
Sbjct: 457 DQDSLPPYEVLDAIIQAYMEHDESPREIIARGLPEAD--VRRTVTMLKRNEYKRRQAPVG 514

Query: 536 TKITAKSFGRDRLYPISNKFRDH 558
            ++T + FGRD  YPI+++++D 
Sbjct: 515 IRVTQRGFGRDWRYPITSRYQDE 537


>gi|300724142|ref|YP_003713459.1| putative glutamine-dependent NAD(+) synthetase [Xenorhabdus
           nematophila ATCC 19061]
 gi|297630676|emb|CBJ91341.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Xenorhabdus nematophila
           ATCC 19061]
          Length = 540

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 236/556 (42%), Positives = 335/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L I +AQLN +VGDI GN  +  +  +E   +  DL++F+EL +SGY PEDL+F+ 
Sbjct: 1   MSRTLNIGLAQLNWLVGDIEGNCERMLQTVKEQQEKEADLVMFSELALSGYFPEDLLFRS 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
              Q C   +  L+  +      I+VG P Q    + N++ +   G ++A   K  LPNY
Sbjct: 61  DLHQRCREQLIRLQEASSQ--VAILVGHPWQQDGKLYNALSLFWQGEVVARYFKQLLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E+R F +G  +  I F+   LG+LICED+W +  +   LKK GAE + S+NASPY 
Sbjct: 119 GVFDEERYFKAGKQDCVIPFKGYNLGLLICEDLWFDEPV-NALKKAGAEIILSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LPI+Y+NQVGGQD+LIFDG S  FD + ++  +M  F EQ 
Sbjct: 178 REKPNIRSALIKSHCQRTQLPIVYLNQVGGQDQLIFDGCSKVFDAKGEITHRMVAFEEQ- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + +  +D        M+ +  +     L      Y A VLS+RDYVQKN F   ++GLS
Sbjct: 237 -IEQCRFDG-------MNIEPMANPIPQLPSLGQIYKALVLSVRDYVQKNGFKGALLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDALGK++VQ +M+P++YTS  S+ DA   A+ LG ++DV+ I  + +
Sbjct: 289 GGIDSGLTLAIAVDALGKDHVQAVMMPFRYTSEMSIHDAREQAEMLGVEFDVVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + +             EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 349 AFMTQLEPMFAGTEKDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFN LKD+ KT VF L+ +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFNALKDVPKTMVFALSEYRNT---------VSPAIPQRVIDRPPSAELAPDQLDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I++  VE ++S  +   E  DE  VR V  L+  +EYKRRQAP+G +IT
Sbjct: 460 DSLPPYDMLDAILEGYVEKDKSVADLIAEGFDEVIVRKVIRLVDINEYKRRQAPIGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
            + FG+DR YPI++ F
Sbjct: 520 QRDFGKDRRYPITSGF 535


>gi|88800780|ref|ZP_01116337.1| NAD synthase [Reinekea sp. MED297]
 gi|88776486|gb|EAR07704.1| NAD synthase [Reinekea sp. MED297]
          Length = 538

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 235/552 (42%), Positives = 329/552 (59%), Gaps = 19/552 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+A+AQ    VGDI GN+ K      EA  QG D+I+F EL ++GYPPEDL+ + S  +
Sbjct: 1   MKLALAQQRFPVGDIDGNVDKILTLSREAMAQGADMIVFPELTLTGYPPEDLLLRPSLAK 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
             S A+  L          +VVG+P+++   + N V+++  G +IA   K +LPNY  F 
Sbjct: 61  RVSQAMHRLFDARLP--IAMVVGYPQREDGKLYNKVMVISEGQVIADYRKQHLPNYQVFD 118

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G       F   R+G+ ICEDIW +    +   + GA+   ++N SPY  N+ 
Sbjct: 119 EKRYFQKGDQTCVFDFMGARIGLSICEDIWYDGP-ARRAYEAGAQINLNINGSPYSINRT 177

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RHE VT  +S   +  +YVN VGGQDEL+FDG SF       +   +  F E     E
Sbjct: 178 AERHEQVTRVVSQWPMATVYVNHVGGQDELVFDGGSFVVGADATVQASLPEFQEALQYVE 237

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
               Q+ + W   S +       P+  E A Y A    L DYV +N F  V++G+SGGID
Sbjct: 238 --LTQEANGWQVKSGEVTP----PMSVEAALYEALKTGLADYVNRNRFPGVVLGMSGGID 291

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL AAIAVDALG + V  +M+PY YT+  SLEDA   A+ LG +Y+VLPI +      +
Sbjct: 292 SALSAAIAVDALGPDRVMGVMMPYHYTAKISLEDAEDEARRLGIRYEVLPIGEAFEAALT 351

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +     + P+ +  +N+QSR+RG  LMALSN +  M+LTT NKSE++VGY TLYGDM G
Sbjct: 352 TLQPQFGDRPADVTEQNMQSRMRGLFLMALSNKTGNMVLTTGNKSEMAVGYATLYGDMCG 411

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           G+N LKD+ K  V++L+ WRNS G         EVIP  ++ + PSAEL P Q D++SLP
Sbjct: 412 GYNCLKDVPKLWVYRLSRWRNSFG---------EVIPERVITRPPSAELAPDQLDEDSLP 462

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY +LD II+R VE++ES     +  +N++ V+ V  L+  +EYKRRQAP G ++T + F
Sbjct: 463 PYEVLDAIIERYVEHDESQQTIIESGFNEDDVKRVIRLIDLNEYKRRQAPEGVRVTKRGF 522

Query: 544 GRDRLYPISNKF 555
           GRDR YPI++ +
Sbjct: 523 GRDRRYPITHGW 534


>gi|304415435|ref|ZP_07396084.1| putative NAD synthase [Candidatus Regiella insecticola LSR1]
 gi|304282699|gb|EFL91213.1| putative NAD synthase [Candidatus Regiella insecticola LSR1]
          Length = 546

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 238/561 (42%), Positives = 347/561 (61%), Gaps = 28/561 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  RA ++  R   DL++F+EL + GYPPEDL+F+ 
Sbjct: 2   MNRSLSIALAQLNLLVGDIKGNTDRILRALKQ-QRGRADLVMFSELALCGYPPEDLLFRA 60

Query: 61  SFIQACSSAIDTL-KSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
            F Q C + +  L K+  H     I+VG P +  + + N++     G ++    K  LPN
Sbjct: 61  DFNQLCITQLARLQKASVH---TAILVGHPWKQGDQLYNALSFFSEGKLLGRYFKQLLPN 117

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           +S F EKR F  G ++  + F+  RLG+LICEDIW    +   LK  GAE L S+NASPY
Sbjct: 118 HSVFDEKRYFTPGNTSCIVEFKGYRLGMLICEDIWSPDPV-DALKNLGAEVLLSINASPY 176

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           +  K   R++++        LP++Y+NQVG QDELIFDG S  F+ Q  L  ++  FSE+
Sbjct: 177 HREKPYIRNQLLINHCKGTTLPLVYLNQVGVQDELIFDGCSKVFNAQGDLIHRLAAFSEE 236

Query: 240 N--FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           +  F  +    QQ+++    +D   + +Y          +A V+++RDYV KN F   I+
Sbjct: 237 SLVFNLKELASQQIAETAIDADHPLAQIY----------DALVMAVRDYVNKNGFKTAIL 286

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSAL  AIAVDAL  +NVQ +M+P++YTS +S+  A   A+    +   + IH 
Sbjct: 287 GLSGGIDSALTLAIAVDALTAKNVQALMMPFRYTSEESINYARQQAQKQKIELKEIDIHP 346

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           + +     ++ F  +       EN+Q+R RG +LMA++N    ++LTT NKSE++VGY T
Sbjct: 347 IFDAVMGQLAPFFADRKKDTTEENLQARCRGMLLMAMANKFGHIVLTTGNKSELAVGYST 406

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSH-GITSGLGPLTEVIPPSILEKSPSAELRPH 476
           LYGDM+GGF+ LKD+ KT VF+LA +RN+  G+        EVIP +++++ PSAEL P+
Sbjct: 407 LYGDMAGGFDVLKDVSKTLVFKLAKYRNARDGV--------EVIPQAVIDRPPSAELAPN 458

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFINNDQEYNDE-TVRYVEHLLYGSEYKRRQAPVG 535
           QTDQ+ LPPY +LD I++  +E +ES  +   +  DE TVR V HL+  +E+KRRQA +G
Sbjct: 459 QTDQDQLPPYAVLDKILEGYLEKDESVTDLVAQGCDEATVRKVIHLVDSNEHKRRQAAIG 518

Query: 536 TKITAKSFGRDRLYPISNKFR 556
            +IT + FG+DR YPI+N FR
Sbjct: 519 PRITCRDFGKDRRYPITNGFR 539


>gi|78485716|ref|YP_391641.1| NAD+ synthetase [Thiomicrospira crunogena XCL-2]
 gi|78364002|gb|ABB41967.1| NH(3)-dependent NAD(+) synthetase [Thiomicrospira crunogena XCL-2]
          Length = 545

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 237/573 (41%), Positives = 352/573 (61%), Gaps = 44/573 (7%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGN----IAKARRAREEANRQGMDLILFTELFISGYPPEDL 56
           M ++L I +AQ+NP+VGD+ GN    I  A++A+ E      D+++F E+ ++GYPPEDL
Sbjct: 1   MSEQLTIIMAQINPIVGDVEGNTSLIIESAKQAKMEHQ---ADIVVFPEMTLTGYPPEDL 57

Query: 57  VFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKI 115
           +F+++  Q   S++ T+     D    +V+G+P  D+ G   N    ++ G I A   K 
Sbjct: 58  LFREALYQQVESSLSTICEQVTD--TVLVIGYPMMDELGDRFNMAAWIEDGQIQASYIKQ 115

Query: 116 NLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLN 175
           NLPNYS F EKR F SG     + ++ ++ G+LICEDIWK S   + +K  GA+ L +LN
Sbjct: 116 NLPNYSVFDEKRYFSSGQQPCVVEYKGVKFGLLICEDIWKLSPADQSVKA-GADILLNLN 174

Query: 176 ASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASF--CFDGQQQLAFQM 233
           ASP+   K + R  +V  ++  V  P+IYVNQVGGQDEL+FDG SF  C +G+ Q+    
Sbjct: 175 ASPFSQEKHQDRIRVVKRRVEEVKRPVIYVNQVGGQDELMFDGGSFATCAEGEVQV---- 230

Query: 234 KHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP------LQEEEADYNACVLSLRDYV 287
                  F T+    + L Q +       + + +P      LQ E   Y A V+ ++DYV
Sbjct: 231 ---QGAEFKTDLIPVKILKQAD-------AVVILPGEKAELLQNEARVYEALVMGVKDYV 280

Query: 288 QKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALG 347
            KN F  V++GLSGGIDSAL  AIAVDALG   V+ +M+P+KYT+  S+EDA   A+ LG
Sbjct: 281 HKNGFKGVLLGLSGGIDSALTLAIAVDALGDNQVEAVMMPFKYTADISVEDAEKEAQVLG 340

Query: 348 CKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSN 407
             Y  +PI  + + + S ++   +     +  EN+Q+RIRG +LM++SN +  ++L TSN
Sbjct: 341 VHYHSIPIEPIYDAYESALASRFEGYEEDVTEENMQARIRGVLLMSISNKTGKLVLATSN 400

Query: 408 KSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEK 467
           KSE++VGY TLYGDM GGF+PLKD+ KT V++LA +RN+         ++ VIP  ++ +
Sbjct: 401 KSEVAVGYSTLYGDMVGGFSPLKDVPKTLVYRLAEYRNT---------ISSVIPERVITR 451

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE--YNDETVRYVEHLLYGS 525
            PSAELRP Q DQ+SLP Y +LD IIK  V+ ++S     +E  Y+ + V  +  ++  +
Sbjct: 452 PPSAELRPDQKDQDSLPDYEVLDTIIKAFVKEDKSPAQIVEEFGYDKQEVVRITKMISRN 511

Query: 526 EYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
           EYKRRQA  G KI+ ++FGRDR YPI++++ + 
Sbjct: 512 EYKRRQAAPGVKISPRAFGRDRRYPITSRYAEE 544


>gi|226943322|ref|YP_002798395.1| glutamine-dependent NAD+ synthase [Azotobacter vinelandii DJ]
 gi|226718249|gb|ACO77420.1| glutamine-dependent NAD+ synthase [Azotobacter vinelandii DJ]
          Length = 556

 Score =  428 bits (1101), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 237/563 (42%), Positives = 338/563 (60%), Gaps = 29/563 (5%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEA-NRQGMDLILFTELFISGYPPEDLVFK 59
           M + L++ +AQLN  VGD+ GN+ +   A   A + +G D+I+F EL + GYPPEDL+ +
Sbjct: 13  MSQTLRVVMAQLNLRVGDVHGNVERIIEAACSARDDRGADVIVFPELALCGYPPEDLLLR 72

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
            S        +  LK +    G  +V+G+P  +     N+  ++  G ++A   K +LPN
Sbjct: 73  SSMQLRIEQGLQRLKDEVR--GIYLVIGYPWLEDGRRFNAAAVIADGELLASYYKQHLPN 130

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           Y  F E+R F  G     +  + I + + ICEDIW    + +  ++ GA  + SLNASP+
Sbjct: 131 YRVFDERRYFEPGSEACLLDIKGIPVALSICEDIWFPGPM-RQAREAGARLMLSLNASPF 189

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           + +K ++R EI+  + S   +P+IYVNQVGGQDEL+FDG S       Q+  +   F E 
Sbjct: 190 HLDKQREREEILVARTSEGGMPVIYVNQVGGQDELVFDGGSCVVAADGQVVQRAPAFVEG 249

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYI----PLQEEEAD-YNACVLSLRDYVQKNNFHK 294
            +  +            + DD A+T       PL E EA  Y A VL +RDYV KN F  
Sbjct: 250 LYPVDLG----------IGDDGAATPRATNCAPLPELEASVYQALVLGVRDYVCKNGFKG 299

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
           V++GLSGGIDSAL  A+AVDALG E V+ +M+PY YT+  SLEDA A A+ALG  Y VLP
Sbjct: 300 VVLGLSGGIDSALTLAVAVDALGAERVEAVMMPYHYTAQMSLEDAEAEARALGVTYRVLP 359

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I  +V  F   ++   +        EN+Q+R RG +LMA+SN    ++LTT NKSE++VG
Sbjct: 360 IAPMVEAFMGTLAPVFEGLGRDTTEENLQARCRGTLLMAISNKKGYLVLTTGNKSEMAVG 419

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
           Y TLYGDM+GGF+ LKD+ KT VF+L  +RN  G          VIP  ++++ PSAEL 
Sbjct: 420 YATLYGDMAGGFDVLKDVPKTLVFRLCDYRNRLG---------AVIPQRVVDRPPSAELA 470

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAP 533
           P Q D++SLPPYP+LD+I+K  +E + S      E ++++TVR V  L+  +EYKRRQA 
Sbjct: 471 PGQKDEDSLPPYPVLDEILKLYIEYDLSANAIVAEGFDEDTVRRVLRLVDLNEYKRRQAA 530

Query: 534 VGTKITAKSFGRDRLYPISNKFR 556
           VG ++T + FGRDR YPI++ +R
Sbjct: 531 VGVRVTQRGFGRDRRYPITSGWR 553


>gi|261345356|ref|ZP_05973000.1| NAD(+) synthase [Providencia rustigianii DSM 4541]
 gi|282566399|gb|EFB71934.1| NAD(+) synthase [Providencia rustigianii DSM 4541]
          Length = 540

 Score =  428 bits (1101), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 230/556 (41%), Positives = 341/556 (61%), Gaps = 23/556 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL I++AQLN +VGDI GN  +  +  E+ + Q  D+++F+EL ++GY PEDL+F+ 
Sbjct: 1   MSRKLNISLAQLNWLVGDIEGNCDRMLQVVEQQS-QNTDIVMFSELALTGYSPEDLLFRH 59

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F + C + +  L+  +  G   I+VG P  +   + N++     G ++A   K  LPNY
Sbjct: 60  DFEERCVAQLKRLQQAS--GECAIIVGHPWYEDSEIYNALSFFYQGKLLARYFKQELPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F +      + F+  RLG+LICEDIW +  I  ++K  GAE + ++NASPY 
Sbjct: 118 GVFDEPRYFTAAEDTCVVDFKGYRLGLLICEDIWYDEPI-DNVKGAGAELVLTINASPYD 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K   R +++        LPIIY+NQVGGQDEL+FDGAS     + +  +QM  F EQ 
Sbjct: 177 LHKEHIRSDLLEEHCQRTGLPIIYLNQVGGQDELVFDGASKVLANKGKQVYQMAEFDEQV 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
               +   + +++   + + S +            Y A VL+ RDY+ KN F+  I+GLS
Sbjct: 237 ATVTFEELKLVTEQPKLPEVSTTAQV---------YQALVLATRDYINKNGFNGAILGLS 287

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDA+GKE VQ +M+P++YTS  S+ DA   A+ LG ++D++ I  + +
Sbjct: 288 GGIDSGLTVAIAVDAIGKEQVQAVMMPFRYTSEMSIHDAKEQAELLGVEFDIVSIEPMFD 347

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + +        +    EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 348 AFMTELQPMFAGAQADTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 407

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 408 DMAGGFDVLKDVPKTLVFELAKYRNT---------ISPAIPQRVIDRPPSAELAPGQLDQ 458

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I++  VE + S  +  +  ++ ETVR V  L+  +EYKRRQAPVG +IT
Sbjct: 459 DSLPPYDVLDAILEGYVEKDLSVTDLIKLGFDKETVRKVVRLVDINEYKRRQAPVGPRIT 518

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 519 MRNFGKDRRYPITSGF 534


>gi|260575409|ref|ZP_05843408.1| NAD+ synthetase [Rhodobacter sp. SW2]
 gi|259022329|gb|EEW25626.1| NAD+ synthetase [Rhodobacter sp. SW2]
          Length = 552

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 237/557 (42%), Positives = 331/557 (59%), Gaps = 9/557 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +  ++ +AQLNP VG IA N A AR    + +  G  ++   E+FI+GY  +DL+ K 
Sbjct: 1   MAETFRLTLAQLNPTVGAIAANAALARDVWAQGHAAGAQMVALPEMFITGYQTQDLILKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           SF+ A  +A+  L  D   G A + +G P      + N   +L  G + A   K +LPN 
Sbjct: 61  SFVAAAMAAVQALAVDCATGPA-LGIGGPVVQDGQLYNGYYVLAGGRVAATVLKHHLPND 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +     P+    +RLGI ICED W + ++   L   GA+ L   N SPY+
Sbjct: 120 GVFDEKRVFAAAEVGAPVTVGPLRLGIPICEDAW-HPDVTAALAAAGADILLIPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R  ++  +++   L ++Y+N  GGQD+ +FDGASF  +   Q+A QM  F +  
Sbjct: 179 RGKPLQRVRLMQTRVAETGLALVYLNMTGGQDDQVFDGASFVVNPGGQIALQMPQFDDAV 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              ++    Q   W  +  D      I     EADY ACVLSLRDY+ K  F +V++GLS
Sbjct: 239 VQVDFTRGPQ--GWQAVPGDLTPIPRI----WEADYRACVLSLRDYLAKTGFKQVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A IA DA+G  NV+ +MLP  +TS  SL+DA   A+ LGC+ D +PI     
Sbjct: 293 GGIDSAIVATIAADAIGPANVRCVMLPSGFTSAHSLQDAGEVARNLGCRLDTVPIGGAQA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + +         GI  ENIQSR+RG +LMA+SN + AMLLTT NKSE++VGY T+YG
Sbjct: 353 AVGAALQPLFAGTAPGITEENIQSRLRGLMLMAISNKTGAMLLTTGNKSEMAVGYCTIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KD+YKT+VF+   WRN +     LGP   VIP  ++ K+PSAELR  Q D 
Sbjct: 413 DMNGGYNPIKDMYKTRVFETCRWRNENHRPWMLGPTGAVIPERVISKAPSAELREGQRDD 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPYP+LD I++ +V+ E+S      Q ++   V+ VE LLY SEYKR QA  GT++T
Sbjct: 473 DSLPPYPVLDAILEGLVDREQSVAEIVAQGHDLAVVKRVEQLLYVSEYKRYQAAPGTRLT 532

Query: 540 AKSFGRDRLYPISNKFR 556
             +FG DR YPI+N++R
Sbjct: 533 PHAFGLDRRYPIANRWR 549


>gi|253988810|ref|YP_003040166.1| NAD synthetase [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253780260|emb|CAQ83421.1| nh(3)-dependent nad+ synthetase [Photorhabdus asymbiotica]
          Length = 540

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 237/556 (42%), Positives = 339/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN ++GDI GN  +  +  +E  +QG DL++F+EL +SGY PEDL+F+ 
Sbjct: 1   MSRTLNIALAQLNWMIGDIEGNCERMLQTVQEQQQQGADLVMFSELALSGYSPEDLLFRA 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C   +  L++ +      I+VG P +    + N++ +   G I+    K  LPNY
Sbjct: 61  DFHQRCREQLARLQAASDQ--VAILVGHPWEQDGEIYNALSLFWQGEILTRYFKQRLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G  +  + F+   LG+LICED+W +  I   L++ GA+ + S+NASPY 
Sbjct: 119 GVFDEKRYFKAGDQSCVVPFKGYNLGLLICEDLWFDEPI-DALQQAGADLILSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R+E++        LP++Y+NQVGGQDELIFDG S  F+   ++  ++  F+EQ 
Sbjct: 178 REKPYIRYELIREHCQRTDLPMVYLNQVGGQDELIFDGCSKVFNASGEITHRLAAFNEQ- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                    Q   +N +  +        L   +  Y A VLS+RDYV+KN F  V++GLS
Sbjct: 237 --------IQQCCFNELKIEPMVNPAPELPPLQQVYQALVLSVRDYVRKNGFQGVLLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDALGKE VQ +M+P++YTS  S+EDA   A  LG +++V+ I  + +
Sbjct: 289 GGIDSGLTLAIAVDALGKEYVQAVMMPFRYTSEMSIEDAKEQADMLGVEFNVVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F                 EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 349 AFMVQFEPMFVGTVKDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFN LKD+ KT VF+LA +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFNALKDVPKTLVFELAKYRNT---------VSPAIPQRVIDRPPSAELAPGQLDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S        +++E VR V  L+  +EYKRRQAPVG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVDELMAAGFDEEVVRKVIRLVDINEYKRRQAPVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 520 PRNFGKDRRYPITSGF 535


>gi|92112628|ref|YP_572556.1| NH(3)-dependent NAD(+) synthetase [Chromohalobacter salexigens DSM
           3043]
 gi|91795718|gb|ABE57857.1| NH(3)-dependent NAD(+) synthetase [Chromohalobacter salexigens DSM
           3043]
          Length = 543

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 238/558 (42%), Positives = 323/558 (57%), Gaps = 23/558 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEAN-RQGMDLILFTELFISGYPPEDLVFKK 60
           ++ L + +AQL+P+VGDI GN A+A  A  EA      D+++F ELF++GYPPEDL+F++
Sbjct: 1   MQDLTLVMAQLDPLVGDIPGNTAQAIEAVREARIEHRADVVVFPELFLTGYPPEDLLFRE 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S       A + +          +++G+P +    + N   +L  G  +    K  LPNY
Sbjct: 61  SMESRLEQAREQMARKVARD-VMVIIGYPGKRDGRLHNLAGVLYDGEWLGEYAKQALPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E+R F  G S   I  R  RLG+LICED+W    + + +   GA+ + +LNASPY+
Sbjct: 120 QVFDEQRYFAPGASPLVIEHRGARLGVLICEDLWDGGPVARSVDA-GADIVVTLNASPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K  +R  +   +   V  P++Y+NQVGGQDEL+FDG S   D   Q+A +   F E  
Sbjct: 179 RDKPLERERLFAERARAVTRPVVYLNQVGGQDELVFDGGSLVLDASGQVAVRAP-FWEVG 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            M     D     W   + +        L  EE+ Y A V  LRDYV KN F  V++GLS
Sbjct: 238 LMPVRFTDAS-GGWQPEAGECEPL----LSSEESLYCALVTGLRDYVNKNRFQGVVLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALG E VQ +M+PY YT+  S  DAAA A+ LG  Y+V+PI  +V 
Sbjct: 293 GGIDSALSLAIAVDALGPERVQAVMMPYHYTADISKADAAAQAELLGVHYEVMPIAPMVE 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   + +           EN+QSR RG +LMALSN    M+L+T NKSE++VGY TLYG
Sbjct: 353 AFTDTLRESFAGTERDTTEENLQSRCRGVLLMALSNKKGLMVLSTGNKSEMAVGYATLYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GG+N LKD+YKT V++LA WRN+             IP  ++ + PSAEL P Q D 
Sbjct: 413 DMVGGYNALKDVYKTWVYRLAKWRNAQ---------APAIPERVITRPPSAELAPDQADS 463

Query: 481 ESLPPYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           +SLP Y  LD I++R +E +   E+ I  D  +  E V  V  L+  SEYKRRQAPVG +
Sbjct: 464 DSLPAYDELDAILERYIEGDMSAEAII--DAGFASEDVYKVVKLVDRSEYKRRQAPVGVR 521

Query: 538 ITAKSFGRDRLYPISNKF 555
           +T + FGRDR YPI N +
Sbjct: 522 VTVRGFGRDRRYPIVNGW 539


>gi|294676904|ref|YP_003577519.1| NAD(+) synthase (glutamine-hydrolyzing) [Rhodobacter capsulatus SB
           1003]
 gi|547988|sp|Q03638|NADE_RHOCA RecName: Full=Glutamine-dependent NAD(+) synthetase; AltName:
           Full=NAD(+) synthase [glutamine-hydrolyzing]
 gi|45986|emb|CAA42042.1| NAD synthetase [Rhodobacter capsulatus]
 gi|294475724|gb|ADE85112.1| NAD(+) synthase (glutamine-hydrolyzing) [Rhodobacter capsulatus SB
           1003]
          Length = 552

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 238/562 (42%), Positives = 341/562 (60%), Gaps = 15/562 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I +AQLNP VG +A N  KA  A +     G DL+   E+F++GY  +DLV K 
Sbjct: 1   MTDRFRITLAQLNPTVGALAANAEKAMAAWQAGRAAGADLVALPEMFLTGYQTQDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++   +A+  L +   DG A + +G P  D+ G  N+  +L  G +IA   K +LP+ 
Sbjct: 61  AFLRDAMAAMAALAAQVVDGPA-LGIGGPYVDETGSYNAWWVLKDGRVIARALKHHLPHD 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F  G  +DP+    + LG+ +CED W + ++   L   GAE L   N SPY 
Sbjct: 120 DVFDEMRLFDQGPVSDPLRLGPVALGVPVCEDAW-HPDVAGALAAAGAEVLMVPNGSPYR 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R ++   +++   LP++Y+N VGGQD+ +FDGASF  +    +A Q+  F E  
Sbjct: 179 RGKLDLRRQVTGARVAETGLPLLYLNMVGGQDDQLFDGASFVLNPDGSVAVQLPAFEEAV 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              +   ++  + W  +  D    +  P  + E DY A VL L+DY++K+ F +V++GLS
Sbjct: 239 VHVD--LERGAADWRAVPAD----IVAPPGDIEQDYRAMVLGLQDYLRKSGFSRVVLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL A IA DALG  NV  +MLP +YTS  SL+DAA  A+ LG + D + I     
Sbjct: 293 GGIDSALVAVIAADALGAGNVHCVMLPSRYTSQGSLDDAADLARRLGARLDTVEIEGPRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++  L      +  ENIQSR+RG ILMA+SN   AMLLTT NKSE++VGY T+YG
Sbjct: 353 AVEGALAHVLAGTAPDVTEENIQSRLRGVILMAISNKFGAMLLTTGNKSEVAVGYCTIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NPLKDLYKT+VF+   WRN+        P  E+IP +I++K PSAELR +QTDQ
Sbjct: 413 DMAGGYNPLKDLYKTRVFETCRWRNATHRPWMQAPAGEIIPVAIIDKPPSAELRENQTDQ 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ----EYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           +SLPPY +LD I++R+VE ++S    DQ     ++  TV+ +EHLLY SE+KR Q+  G 
Sbjct: 473 DSLPPYEVLDAILERLVEGDQSV---DQIVAAGFDRATVKRIEHLLYISEWKRFQSAPGP 529

Query: 537 KITAKSFGRDRLYPISNKFRDH 558
           ++T ++F  DR YP+ N++RD 
Sbjct: 530 RLTTRAFWLDRRYPMVNRWRDQ 551


>gi|37527188|ref|NP_930532.1| NAD synthetase [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36786622|emb|CAE15684.1| NH(3)-dependent NAD+ synthetase [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 540

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 239/556 (42%), Positives = 339/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN ++GDI GN  +  +  +E  +Q  DL++F+EL ISGY PEDL+F+ 
Sbjct: 1   MSRTLNIALAQLNWMIGDIEGNCERMLQTVQEQQQQNADLVMFSELAISGYSPEDLLFRA 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C   +  L++ +      I+VG P +    + N++ +   G I+A   K  LPNY
Sbjct: 61  DFHQRCREQLARLQAASCQ--IAILVGHPWEQDGEIYNALSLFWQGEILARYFKQRLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G  +  + F+   LG+LICED+W +  I   LK+ GA+ + S+NASPY 
Sbjct: 119 GVFDEKRYFKAGDQSCVVPFKGYNLGLLICEDLWFDEPI-DALKQAGADLVLSINASPYS 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R+E++        LP+IY+NQVGGQDELIFDG S  F+   ++  ++  F+EQ 
Sbjct: 178 REKPYIRYELIREHCRRTELPMIYLNQVGGQDELIFDGCSKVFNASGEVTHRLAAFNEQ- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                    Q   +N +  +        L   +  Y A VLS+ DYV+KN F  V++GLS
Sbjct: 237 --------IQQCCFNELKIEPMVNPAPELPPLQQVYQALVLSVHDYVRKNGFQGVLLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDALGKE+VQ +M+P++YTS  S+EDA   A  LG +++V+ I  + +
Sbjct: 289 GGIDSGLTLAIAVDALGKEHVQAVMMPFRYTSEMSIEDAKKQADMLGVEFNVVSIEPVFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F +               EN+Q+R R  ILMA+SN    ++LTTSNKSE +VGY TLYG
Sbjct: 349 AFMAQFEPLFAGTAKDTTEENLQARCRAVILMAMSNKRHRLVLTTSNKSESAVGYSTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFN LKD+ KT VF LA +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFNALKDVPKTLVFALAKYRNT---------VSPAIPQRVIDRPPSAELAPGQLDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILDDI++  VE ++S        ++++ VR V  L+  +EYKRRQAPVG +IT
Sbjct: 460 DSLPPYDILDDILEGYVEQDKSVDGLVAAGFDEQIVRKVVRLVDINEYKRRQAPVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 520 LRNFGKDRRYPITSGF 535


>gi|89055837|ref|YP_511288.1| NAD synthetase [Jannaschia sp. CCS1]
 gi|88865386|gb|ABD56263.1| NH(3)-dependent NAD(+) synthetase [Jannaschia sp. CCS1]
          Length = 552

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 229/558 (41%), Positives = 333/558 (59%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    ++ +AQLNP +GD+ GN    R A  EA  +  D + F E+FI+GY   DLV K+
Sbjct: 1   MADTFRLTLAQLNPTLGDLGGNAKLVREAFAEAKAEDSDFLAFPEMFITGYQLLDLVMKQ 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F +     I  L ++ HDG A   +G P    +   N+  I + G I A   K +LPNY
Sbjct: 61  AFAEDVQRVIADLAAELHDGPA-FGIGGPMWGGDKPYNAYYICEGGKIAATILKHHLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R + S     P+    +R+G  ICED W   ++C+ L++ GAE L S N SPY+
Sbjct: 120 AVFDEVRYYHSADPQGPVNINGVRIGFPICEDAW-FEDVCETLEESGAEILISPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K++ R  +V  ++    LP+ Y+N +GGQD+ +FDG SF  +    LA QM  F  + 
Sbjct: 179 RGKMELRQSVVVSRVVETGLPMAYLNLLGGQDDQVFDGGSFVLNRGGALAVQMPQF--EA 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + +  + +    W  ++ D      +P +  EADY   V++L DY++K  F  V++GLS
Sbjct: 237 GLEQVDFARGDDGW--VAKDGVKAR-LP-EAYEADYRVMVMALGDYLRKTGFTSVVLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A IA DA+G ENV  +MLP ++TS  SL+DA   A  LGC+ D +PI     
Sbjct: 293 GGIDSAIVACIAADAIGPENVHCVMLPSRFTSEVSLDDARDVAARLGCRLDTIPITPARE 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++   +     +  ENIQSR+RG +LMALSN   +MLLTT NKSE++VGY T+YG
Sbjct: 353 AVTASLAPLFEGLEEDVTEENIQSRLRGVMLMALSNKFGSMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN       L P  E+IPP +++K P+AELR  Q D+
Sbjct: 413 DMAGGYNPIKDLYKTRVFETCRWRNREHRDWMLAPAGEIIPPRVIDKPPTAELREDQKDE 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY  LD +++ +++ + S        Y+ E VR +E L+Y SEYKR QA  G ++T
Sbjct: 473 DSLPPYAELDVMLEMLIDKDLSVAEVVAAGYDPEWVRKIERLIYLSEYKRFQAAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            K+F  DR YP++N++RD
Sbjct: 533 QKAFWLDRRYPVANRWRD 550


>gi|89070087|ref|ZP_01157417.1| NAD(+) synthase [Oceanicola granulosus HTCC2516]
 gi|89044308|gb|EAR50451.1| NAD(+) synthase [Oceanicola granulosus HTCC2516]
          Length = 552

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 236/559 (42%), Positives = 339/559 (60%), Gaps = 11/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M ++ ++ IAQ NP VGD+AGN A+AR A E     G  +++  E+F++GY  +DLV K 
Sbjct: 1   MSERFRLTIAQANPTVGDLAGNAARARAAWEAGRAAGAQMVVLPEMFLAGYQTQDLVQKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+  C   ++TL     DG A + +G P  +   + N   IL  G + A   K +LPNY
Sbjct: 61  AFVADCQRHLETLAEACADGPA-LGIGAPVIEGTALYNGYFILCNGRVHAAMRKFHLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E+R +  G  + P     +R+G  ICED W   ++ + + + GAE L   N SPY+
Sbjct: 120 TVFDEERLYEHGSFSGPYEVAGVRIGTPICEDAWY-PDVAETMVESGAEILVVPNGSPYF 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R   +  ++    +P++Y+N VG QD+ +FDGASF  +    LA ++  F E  
Sbjct: 179 REKFDVRLNRMVARVVENDVPLVYLNLVGAQDDQVFDGASFVLNRHGALALRLPAFEEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE-EADYNACVLSLRDYVQKNNFHKVIIGL 299
            +    + +  + W     + A     PL +  E DY+A VLSL DY++K  F KV++GL
Sbjct: 238 -VAHVDFARTDAGWRAEPGEIA-----PLPDSLEQDYHAMVLSLSDYMRKTGFGKVLLGL 291

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSA+ A +A DALG ENV+ +MLP +YTS  SLEDA A A  LGC+YD +PI  + 
Sbjct: 292 SGGIDSAIVATVAADALGPENVRCVMLPSEYTSETSLEDARAVAANLGCRYDFVPITRVR 351

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           +     ++   +     +  EN+QSRIRG +LMA SN    MLLTT NKSE++VGY T+Y
Sbjct: 352 DAVTETLAPLFEGLAEDLTEENVQSRIRGLLLMAQSNKFGEMLLTTGNKSEVAVGYATIY 411

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GG+NP+KDLYKT+VF L  WRN++       P  EVIP  +++K PSAELR  Q D
Sbjct: 412 GDMAGGYNPIKDLYKTRVFALCRWRNANHRPWMAAPAGEVIPVRVIDKPPSAELRADQKD 471

Query: 480 QESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           ++SLPPY +LD I+K +V+ + S  +     Y  ETV+ VE L+Y SEYKR Q+  GT++
Sbjct: 472 EDSLPPYDVLDGILKLLVDEDSSVADCVAAGYERETVKRVEQLIYISEYKRFQSAPGTRL 531

Query: 539 TAKSFGRDRLYPISNKFRD 557
           + ++F  DR YPI N++RD
Sbjct: 532 SMRAFWLDRRYPIVNRWRD 550


>gi|291614117|ref|YP_003524274.1| NAD+ synthetase [Sideroxydans lithotrophicus ES-1]
 gi|291584229|gb|ADE11887.1| NAD+ synthetase [Sideroxydans lithotrophicus ES-1]
          Length = 534

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 233/554 (42%), Positives = 327/554 (59%), Gaps = 23/554 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQ+N  VGD+AGN AK     + A +QG  ++L  EL + GYPPEDL+ +  F  
Sbjct: 1   MKIAIAQINCTVGDLAGNAAKIAEYAQRAKKQGAGILLTPELSLCGYPPEDLLLRDGFYH 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC +A+  L       G  ++VG PR+      NS  +L  G I+A  +K  LPN+S F 
Sbjct: 61  ACDTALRDLALQAQ--GITLIVGHPRKIDRHFYNSASVLRDGKIVATYNKHALPNHSVFD 118

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E+R F  G     I    +R GI IC D+W + +     K+ GA+ L  LNASPY+ NK 
Sbjct: 119 EERYFAHGNEPCLIELDGVRFGINICADVW-HEHAAIRAKEAGAQVLLVLNASPYHFNKQ 177

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R+E +  +I    L ++Y N VGGQDEL+FDGASF  D + +L  Q   F E   + E
Sbjct: 178 DTRYETIRERIVDTGLAVVYANMVGGQDELVFDGASFVMDNEGELTHQFPAFDELLGLVE 237

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           +  D +L      +          +++E + Y A  + +RDY+ KN F  V++GLSGGID
Sbjct: 238 FE-DGKLVPGKCEN---------VVKDEASIYRALCVGVRDYIGKNRFPGVLLGLSGGID 287

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL  A+AVDALG + V  +M+P  YT+  S++D+    + LG +Y+ L I         
Sbjct: 288 SALTLAVAVDALGADKVLAVMMPSPYTAQMSIDDSREMVRLLGVRYEELDILPTFTALQE 347

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S   +  P+    EN+Q+RIRGN+LMA+SN + +++LTT NKSE++VGY TLYGDM+G
Sbjct: 348 TLSPLFKGLPADTTEENLQARIRGNLLMAISNKTGSLVLTTGNKSEMTVGYATLYGDMAG 407

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF  LKD+ KT V++L++WRNS G          VIP  I+ + PSAEL+P QTDQ+SLP
Sbjct: 408 GFAVLKDVSKTWVYRLSNWRNSMG---------RVIPERIITRPPSAELKPDQTDQDSLP 458

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
            Y +LD I+   VE   +     D  Y    V  V  L+  +EYKRRQAPVG +IT + F
Sbjct: 459 LYDVLDAIMACYVEKNMNIAQIEDLGYASADVLRVVRLIRIAEYKRRQAPVGVRITDRGF 518

Query: 544 GRDRLYPISNKFRD 557
           G+D  YPI+ +++D
Sbjct: 519 GKDWRYPITVRYQD 532


>gi|152996972|ref|YP_001341807.1| NAD+ synthetase [Marinomonas sp. MWYL1]
 gi|150837896|gb|ABR71872.1| NAD+ synthetase [Marinomonas sp. MWYL1]
          Length = 545

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 236/563 (41%), Positives = 342/563 (60%), Gaps = 26/563 (4%)

Query: 5   LKIAIAQLNPVVGDIAGN----IAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           L+IA+AQL+ +VGDI  N    I  A +AR+E   +  D+++F EL ++GYPPEDL+ + 
Sbjct: 3   LRIAMAQLDMLVGDITKNTQSVIDAANKARDE---ERADVVVFPELTLTGYPPEDLLLRS 59

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S      SA+  L ++ HD    +VVG+PR+    + N   ++  G ++    K  LPN+
Sbjct: 60  SLDTRIESALAKLLAEVHD--IYVVVGYPRRIDGELFNCAGVIYQGQLLVEYAKQKLPNF 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F +KR F  G     +  + +++G+ ICEDIW    I +  K  GAE + +LNASPY+
Sbjct: 118 LVFDDKRYFSEGREAGLVDIKGVKVGLSICEDIWHPGPIAQA-KAAGAELILNLNASPYH 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K+ +R E++  + + V LPI+YVN +G QDEL+++G SF  + + +   Q   F    
Sbjct: 177 IEKMGEREELLHQRATEVTLPIVYVNYMGAQDELVYEGGSFVVNAKGEKIMQAPWFEAGL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           +  +   D   SQ N + +  A ++   L  E + Y A VL LRDY+ KN F  +++GLS
Sbjct: 237 YSIDMIVDD--SQPNKV-EPVAGSIAPALGVEASVYQAMVLGLRDYITKNRFKGIVLGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  A+AVDA+G + VQ +M+PY YTS  SL DA   A  LG KY VLPI  +V+
Sbjct: 294 GGIDSALSLAVAVDAIGADRVQAVMMPYTYTSSISLHDAEEEANLLGVKYSVLPIETMVS 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F  +++   +        EN+Q+R RG  LMA+SN    M+LTT NKSE++VGY TLYG
Sbjct: 354 AFTDVLAPEFEGYGKDTTEENLQARTRGVTLMAISNKKGYMVLTTGNKSEMAVGYATLYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GG++ LKD++KT VF+L  +RN+ G          VIP  ++ + PSAEL P Q D+
Sbjct: 414 DMVGGYSVLKDVFKTLVFKLCRYRNTLGY---------VIPERVITRPPSAELAPDQKDE 464

Query: 481 ESLPPYPILDDIIKRIVENEES--FINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           +SLP Y ILD+I++  +E ++S   I    +++ ETV  V  L+  +EYKRRQAP G +I
Sbjct: 465 DSLPSYDILDEILRMYIEEDQSAEAILATNQFDRETVYRVLRLVDVNEYKRRQAPTGVRI 524

Query: 539 TAKSFGRDRLYPISNKFRDHISE 561
           TA+ FGRDR YPI+N +  HI E
Sbjct: 525 TARGFGRDRRYPITNGW--HIGE 545


>gi|307543917|ref|YP_003896396.1| NAD+ synthetase [Halomonas elongata DSM 2581]
 gi|307215941|emb|CBV41211.1| NAD+ synthetase [Halomonas elongata DSM 2581]
          Length = 557

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 235/566 (41%), Positives = 331/566 (58%), Gaps = 36/566 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKA-RRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           ++ L + +AQL+P+VGDI GN  +A    RE     G D+++  ELF++GYPPEDL+ + 
Sbjct: 14  MQDLTLVMAQLDPLVGDIPGNTERAIETVREARIEHGADVVVLPELFLTGYPPEDLLLRP 73

Query: 61  S----FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKIN 116
           S      QA +   + +  D       ++VG+P + +    N   +L  G  +    K  
Sbjct: 74  SMETRLRQARARMAEKMARDVM-----VIVGYPGRREGANWNLAGVLYNGEWLGEYAKQA 128

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LPNY  F E+R F  G S   I  +  +LG+LICED+W+   + +  ++ GA+ L +LNA
Sbjct: 129 LPNYEVFDEQRYFAVGESPLVIEHKGAKLGVLICEDVWEEGPV-QQAREAGADILVTLNA 187

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SP++ +K  +R  ++  +   V LPI+YVNQ+GGQDEL+FDG S C D   +L  Q  H+
Sbjct: 188 SPFHQDKPAERLALLEQRAREVGLPIVYVNQIGGQDELVFDGGSACVDADGELRVQAPHW 247

Query: 237 SEQNFMTEWHYDQQLSQWNYMS---DDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFH 293
           +      ++  D+Q   W   +   D+ AS        EE  Y A V  LRDYV K+ F 
Sbjct: 248 AVGLMPVQFVRDEQ-GAWVPSAGEVDEEASA-------EENLYCALVTGLRDYVNKSGFK 299

Query: 294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVL 353
            V++GLSGGIDSAL  AIAVDALG + V  +M+PY YT+  S EDAA  A+ LG  Y+VL
Sbjct: 300 GVVLGLSGGIDSALSLAIAVDALGPQRVHAVMMPYHYTADISKEDAAEQARMLGVDYEVL 359

Query: 354 PIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISV 413
           PI  +V  F   ++            EN+QSR RG +LMA+SN    M+L+T NKSE++V
Sbjct: 360 PIESMVEAFMDTLADSFAGTERDTTEENLQSRCRGVLLMAISNKKGLMVLSTGNKSEMAV 419

Query: 414 GYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAEL 473
           GY TLYGDM GG+N +KD+YKT V++LA WRN+             IP  ++E+ PSAEL
Sbjct: 420 GYATLYGDMVGGYNAIKDVYKTWVYRLARWRNTQ---------DPAIPERVIERPPSAEL 470

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRR 530
            P Q D +SLP Y  LD I+ R +E +   E+ I    +++D  V  V  L+   EYKRR
Sbjct: 471 APDQQDTDSLPDYDTLDAILVRYIEGDMSAEAIIEAGFDHDD--VYKVVRLVDRCEYKRR 528

Query: 531 QAPVGTKITAKSFGRDRLYPISNKFR 556
           QAPVG ++T + FGRDR YPI N ++
Sbjct: 529 QAPVGVRVTRRGFGRDRRYPIVNGWQ 554


>gi|53804666|ref|YP_113448.1| NAD(+) synthetase [Methylococcus capsulatus str. Bath]
 gi|53758427|gb|AAU92718.1| NAD(+) synthetase [Methylococcus capsulatus str. Bath]
          Length = 539

 Score =  425 bits (1093), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 237/558 (42%), Positives = 334/558 (59%), Gaps = 30/558 (5%)

Query: 5   LKIAIAQLNPVVGDIAGN----IAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           L+IAIAQL+ +VGD+ GN    +A A RAR+E    G   ++F EL ++GYPP+DL+ + 
Sbjct: 3   LRIAIAQLDFLVGDVGGNADRVLAAAVRARDE---LGAHAVVFPELALAGYPPDDLILRP 59

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F+ A  +A+  L       G  ++VGFP +      NS  +L  G I  V  K  LPNY
Sbjct: 60  DFLTAVETALKVLAERVR--GIDVIVGFPERHDGLPFNSAAVLRDGGIHKVYRKQILPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
             F EKR F+ G +  P VF  R + +G+ ICED+W    + +     GA  + +LNASP
Sbjct: 118 GVFDEKRHFLPGSA--PCVFDLRGVPVGLTICEDVWFPGPV-EQAAAAGARLVLNLNASP 174

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           ++  K  +R  +V  +I+   +P++Y N VGGQDEL+FDG SF  D    L ++   F E
Sbjct: 175 FHVGKSVEREHVVRERIAAARVPLVYTNLVGGQDELVFDGGSFVMDAAGGLVYRAPQFGE 234

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
                 +  D+     N +S    + +  P+ E E+ Y A V  +RDYV KN F   ++G
Sbjct: 235 TLDAVGFTVDED--GVNPLS----ARLVEPMGEVESVYAALVTGIRDYVGKNGFRGAVLG 288

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL  A+AVDALG + V+ +++P +YT+  S+EDA   A+ L   + ++PI  +
Sbjct: 289 LSGGIDSALTLALAVDALGADRVEAVLMPSRYTADISIEDARQEAETLAVAWHLIPIEPV 348

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
              F  L++      P+ +  ENIQ+R RG ILMALSN    +LLTT NKSE+SVGY TL
Sbjct: 349 FRSFLDLLAGPFAGAPADVTEENIQARCRGVILMALSNKQGRILLTTGNKSEMSVGYATL 408

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGF PLKD+ K  V++LA +RN+         ++ VIPP ++E+ PSAELRP Q 
Sbjct: 409 YGDMAGGFAPLKDVSKLLVYRLAEYRNA---------VSAVIPPRVIERPPSAELRPDQK 459

Query: 479 DQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           D++SLPPY +LD I+   VE + S        Y ++ VR V  L+  +EYKRRQAP G K
Sbjct: 460 DEDSLPPYAVLDPILALYVEQDRSIAEIVAAGYPEDVVRRVVRLVDRNEYKRRQAPPGIK 519

Query: 538 ITAKSFGRDRLYPISNKF 555
           IT ++FGR+R YPI+  F
Sbjct: 520 ITRRAFGRERRYPITCGF 537


>gi|183599762|ref|ZP_02961255.1| hypothetical protein PROSTU_03267 [Providencia stuartii ATCC 25827]
 gi|188022023|gb|EDU60063.1| hypothetical protein PROSTU_03267 [Providencia stuartii ATCC 25827]
          Length = 540

 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 231/556 (41%), Positives = 335/556 (60%), Gaps = 23/556 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL I++AQLN +VGDI GN  +  +  EE  +   D+++F+EL ++GYPPEDL+F+ 
Sbjct: 1   MSRKLNISLAQLNWLVGDIEGNCERMLQVFEE-QKNIADIVVFSELSLTGYPPEDLLFRA 59

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q     ++ L++ + +    IVVG P  +   + N++     G ++    K  LPNY
Sbjct: 60  DFTQRYLVQLERLQNASTE--TAIVVGHPWTEAGKMYNALSFFYQGKLLTRYFKQELPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F +G     + F+  R+G+LICEDIW +  +   +K+ GAE L ++NASPY 
Sbjct: 118 GVFDELRYFSAGDKTGVVDFKGYRIGLLICEDIWFDGPV-DAVKQAGAELLLTINASPYD 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK   R +++        LPIIY+NQVGGQDELIFDG S       ++  Q+  F EQ 
Sbjct: 177 RNKDHSRSDLLVRHCQRTQLPIIYLNQVGGQDELIFDGGSKVLASDGKITHQLVDFDEQI 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                       Q+N +S      +   L      Y   V++ RDY+ KN F+  I+GLS
Sbjct: 237 VNC---------QFNELSAVPMEKLAPALSPVAQVYQGLVMATRDYINKNGFNGAILGLS 287

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDA+GKE VQ +M+P++YTS  S+ DA   A+ LG ++D++ I  + +
Sbjct: 288 GGIDSGLTVAIAVDAIGKERVQAVMMPFRYTSEMSIHDAKEQAELLGVEFDIVSIEPMFD 347

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F S +    +        EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 348 AFMSQLQPMFEGTAVDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 407

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 408 DMAGGFDVLKDVPKTLVFELAKYRNT---------ISPAIPQRVIDRPPSAELAPGQLDQ 458

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD +++  VE + S     +Q +++ TV  V  L+  +EYKRRQAPVG +IT
Sbjct: 459 DSLPPYDILDALLEAYVEKDYSVAQLIEQGFDEATVHRVVRLVDINEYKRRQAPVGPRIT 518

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 519 VRNFGKDRRYPITSGF 534


>gi|159043154|ref|YP_001531948.1| NAD synthetase [Dinoroseobacter shibae DFL 12]
 gi|157910914|gb|ABV92347.1| glutamine-dependent NAD(+) synthetase [Dinoroseobacter shibae DFL
           12]
          Length = 557

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 238/559 (42%), Positives = 338/559 (60%), Gaps = 11/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    ++ + QLNP +G ++ N  KA RA +E    G   +   E+F++GY  +DLV + 
Sbjct: 1   MSDTFRLTLGQLNPTLGALSENAQKALRAWQEGKLAGAQFVALPEMFLTGYQTQDLVMRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F       +  L  D  DG A + +G P      + NS  IL+ G + A   K +LPN 
Sbjct: 61  AFAADAERVLQGLARDCADGPA-LGIGCPLVQGGKLYNSYAILEGGAVKARVLKHHLPNS 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E+R F +G  + P     +R+G  ICED W   ++ + L +  AE LF  N SPY+
Sbjct: 120 DVFDEERLFTAGPVSGPYRIGPLRIGTPICEDAWY-PDVAETLAESAAEILFVPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++  ++    LP+IY+N VGGQD+ +FDGASF  +    LA Q+    E  
Sbjct: 179 RGKHDTRLNLMVARVIETGLPLIYLNMVGGQDDQMFDGASFALNTHGALAMQLPAMEE-- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE-EADYNACVLSLRDYVQKNNFHKVIIGL 299
                H D   +   +  +D+      PL +E EADY   V SLRDY++K+ F KV++GL
Sbjct: 237 --VIAHLDLTQTAEGWRIEDARKD---PLPDEWEADYRVMVESLRDYLRKSGFGKVLLGL 291

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSA+ AAIA DA+G +NV+ +MLP +YTS +SLEDA A A+ LGC+ D LPI    
Sbjct: 292 SGGIDSAIVAAIAADAIGPQNVRCVMLPSEYTSQESLEDAEAVARNLGCRIDTLPITGPR 351

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
                +++ F    PSGI  EN+QSR+RG +LMALSN    MLLTT NKSE++VGY T+Y
Sbjct: 352 AAVTEVLAPFFNGTPSGIAEENVQSRLRGVLLMALSNKFGEMLLTTGNKSEVAVGYATIY 411

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GG+NP+KDLYKT+VF+   WRN       LGP  E+IP  ++EK PSAELR  Q D
Sbjct: 412 GDMAGGYNPIKDLYKTRVFETCRWRNETHRPWMLGPEGELIPDRVIEKPPSAELRADQKD 471

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           ++SLPPY +LD I++ +++ E S      + ++ +TV+ +EHL++ SEYKR Q+  G ++
Sbjct: 472 EDSLPPYGVLDAILEGLIDREASVAELVADGFDLDTVKKIEHLIFISEYKRFQSAPGARL 531

Query: 539 TAKSFGRDRLYPISNKFRD 557
           T ++F  DR YPI N++RD
Sbjct: 532 TKRAFWLDRRYPIVNRWRD 550


>gi|93005127|ref|YP_579564.1| NAD+ synthetase [Psychrobacter cryohalolentis K5]
 gi|92392805|gb|ABE74080.1| NAD+ synthetase [Psychrobacter cryohalolentis K5]
          Length = 567

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 238/559 (42%), Positives = 329/559 (58%), Gaps = 33/559 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +  A+AQ + +VGDI  N  K R    +A  QG D+I+F EL + GYPP+DL+ + S   
Sbjct: 30  VTFALAQSHFLVGDIKANAEKMRTLALQAREQGADVIIFPELALLGYPPQDLLLRPSLSG 89

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
              SA+ TL SD  D    ++VG+P  D  G  NS  IL  G+      K  LPNY  F 
Sbjct: 90  RIKSALSTL-SDIDD--IVMIVGYPHVDHHGTFNSAAILHNGHQKGFYHKQILPNYGVFD 146

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E+R F  G +     ++ I +G+LICED+W+   I + LKKQGA+ + SLNASP+   K 
Sbjct: 147 ERRYFDKGRNQVLFDYKGITIGLLICEDLWEKGPIAE-LKKQGADLIVSLNASPFEIEKQ 205

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R  ++  +    +LPI+Y+N VGGQD+L+FDG S        +A +   F  Q  +  
Sbjct: 206 DTRKTMLAKRSRENNLPIVYLNAVGGQDDLVFDGGSMAIQADGSVAHEASRFMNQLLLAS 265

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
             +D + +++     D+ +   + L  E   Y A V+ LRDYV  + F  +I+GLSGGID
Sbjct: 266 --FDAKTAKF-----DTQAKAPLSLSRESEMYQALVVGLRDYVNLSGFTGIIVGLSGGID 318

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL   IAVDALG + V  +M+PY+YTS  SLEDA A A+ L   Y V PI D V     
Sbjct: 319 SALTLCIAVDALGADKVYAVMMPYEYTSQISLEDAQAQARRLNVSYTVCPIFDAVEGIRH 378

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++    + P+    ENIQ+R RG +LMALSN    +++TT NKSE++VGY TLYGDM+G
Sbjct: 379 TLAPLFNKSPADTTEENIQARARGVVLMALSNKFGHLVITTGNKSELAVGYSTLYGDMAG 438

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF+ LKD+YK+QV++LAS+RN           T VIP  ++ + PSAELRP Q DQ+SLP
Sbjct: 439 GFDVLKDVYKSQVYKLASYRNRL-------EDTPVIPERVITRPPSAELRPDQKDQDSLP 491

Query: 485 PYPILDDIIKRIVENEESFINNDQEYND--------ETVRYVEHLLYGSEYKRRQAPVGT 536
            Y +LD I+        S+I+ D  Y D        + V  V  ++  SEYKR QAP+GT
Sbjct: 492 DYDVLDGILM-------SYIDEDMGYQDIINKGFDADLVAKVIQMVDNSEYKRSQAPIGT 544

Query: 537 KITAKSFGRDRLYPISNKF 555
           KI+ K+FGR+R YP+ NK+
Sbjct: 545 KISHKAFGRERRYPLVNKW 563


>gi|217970173|ref|YP_002355407.1| NAD synthetase [Thauera sp. MZ1T]
 gi|217507500|gb|ACK54511.1| NAD+ synthetase [Thauera sp. MZ1T]
          Length = 542

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 228/556 (41%), Positives = 334/556 (60%), Gaps = 25/556 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           + IA+AQLN  VGD+ GN      A ++A   G  L+L  EL +SGYPPEDL+ +  F +
Sbjct: 9   VSIAVAQLNLTVGDLVGNADHIIAALDDARAAGAQLLLTPELALSGYPPEDLLLRPDFYR 68

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC+  ++ + +     G  +V+G P +D     N+  +L  G ++    K  LPNY  F 
Sbjct: 69  ACAREVERIAAAAR--GVTVVLGHPVEDGGERYNAASVLRDGAVLTRYHKSLLPNYEVFD 126

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E+R F +G +        +R G+ IC D+W+            A+ L +LNASPY+ NK 
Sbjct: 127 EERYFEAGGTACVFECAGVRFGVNICADVWERGPAEAARAAG-AQVLLALNASPYHMNKQ 185

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +R E++  +++   LP++Y N VGGQDEL+FDGASF  D    +  Q+  F E+     
Sbjct: 186 AQRLEVLRARVAETGLPVLYCNMVGGQDELVFDGASFALDAGGAVGLQLGSFVER----- 240

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGLSGGI 303
                 ++  +Y S   +   ++P +  EA+ Y A  + +RDY+ KN F   IIGLSGGI
Sbjct: 241 ------VAIVDYASGGWSGGEHVPARTLEAEVYEALRIGVRDYLAKNRFPGAIIGLSGGI 294

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL  AIAVDALG + V+ +M+P  YT+  SL+D+      LG +YD + I   +  F 
Sbjct: 295 DSALTLAIAVDALGADKVRAVMMPSPYTAQMSLDDSRDMVARLGVRYDEIAIEPAMKVFA 354

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
            L++      P+    EN+Q+RIRG +LMALSN + A++LTT NKSE++ GY TLYGDM+
Sbjct: 355 ELLADQFAGLPADTTEENLQARIRGMLLMALSNKTGAIVLTTGNKSEMATGYATLYGDMA 414

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF  LKDLYKT VF+L++WRN+         ++ VIP +I+++ PSAEL+P Q DQ+SL
Sbjct: 415 GGFAVLKDLYKTFVFRLSNWRNT---------VSPVIPQNIIDRPPSAELKPDQKDQDSL 465

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           PPY +LD II+  +E +ES  +     + +  VR V  +L  +EYKRRQAPVG ++T + 
Sbjct: 466 PPYDMLDAIIQAYMERDESPRDIVAAGFPEGEVRRVVGMLKRNEYKRRQAPVGIRVTQRG 525

Query: 543 FGRDRLYPISNKFRDH 558
           FGRD  YPI+++++D 
Sbjct: 526 FGRDWRYPITSRYQDE 541


>gi|94501751|ref|ZP_01308265.1| NAD synthase [Oceanobacter sp. RED65]
 gi|94426151|gb|EAT11145.1| NAD synthase [Oceanobacter sp. RED65]
          Length = 543

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 227/562 (40%), Positives = 340/562 (60%), Gaps = 27/562 (4%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           + L + +AQLN VVGDI  N  K   + +++  +G+D+++F EL ++GYPPEDL+ + S 
Sbjct: 4   QSLSVCLAQLNLVVGDIQSNTQKVLASAKQSVEKGVDVVIFPELTLTGYPPEDLLLRPSL 63

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
                 A+  ++         +V+G+P+    G+ N   +++ G ++A   K +LPN+  
Sbjct: 64  KLRVEQALQEIEEAALP--ITLVIGYPKVTASGLQNMAGVIENGRLVAEYAKQHLPNFQV 121

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR FI G     +  + + + I ICEDIW+   I    K+ GA+ + +LNASP++ +
Sbjct: 122 FDEKRYFIEGTQPCVVQIKGLPVAISICEDIWQK-GIMTQAKQAGAKLMLNLNASPFHID 180

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K   R  ++  +     +PI+YVN VGGQDEL+FDG S   D Q  +  +   + E   +
Sbjct: 181 KPLHREALLKERALEGAMPIVYVNLVGGQDELVFDGGSVVVDQQGNVKSRAITYDEAQPV 240

Query: 243 TEWHYDQQLSQWNYMSDDSASTM---YIPLQEE-EADYNACVLSLRDYVQKNNFHKVIIG 298
            E   D          D + S++     P +E+ ++ Y+A VL  +DYV KN F  V++G
Sbjct: 241 VELAID----------DGAVSSIDGKTEPHREKLDSIYSALVLGTKDYVNKNGFKGVVLG 290

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL  A+AVDALGKE VQ IM+P+KYTS  SL DA   A  LG +Y V+PI  +
Sbjct: 291 LSGGIDSALTLAVAVDALGKERVQAIMMPFKYTSQMSLHDAEDEANRLGVEYKVMPIEPM 350

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
            + F   ++   +        EN+QSR RG +LMA+SN   +++LTT NKSE++VGY TL
Sbjct: 351 FDAFMGTLADEFEGTKVDTTEENLQSRCRGVLLMAMSNKKGSLVLTTGNKSEMAVGYATL 410

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GG+  LKD++KT VF+L+ +RN+ G         EVIPP ++ + PSAEL P Q 
Sbjct: 411 YGDMAGGYGVLKDVFKTLVFELSKYRNTLG---------EVIPPRVISRPPSAELAPDQV 461

Query: 479 DQESLPPYPILDDIIKRIVENEESF-INNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           D++SLP YP+LD+I++  +E ++S      + + ++ V  V  L+  +EYKRRQAPVG +
Sbjct: 462 DEDSLPAYPVLDEILRLYIEEDQSAQAIIAKGFKEDEVNRVIRLVDINEYKRRQAPVGVR 521

Query: 538 ITAKSFGRDRLYPISNKFRDHI 559
           +T + FGRDR YPI+N +R  I
Sbjct: 522 LTQRGFGRDRRYPITNGWRAGI 543


>gi|71064847|ref|YP_263574.1| putative NH3-dependent (glutamine-hydrolyzing) NAD(+) synthetase
           [Psychrobacter arcticus 273-4]
 gi|71037832|gb|AAZ18140.1| putative NH3-dependent (glutamine-hydrolyzing) NAD(+) synthetase
           [Psychrobacter arcticus 273-4]
          Length = 567

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 235/552 (42%), Positives = 330/552 (59%), Gaps = 19/552 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +  A+AQ + +VGDI  N  K R    +A  QG D+I+F EL + GYPP+DL+ + S   
Sbjct: 30  VTFALAQSHFLVGDIKANAEKMRTLALQAREQGADVIIFPELALLGYPPQDLLLRPSLSG 89

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
              SA+ TL SD  D    ++VG+P  D  G  NS  IL  G+      K  LPNY  F 
Sbjct: 90  RIKSALSTL-SDIDD--IVMIVGYPHVDHHGTFNSAAILHNGHQKGFYHKQILPNYGVFD 146

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E+R F  G +     ++ I +G+LICED+W    I + LKKQGA+ + SLNASP+   K 
Sbjct: 147 ERRYFDKGRNQVLFDYKGITIGLLICEDLWGKGPIAE-LKKQGADLIVSLNASPFEIEKQ 205

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R  ++T +    +LPI+Y+N VGGQD+L+FDG S        +A +   F  Q  +  
Sbjct: 206 DARKTMLTKRSRENNLPIVYLNAVGGQDDLVFDGGSMAIQADGSVAHEASRFMNQLLLAS 265

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
             +D + +++     D  +   + L  E   Y A V+ LRDYV  + F  +I+GLSGGID
Sbjct: 266 --FDVKTAKF-----DIQAKAPLSLSRESEMYQALVVGLRDYVNLSGFTGIIVGLSGGID 318

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL   IAVDALG + V  +M+PY+YTS  SLEDA A A+ L   Y V PI D V     
Sbjct: 319 SALTLCIAVDALGADKVYAVMMPYEYTSQISLEDAQAQARRLNVSYTVCPIFDAVEGIRH 378

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++    + P+    ENIQ+R RG +LMALSN    +++TT NKSE++VGY TLYGDM+G
Sbjct: 379 TLAPLFNKSPADTTEENIQARARGVVLMALSNKFGHLVITTGNKSELAVGYSTLYGDMAG 438

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF+ LKD+YK+QV++LAS+RN           T VIP  ++ + PSAELRP Q DQ+SLP
Sbjct: 439 GFDVLKDVYKSQVYKLASYRNRL-------EDTPVIPERVITRPPSAELRPDQKDQDSLP 491

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
            Y +LD I+   ++ +  + +  D+ ++ + V  V  ++  SEYKR QAP+GTKI+ K+F
Sbjct: 492 DYDVLDGILMSYIDEDMGYQDIVDKGFDADLVAKVIQMVDNSEYKRSQAPIGTKISHKAF 551

Query: 544 GRDRLYPISNKF 555
           GR+R YP+ NK+
Sbjct: 552 GRERRYPLVNKW 563


>gi|297172743|gb|ADI23709.1| NAD synthase [uncultured Oceanospirillales bacterium HF4000_21D01]
          Length = 556

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 244/570 (42%), Positives = 342/570 (60%), Gaps = 33/570 (5%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFK 59
           M ++L++ +AQLN +VGDI GN +   +  E A  +   DLI+F EL ++ YPPEDL+ +
Sbjct: 1   MARQLRVVMAQLNLMVGDIEGNTSLVLKNAERAISEFAADLIVFPELTLTAYPPEDLLLR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
            S       AID +     D    IV+GFP      + N++ +L+ GN +A   K  LPN
Sbjct: 61  PSLKLRIDRAIDAILQ--ADLPIHIVLGFPESIDGKLFNALTVLEGGNRLATYHKQCLPN 118

Query: 120 YSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           Y  F E+R F +G  + P V +   IRLG  ICED+W+     K     GA+ + ++NAS
Sbjct: 119 YQVFDERRYFHAG--DKPCVLQIAGIRLGFTICEDMWEQDPF-KQAGDAGADLMININAS 175

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY+ +KL++R  ++  +      PIIYVN VGGQDEL+FDGAS       +      H+ 
Sbjct: 176 PYHIHKLEQRQALLKQRSIEGGFPIIYVNLVGGQDELVFDGASMAMSASGEC-----HYL 230

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDS----ASTMYIPLQEEEAD-------YNACVLSLRDY 286
             NF  + H    L   + ++ DS    A    IP Q   A+       Y+A VL +RDY
Sbjct: 231 APNFEADLH----LVNVDILNSDSQEFAAKRCEIPRQSLAAEQSSIASVYHALVLGVRDY 286

Query: 287 VQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKAL 346
           V KN F   ++GLSGGIDSAL  AIAVDALGK+ VQ +M+P++YTS  SL+ AA  A++L
Sbjct: 287 VNKNKFVGTVLGLSGGIDSALTLAIAVDALGKDRVQAVMMPFEYTSKLSLDSAAEQAQSL 346

Query: 347 GCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTS 406
             +Y V+PI  +   F   +       P  +  +NIQ+R RG ILMA+SN  + M+LTT 
Sbjct: 347 AVEYQVIPIRHIYAAFIEALEHEFAGMPVDVSEQNIQARCRGVILMAISNKKQLMVLTTG 406

Query: 407 NKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILE 466
           NKSE +VGY TLYGDM+GGF+ LKD+ KT V+QLA++RN+   + G      VIP  +++
Sbjct: 407 NKSECAVGYSTLYGDMAGGFDVLKDVSKTLVYQLAAYRNTEYGSQG----EAVIPQQVID 462

Query: 467 KSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGS 525
           + PSAEL P+Q DQ+SLPPY  LD I++  +EN+ S      E Y +E V+ V  L+  +
Sbjct: 463 RPPSAELAPNQLDQDSLPPYDDLDRILELYIENDYSADAIVAEGYAEEVVKKVLRLVDLN 522

Query: 526 EYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           EYKRRQ+PVG ++T + FGRDR YPI+N +
Sbjct: 523 EYKRRQSPVGVRLTPRGFGRDRRYPITNAW 552


>gi|161829967|ref|YP_001596848.1| NAD+ synthetase [Coxiella burnetii RSA 331]
 gi|161761834|gb|ABX77476.1| NAD+ synthetase [Coxiella burnetii RSA 331]
          Length = 542

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 233/559 (41%), Positives = 331/559 (59%), Gaps = 26/559 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGN----IAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           +KKL I  AQLN +VGDI GN    I  A +A +E+     DLILF EL I+ YPPEDL+
Sbjct: 1   MKKLVIVGAQLNFLVGDIEGNTQLIIDAANQAYQESK---ADLILFPELSITSYPPEDLL 57

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
           F+ +  +    A+ T+     +    +VVG+P        N   ++  G I+A   K  L
Sbjct: 58  FRPALYRRVHQALQTIADKVKN--TTVVVGYPDFIDNKCYNKAAVITDGKIVATYAKHEL 115

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           PNY  F EKR F +G     I  + +++GILICED+W  + I K     GA+ +  +NAS
Sbjct: 116 PNYRVFDEKRYFAAGDQPCVIEIKGVKIGILICEDLWLENPI-KQSVAAGAQLIACINAS 174

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           P+  +K   R +++T +    H+PI+Y+N VGGQDEL+FDG S  F+   +L  Q  +  
Sbjct: 175 PFAQDKSHHRRDLLTKRTKRYHIPIVYLNLVGGQDELVFDGGSLVFNQHGELIQQGSYLK 234

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           E+    E+  D  L+               PL EE+  YN  VL +RDY+ KNNF   +I
Sbjct: 235 EELITVEFDIDDNLTILTKTPLPPE-----PLDEEKI-YNVLVLGVRDYINKNNFPGAVI 288

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGG+DSAL  AIAVDA+G E V  +++P  +TS  S+EDA   AKAL  +   + I  
Sbjct: 289 GLSGGVDSALTLAIAVDAIGSERVSGVLMPSPFTSTMSIEDAEGGAKALNVRTSTINIQP 348

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           +   F   +          +  EN+Q+RIRG +LMA+SN   A++LTT NKSE++VGY T
Sbjct: 349 IFEAFIRSLESEFTGLGKDVTEENLQARIRGTLLMAISNKKDAIVLTTGNKSEMAVGYAT 408

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGF  LKD+YKT V++L  +RN+         ++ VIP  +LE+ PSAEL P Q
Sbjct: 409 LYGDMAGGFGVLKDVYKTMVYRLCRYRNT---------ISRVIPERVLERPPSAELAPDQ 459

Query: 478 TDQESLPPYPILDDIIKR-IVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            DQ+ LPPY ILD+I++R I ++E+        ++ E V+ V  ++  +EYKRRQAP+G 
Sbjct: 460 KDQDVLPPYHILDEILERYIAKDEDPTAIAAGGFDVEMVKKVVRMINRNEYKRRQAPIGI 519

Query: 537 KITAKSFGRDRLYPISNKF 555
           +IT ++FG+DR YPI++ F
Sbjct: 520 RITERAFGKDRRYPITSGF 538


>gi|268593219|ref|ZP_06127440.1| NAD(+) synthase [Providencia rettgeri DSM 1131]
 gi|291311267|gb|EFE51720.1| NAD(+) synthase [Providencia rettgeri DSM 1131]
          Length = 540

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 227/557 (40%), Positives = 340/557 (61%), Gaps = 25/557 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL I++AQLN +VGDI GN  +  +   E      D+++F+EL ++GYPPEDL+F+ 
Sbjct: 1   MSRKLNISLAQLNWLVGDIEGNCDRMLQVVSE-QAPNTDIVMFSELSLTGYPPEDLIFRA 59

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F   C   +D L+  + +    I+VG P  + + + N++     G + A   K  LPNY
Sbjct: 60  DFEDRCLVQLDRLQKASQE--TAIIVGHPWYEGDDIYNALSFFYQGKLHARYFKQELPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F +      + F+  +LG+LICEDIW +  +   +K  GAE L ++NASPY 
Sbjct: 118 GVFDEPRYFTADEKTCVVEFKGYQLGLLICEDIWYDEPV-DAVKGAGAEILLTINASPYD 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK   R +++       H+PI+Y+NQVGGQDEL+FDG S     + +  F+++ F EQ 
Sbjct: 177 INKEHIRTDLLVDHCKRTHMPIVYLNQVGGQDELVFDGGSKIIANKGKQTFKLEEFKEQV 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                       Q++ ++  S  +++I        Y A V+S RDY+ KN F+  I+GLS
Sbjct: 237 ITV---------QFDELALVSEGSVFIENDPVAQVYQALVMSTRDYINKNGFNGAILGLS 287

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDA+GKE+VQ +M+P++YTS  S+ DA   A  LG ++D++ I  + +
Sbjct: 288 GGIDSGLTVAIAVDAIGKEHVQAVMMPFRYTSEMSIHDAKEQADLLGVEFDIVSIEPMFD 347

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + ++   +        EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 348 AFMAQLTPMFEGTAVDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 407

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 408 DMAGGFDVLKDVPKTLVFELAKYRNT---------ISPAIPQRVIDRPPSAELAPGQLDQ 458

Query: 481 ESLPPYPILDDIIKRIVENEESFINN--DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           +SLPPY +LD +++  VE + S +N+     ++ + VR V  L+  +EYKRRQAPVG +I
Sbjct: 459 DSLPPYDVLDALLEGYVEKDLS-VNDLIKLGFDKDVVRKVVRLVDINEYKRRQAPVGPRI 517

Query: 539 TAKSFGRDRLYPISNKF 555
           T ++FG+DR YPI++ F
Sbjct: 518 TMRNFGKDRRYPITSGF 534


>gi|150021282|ref|YP_001306636.1| NAD synthetase [Thermosipho melanesiensis BI429]
 gi|149793803|gb|ABR31251.1| NAD+ synthetase [Thermosipho melanesiensis BI429]
          Length = 574

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 227/580 (39%), Positives = 340/580 (58%), Gaps = 34/580 (5%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           K+++ I QLN  +GD  GN+ K   A + A +   D ++F ELF++GYPPEDLV + SF+
Sbjct: 2   KIRVTIVQLNAHLGDFDGNLKKIYNAIDIAEKNQSDFVVFPELFLTGYPPEDLVLRTSFL 61

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +     I+ + S + D    I++G+   + +   NS+ I+  G  +    K  LPNYS F
Sbjct: 62  KKNIEYINKIVSYSKDKKTVILIGYIDVEDDA-FNSLAIIHNGKFLGKYHKHLLPNYSVF 120

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E R F SG     I + +I++GI ICEDIW       +    G + + + +ASPY++ K
Sbjct: 121 DEHRYFKSGNEITIIEYNNIKIGINICEDIWSPIGPLHYQVLNGTQLIINSSASPYFYGK 180

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
            K R + ++ +    H PI+Y N VGGQDE++FDG S     +  + ++ K F E+    
Sbjct: 181 RKLRKKYLSTKSYDYHCPIVYCNLVGGQDEVVFDGGSIVTTSEGNIMYECKPFEEEIVTL 240

Query: 244 EWHYDQQLS------QWNYMSDD--------------------SASTMYIPLQEEEADYN 277
           +   ++ L       +  ++S                      + ST    L+ EE  + 
Sbjct: 241 DIPIEENLRTNLQDPRRRHISSTKIPNINIIKISNKIERKTKINVSTKNFSLKREEEIFK 300

Query: 278 ACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLE 337
           A  L LRDY+ KN F KV+IGLSGG+DS+L AAIAV+ALGK+NV  I++P  Y+S  S+E
Sbjct: 301 AVTLGLRDYIIKNGFKKVVIGLSGGMDSSLVAAIAVEALGKDNVLGILMPSMYSSSHSIE 360

Query: 338 DAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNH 397
           DA   A+ LG KY ++ I ++   F + + +        I  EN+Q+RIRG ILMA+SN 
Sbjct: 361 DAKNLAENLGIKYYIIKIENIYYSFVNELKEIFSNTKEDITEENLQARIRGTILMAISNK 420

Query: 398 SKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLT 457
              ++L T NKSEI+ GY TLYGDM GGF+P+KD+YKT V+++A W N            
Sbjct: 421 FGHIVLATGNKSEIATGYSTLYGDMVGGFSPIKDVYKTDVYKMAKWYNKF-------KGK 473

Query: 458 EVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRY 517
           E+IP ++  K PSAELRP+Q DQ++LPPY ILD+I+K  +E E S     ++++ ETV+Y
Sbjct: 474 EIIPQNVFVKPPSAELRPNQKDQDTLPPYEILDEILKLYIEKELSVEEISEKFDKETVKY 533

Query: 518 VEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           V  L+  +EYKRRQ  +G K++ +SFG+DR  PI++K+++
Sbjct: 534 VAKLVDKNEYKRRQGVIGVKVSERSFGKDRRMPITSKYKE 573


>gi|188997459|ref|YP_001931710.1| NAD+ synthetase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932526|gb|ACD67156.1| NAD+ synthetase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 573

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 240/586 (40%), Positives = 345/586 (58%), Gaps = 44/586 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +KK+++A+AQ+NPVVGD   N  K     E+A +   D++ F EL ++GYPPEDL+ K S
Sbjct: 1   MKKIRLALAQINPVVGDFEYNYNKILEFIEKAKKLEADIVAFPELVLTGYPPEDLILKPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+     ++ LK +  +  A  VVGF  + QE V N+  ++    I+ V  K  LPNY 
Sbjct: 61  FIEKNLQHLEKLKENIDNIIA--VVGFIDK-QEDVFNAAAVIYNKEIVGVYHKQFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F  G     +   + ++GI ICEDIW   N        GAE + ++NASPY  
Sbjct: 118 VFDENRYFQKGDGLLLLSIDNYKVGISICEDIWYPENPVNDYAILGAEVVININASPYSQ 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+KKR E++  +     + I YVN VGGQDEL+FDG S   D Q ++  + + F E+  
Sbjct: 178 GKVKKREEMLKVRSRDNLISIAYVNMVGGQDELVFDGNSLILDAQGEILAKAESFEEELL 237

Query: 242 MTEWHYDQ---------QLSQWNYM------------------SDDSASTMYIPLQEEEA 274
           + +   D+         +L    Y+                  ++  +  + +  +E E 
Sbjct: 238 LADIDLDEIFRLQLKDNRLKNLRYLKKPINVKEVRLDYKIKNKNNQISQKIALDKKEIED 297

Query: 275 DYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQ 334
           +Y A V+ LRDY+ KN F KV+IGLSGGIDS+L A IAVDALGKENV+ +++P  YTS +
Sbjct: 298 NYKALVVGLRDYINKNGFKKVVIGLSGGIDSSLTACIAVDALGKENVKGVLMPSHYTSKE 357

Query: 335 SLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMAL 394
           S+EDA   AK L  +   +PI ++ + +     +  +        EN+Q+RIRGNILMAL
Sbjct: 358 SIEDAIELAKNLDIETFTIPIKNIFDKYLEEFQEIFKGLKPDTTEENLQARIRGNILMAL 417

Query: 395 SNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLG 454
           SN    +++ T NKSE+SVGY TLYGDM GGF  LKD+ KT+V++L+ +RNS        
Sbjct: 418 SNKFGWIVIATGNKSEMSVGYSTLYGDMVGGFAVLKDVLKTKVYELSYYRNS-------- 469

Query: 455 PLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENE---ESFINNDQEYN 511
            +++VIP  +L K PSAELRP+QTD+  L PYPILD II+  VE +   E  +    E  
Sbjct: 470 -ISKVIPDRVLTKPPSAELRPNQTDEAELLPYPILDQIIQFYVEQDLTVEEIVKLGFEEK 528

Query: 512 DETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           D  V+ + +L+  +EYKRRQAP+G KIT ++FG+DR  PI+N+F++
Sbjct: 529 D--VKKIINLIDKNEYKRRQAPIGIKITERAFGKDRRMPITNRFKE 572


>gi|29654185|ref|NP_819877.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii RSA 493]
 gi|29541451|gb|AAO90391.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii RSA 493]
          Length = 542

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 233/559 (41%), Positives = 331/559 (59%), Gaps = 26/559 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGN----IAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           +KKL I  AQLN +VGDI GN    I  A +A +E+     DLILF EL I+ YPPEDL+
Sbjct: 1   MKKLVIVGAQLNFLVGDIEGNTQLIIDAANQAYQESK---ADLILFPELSITSYPPEDLL 57

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
           F+ +  +    A+ T+     +    +VVG+P        N   ++  G I+A   K  L
Sbjct: 58  FRPALYRRVHQALQTIADKVKN--TTVVVGYPDFIDNKCYNKAAVITDGKIVATYAKHEL 115

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           PNY  F EKR F +G     I  + +++GILICED+W  + I K     GA+ +  +NAS
Sbjct: 116 PNYRVFDEKRYFAAGDQPCVIEIKGVKIGILICEDLWLENPI-KQSVAAGAQLIACINAS 174

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           P+  +K   R +++T +    H+PI+Y+N VGGQDEL+FDG S  F+   +L  Q  +  
Sbjct: 175 PFAQDKSHHRRDLLTKRTKRYHIPIVYLNLVGGQDELVFDGGSLVFNQHGELIQQGSYLK 234

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           E+    E+  D  L+               PL EE+  YN  VL +RDY+ KNNF   +I
Sbjct: 235 EELITVEFDIDDNLTILTKTPLPPE-----PLDEEKI-YNVLVLGVRDYINKNNFPGAVI 288

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGG+DSAL  AIAVDA+G E V  +++P  +TS  S+EDA   AKAL  +   + I  
Sbjct: 289 GLSGGVDSALTLAIAVDAIGSERVSGVLMPSPFTSTMSIEDAEGEAKALNVRTSTINIQP 348

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           +   F   +          +  EN+Q+RIRG +LMA+SN   A++LTT NKSE++VGY T
Sbjct: 349 IFEAFIRSLESEFTGLGKDVTEENLQARIRGTLLMAISNKKDAIVLTTGNKSEMAVGYAT 408

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGF  LKD+YKT V++L  +RN+         ++ VIP  +LE+ PSAEL P Q
Sbjct: 409 LYGDMAGGFGVLKDVYKTMVYRLCRYRNT---------ISRVIPERVLERPPSAELAPDQ 459

Query: 478 TDQESLPPYPILDDIIKR-IVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            DQ+ LPPY ILD+I++R I ++E+        ++ E V+ V  ++  +EYKRRQAP+G 
Sbjct: 460 KDQDVLPPYHILDEILERYIAKDEDPTAIAAGGFDVEMVKKVVRMINRNEYKRRQAPIGI 519

Query: 537 KITAKSFGRDRLYPISNKF 555
           +IT ++FG+DR YPI++ F
Sbjct: 520 RITERAFGKDRRYPITSGF 538


>gi|165918537|ref|ZP_02218623.1| NAD+ synthetase [Coxiella burnetii RSA 334]
 gi|212212687|ref|YP_002303623.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii CbuG_Q212]
 gi|165917783|gb|EDR36387.1| NAD+ synthetase [Coxiella burnetii RSA 334]
 gi|212011097|gb|ACJ18478.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii CbuG_Q212]
          Length = 542

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 233/559 (41%), Positives = 331/559 (59%), Gaps = 26/559 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGN----IAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           +KKL I  AQLN +VGDI GN    I  A +A +E+     DLILF EL I+ YPPEDL+
Sbjct: 1   MKKLVIVGAQLNFLVGDIEGNTQLIIDAANQAYQESK---ADLILFPELSITSYPPEDLL 57

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
           F+ +  +    A+ T+     +    +VVG+P        N   ++  G I+A   K  L
Sbjct: 58  FRPALYRRVHQALQTIADKVKN--TTVVVGYPDFIDNKCYNKAAVITDGKIVATYAKHEL 115

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           PNY  F EKR F +G     I  + +++GILICED+W  + I K     GA+ +  +NAS
Sbjct: 116 PNYRVFDEKRYFAAGDQPCVIEIKGVKIGILICEDLWLENPI-KQSVAAGAQLIACINAS 174

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           P+  +K   R +++T +    H+PI+Y+N VGGQDEL+FDG S  F+   +L  Q  +  
Sbjct: 175 PFAQDKSHHRRDLLTKRTKRYHIPIVYLNLVGGQDELVFDGGSLVFNQHGELIQQGSYLK 234

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           E+    E+  D  L+               PL EE+  YN  VL +RDY+ KNNF   +I
Sbjct: 235 EELITVEFDIDDNLTILTKTPLPPE-----PLDEEKI-YNVLVLGVRDYINKNNFPGAVI 288

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGG+DSAL  AIAVDA+G E V  +++P  +TS  S+EDA   AKAL  +   + I  
Sbjct: 289 GLSGGVDSALTLAIAVDAIGSERVSGVLMPSPFTSTMSIEDAEGEAKALNVRTSTINIQP 348

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           +   F   +          +  EN+Q+RIRG +LMA+SN   A++LTT NKSE++VGY T
Sbjct: 349 IFEAFIRSLESEFTGLGKDVTEENLQARIRGTLLMAISNKKGAIVLTTGNKSEMAVGYAT 408

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGF  LKD+YKT V++L  +RN+         ++ VIP  +LE+ PSAEL P Q
Sbjct: 409 LYGDMAGGFGVLKDVYKTMVYRLCRYRNT---------ISRVIPERVLERPPSAELAPDQ 459

Query: 478 TDQESLPPYPILDDIIKR-IVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            DQ+ LPPY ILD+I++R I ++E+        ++ E V+ V  ++  +EYKRRQAP+G 
Sbjct: 460 KDQDVLPPYHILDEILERYIAKDEDPTAIAAGGFDVEMVKKVVRMINRNEYKRRQAPIGI 519

Query: 537 KITAKSFGRDRLYPISNKF 555
           +IT ++FG+DR YPI++ F
Sbjct: 520 RITERAFGKDRRYPITSGF 538


>gi|255261836|ref|ZP_05341178.1| glutamine-dependent NAD(+) synthetase (NAD(+)
           synthase[glutamine-hydrolyzing]) [Thalassiobium sp.
           R2A62]
 gi|255104171|gb|EET46845.1| glutamine-dependent NAD(+) synthetase (NAD(+)
           synthase[glutamine-hydrolyzing]) [Thalassiobium sp.
           R2A62]
          Length = 554

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 232/561 (41%), Positives = 329/561 (58%), Gaps = 11/561 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQ+NP VGD+ GN  KA  A +     G D+++  E+F+ GY  +DLV K 
Sbjct: 1   MPDQFRLTMAQMNPTVGDLVGNADKAFAAWQMGVDAGSDMVVCPEMFLIGYQAQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG--VLNSVVILDAGNIIAVRDKINLP 118
           +F+ +    +  L +   DG + + VG P  D E   + N+  IL  G + A   K  LP
Sbjct: 61  AFVHSAMDMVMNLAARCADGPS-LGVGAPFLDPESGRLYNAYWILKGGKVAARMLKHFLP 119

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           N++ F E R F  G +  P     +R+G  ICED W   ++C+ + + GAE L   N SP
Sbjct: 120 NFNVFDEVRLFNRGATQGPYDVGGVRIGSPICEDAWY-VDVCETMVESGAEILVIPNGSP 178

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y+ +K   R   +  ++    +P++Y+N VGGQD+ +FDG SF  +   +LA QM  F E
Sbjct: 179 YFRDKFDIRMNHMVSRVIENDVPLVYLNMVGGQDDQVFDGGSFVLNRGGKLALQMPTFDE 238

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
                +  + +    W  +  + A+   +P    E DY  CV  LRDY+ K  F KV++G
Sbjct: 239 AYAHVD--FTRTSDGWEAIEGERAT---LP-DSLEQDYRVCVEGLRDYMGKTGFKKVLLG 292

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSA+ A IA DALG  NV+ +MLP +YTS  SL+DAA CA  +GC  D + I   
Sbjct: 293 LSGGIDSAIVATIAADALGPGNVRCVMLPSEYTSQASLDDAAQCAHNIGCNLDTVSIAGP 352

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
                  ++   +    G+  ENIQSR+RG +LMA SN    MLLTT NKSE++VGY T+
Sbjct: 353 RAAVTDALAPLFEGLEEGLTEENIQSRLRGVLLMAQSNKFGEMLLTTGNKSEVAVGYATI 412

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDMSGG+NP+KD+YKT+VF +  WRN++     + P   ++P  I+EK P+AELR  Q 
Sbjct: 413 YGDMSGGYNPIKDMYKTRVFDICRWRNANHRPWMMAPAGTMVPVEIIEKPPTAELREDQK 472

Query: 479 DQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           D +SLPPY ILD I+  +V+ E S  +     Y  ETV+ VEHL+Y SEYKR Q+  G +
Sbjct: 473 DSDSLPPYDILDGILTMLVDQEASVADCVAVGYERETVKKVEHLIYISEYKRFQSAPGPR 532

Query: 538 ITAKSFGRDRLYPISNKFRDH 558
           +T  +F  DR YPI N++RDH
Sbjct: 533 LTDSAFWLDRRYPIVNRWRDH 553


>gi|154706227|ref|YP_001424305.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii Dugway
           5J108-111]
 gi|154355513|gb|ABS76975.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii Dugway
           5J108-111]
          Length = 542

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 233/559 (41%), Positives = 331/559 (59%), Gaps = 26/559 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGN----IAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           +KKL I  AQLN +VGDI GN    I  A +A +E+     DLILF EL I+ YPPEDL+
Sbjct: 1   MKKLVIVGAQLNFLVGDIEGNTQLIIDAANQAYQESK---ADLILFPELSITSYPPEDLL 57

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
           F+ +  +    A+ T+     +    +VVG+P        N   ++  G I+A   K  L
Sbjct: 58  FRPALYRRVHQALQTIADKVKN--TTVVVGYPDFIDNKCYNKAAVIADGKIVATYAKHEL 115

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           PNY  F EKR F +G     I  + +++GILICED+W  + I K     GA+ +  +NAS
Sbjct: 116 PNYRVFDEKRYFAAGDQPCVIEIKGVKIGILICEDLWLENPI-KQSVAAGAQLIACINAS 174

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           P+  +K   R +++T +    H+PI+Y+N VGGQDEL+FDG S  F+   +L  Q  +  
Sbjct: 175 PFAQDKSHHRRDLLTKRTKRYHIPIVYLNLVGGQDELVFDGGSLVFNQHGELIQQGSYLK 234

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           E+    E+  D  L+               PL EE+  YN  VL +RDY+ KNNF   +I
Sbjct: 235 EELITVEFDIDDNLTILTKTPLPPE-----PLDEEKI-YNVLVLGVRDYINKNNFPGAVI 288

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGG+DSAL  AIAVDA+G E V  +++P  +TS  S+EDA   AKAL  +   + I  
Sbjct: 289 GLSGGVDSALTLAIAVDAIGSERVSGVLMPSPFTSTMSIEDAEGKAKALNVRTSTINIQP 348

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           +   F   +          +  EN+Q+RIRG +LMA+SN   A++LTT NKSE++VGY T
Sbjct: 349 IFEAFIRSLESEFTGLGKDVTEENLQARIRGTLLMAISNKKGAIVLTTGNKSEMAVGYAT 408

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGF  LKD+YKT V++L  +RN+         ++ VIP  +LE+ PSAEL P Q
Sbjct: 409 LYGDMAGGFGVLKDVYKTMVYRLCRYRNT---------ISRVIPERVLERPPSAELAPDQ 459

Query: 478 TDQESLPPYPILDDIIKR-IVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            DQ+ LPPY ILD+I++R I ++E+        ++ E V+ V  ++  +EYKRRQAP+G 
Sbjct: 460 KDQDVLPPYHILDEILERYIAKDEDPTAIAAGGFDVEMVKKVVRMINRNEYKRRQAPIGI 519

Query: 537 KITAKSFGRDRLYPISNKF 555
           +IT ++FG+DR YPI++ F
Sbjct: 520 RITERAFGKDRRYPITSGF 538


>gi|313903243|ref|ZP_07836636.1| NH(3)-dependent NAD(+) synthetase [Thermaerobacter subterraneus DSM
           13965]
 gi|313466554|gb|EFR62075.1| NH(3)-dependent NAD(+) synthetase [Thermaerobacter subterraneus DSM
           13965]
          Length = 621

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 239/615 (38%), Positives = 343/615 (55%), Gaps = 69/615 (11%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQ+N  VGD+ GN  K  R   +A + G DL++F EL ++GYPPEDLVF+ +F+ 
Sbjct: 8   LRIAVAQVNVTVGDLEGNARKLARFAADAAQTGADLVVFPELALTGYPPEDLVFRPAFLD 67

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           A    +  L  +   G   +V GF  +D++ + N+  +L  G I AV  K  LPNY  F 
Sbjct: 68  ATRHWLGWLAGELAAGPVALV-GFVHRDRD-LYNAAAVLQGGQIKAVACKRFLPNYGVFD 125

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIW-KNSNICKHLKKQGAEFLFSLNASPYYHNK 183
           EKR F  G     +  R + LG+ ICED+W  +  I +     GAE L +L+ASPY+  K
Sbjct: 126 EKRYFAPGRRALVLHLRGVALGVSICEDLWYPHGPIREQALAGGAEILLNLSASPYHMGK 185

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF-- 241
            ++R  ++  + + + + I+Y N VGGQDEL+FDG S   D   Q+A + + F+E  F  
Sbjct: 186 PREREGLLITRATDLGVAIVYANLVGGQDELVFDGHSLVVDAGGQVAARGRPFAEDLFFW 245

Query: 242 --------MTEWH---------YDQQLSQWNYMSDDS----------------------- 261
                   +  WH           ++ +Q  ++  D                        
Sbjct: 246 DYDPAAAAVARWHEPRYRHMPVTPEEAAQVEHVDLDEPAAGGGPGGRLPGPVAGPGVAVP 305

Query: 262 ----------ASTMYIP------LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDS 305
                     AS   +P      L+ E   Y A VL+LRDY +KN F +  +GLSGGIDS
Sbjct: 306 GVAGPGTAPEASRPPLPPRQVEVLEGEAEVYAALVLALRDYFEKNGFRRAWLGLSGGIDS 365

Query: 306 ALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSL 365
           AL A +A DALG   V  + +P  +TS  SL+DA A A+ LG   + +PI ++   F   
Sbjct: 366 ALVACLAADALGPRQVTGVRMPSPFTSAASLDDAEAVARNLGIGLETIPIGEIFGAFRQA 425

Query: 366 MSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGG 425
           ++    + P  +  EN+Q+RIRG +LMAL+N    ++L T NKSE++ GY TLYGDM+GG
Sbjct: 426 LAPLFGDRPFDVAEENLQARIRGTLLMALANKFGGLVLATGNKSELATGYATLYGDMAGG 485

Query: 426 FNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPP 485
           F PLKD+ KT V++LA++RN         P   VIP S+LEK+P+AELRP Q D++SLPP
Sbjct: 486 FAPLKDVPKTLVYRLAAYRNGW-------PGGPVIPRSVLEKAPTAELRPGQKDEDSLPP 538

Query: 486 YPILDDIIKRIVENE-ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFG 544
           Y +LD I++  VE +  +     +    E VR   HL+  SEYKRRQA  G KITA++FG
Sbjct: 539 YAVLDPILEAYVERDLPAAALVARGLPAEAVRRTVHLVATSEYKRRQAAPGPKITARAFG 598

Query: 545 RDRLYPISNKFRDHI 559
           RDR YPI++ +R+ +
Sbjct: 599 RDRRYPITSGYREAV 613


>gi|153209220|ref|ZP_01947286.1| NAD+ synthetase [Coxiella burnetii 'MSU Goat Q177']
 gi|212218339|ref|YP_002305126.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii CbuK_Q154]
 gi|120575475|gb|EAX32099.1| NAD+ synthetase [Coxiella burnetii 'MSU Goat Q177']
 gi|212012601|gb|ACJ19981.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii CbuK_Q154]
          Length = 542

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 233/559 (41%), Positives = 331/559 (59%), Gaps = 26/559 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGN----IAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           +KKL I  AQLN +VGDI GN    I  A +A +E+     DLILF EL I+ YPPEDL+
Sbjct: 1   MKKLVIVGAQLNFLVGDIEGNTQLIIDAANQAYQESK---ADLILFPELSITSYPPEDLL 57

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
           F+ +  +    A+ T+     +    +VVG+P        N   ++  G I+A   K  L
Sbjct: 58  FRPALYRRVHQALQTIADKVKN--TTVVVGYPDFIDNKCYNKAAVITDGKIVATYAKHEL 115

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           PNY  F EKR F +G     I  + +++GILICED+W  + I K     GA+ +  +NAS
Sbjct: 116 PNYRVFDEKRYFAAGDQPCVIEIKGVKIGILICEDLWLENPI-KQSVAAGAQLIACINAS 174

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           P+  +K   R +++T +    H+PI+Y+N VGGQDEL+FDG S  F+   +L  Q  +  
Sbjct: 175 PFAQDKSHHRRDLLTKRTKRYHIPIVYLNLVGGQDELVFDGGSLVFNQHGELIQQGSYLK 234

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           E+    E+  D  L+               PL EE+  YN  VL +RDY+ KNNF   +I
Sbjct: 235 EELITVEFDIDDNLTILTKTPLPPE-----PLDEEKI-YNVLVLGVRDYINKNNFPGAVI 288

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGG+DSAL  AIAVDA+G E V  +++P  +TS  S+EDA   AKAL  +   + I  
Sbjct: 289 GLSGGVDSALTLAIAVDAIGSERVSGVLMPSPFTSTISIEDAEGEAKALNVRTSTINIQP 348

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           +   F   +          +  EN+Q+RIRG +LMA+SN   A++LTT NKSE++VGY T
Sbjct: 349 IFEAFIRSLESEFTGLGKDVTEENLQARIRGTLLMAISNKKGAIVLTTGNKSEMAVGYAT 408

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGF  LKD+YKT V++L  +RN+         ++ VIP  +LE+ PSAEL P Q
Sbjct: 409 LYGDMAGGFGVLKDVYKTMVYRLCRYRNT---------ISRVIPERVLERPPSAELAPDQ 459

Query: 478 TDQESLPPYPILDDIIKR-IVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            DQ+ LPPY ILD+I++R I ++E+        ++ E V+ V  ++  +EYKRRQAP+G 
Sbjct: 460 KDQDVLPPYHILDEILERYIAKDEDPTAIAAGGFDVEMVKKVVRMINRNEYKRRQAPIGI 519

Query: 537 KITAKSFGRDRLYPISNKF 555
           +IT ++FG+DR YPI++ F
Sbjct: 520 RITERAFGKDRRYPITSGF 538


>gi|145588869|ref|YP_001155466.1| NAD+ synthetase [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047275|gb|ABP33902.1| NAD+ synthetase [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 539

 Score =  421 bits (1083), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 234/559 (41%), Positives = 331/559 (59%), Gaps = 33/559 (5%)

Query: 6   KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQA 65
           KIA+AQ+NP++GD+ GN     +A ++A +QG  L++  EL ++GYPPEDL+ + +FIQA
Sbjct: 5   KIALAQINPLLGDLGGNAQLILKASQDAFKQGAKLVVTPELSLTGYPPEDLLLRPAFIQA 64

Query: 66  CSSAIDTLKSD-THDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
               +D L  + T      ++VG P+Q   G+ N   +L  G +IA   K  LPN+  F 
Sbjct: 65  SERELDLLMQELTAYPDLTVIVGHPKQTDAGLQNYASVLRNGKVIAGYAKQELPNHEVFD 124

Query: 125 EKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           E R F+ G  N   VF    I  G+++CED W +    K     GA+ L   NASPY+  
Sbjct: 125 EVRYFVPG--NRACVFECAGIHYGLILCEDAW-HPGPAKQSHAAGAQILLVPNASPYHLK 181

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K   R +++   I   H+P++YVN VGGQDEL+FDG SF  +   ++   +  F      
Sbjct: 182 KEALRIDVLRSHIHKTHMPLVYVNSVGGQDELVFDGGSFALNATGEVVMALPQFETALGY 241

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
            E     QL +           + +P   E   Y A VL +RDYV KN F  VIIGLSGG
Sbjct: 242 VEVSSAGQLKK---------GVIALPQSVEAQAYQALVLGVRDYVTKNRFPGVIIGLSGG 292

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           +DSAL  A+AVDALG + V+ +M+  +YT+  S  DA   A  LG +YD +PI   V+  
Sbjct: 293 VDSALVLAVAVDALGADKVRAVMMASRYTADISWIDARELADNLGVRYDEIPISGPVDA- 351

Query: 363 FSLMSQFLQEEPSGI----VAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
              + Q L E+  G+      ENIQ+R+RG +LMALSN +  ++LTT NKSE++VGY TL
Sbjct: 352 ---LEQSLAEQFKGMKVDATEENIQARVRGTMLMALSNKTGRLVLTTGNKSEMAVGYCTL 408

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGF  +KD+ KT V++L ++RNS         +  VIP  IL ++PSAELRP QT
Sbjct: 409 YGDMAGGFAVIKDIAKTLVYRLCAYRNS---------IKPVIPERILTRAPSAELRPDQT 459

Query: 479 DQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLP Y +LD I++R +E  +S        ++ E+V  V  L+  +EYKRRQAP G +
Sbjct: 460 DQDSLPSYEVLDGIVERYMEQNQSIEEMIAAGFDAESVEKVTRLIKLNEYKRRQAPPGVR 519

Query: 538 ITAKSFGRDRLYPISNKFR 556
           +T ++FGRD  YPI+++FR
Sbjct: 520 VTTRAFGRDWRYPITSQFR 538


>gi|302878486|ref|YP_003847050.1| NAD+ synthetase [Gallionella capsiferriformans ES-2]
 gi|302581275|gb|ADL55286.1| NAD+ synthetase [Gallionella capsiferriformans ES-2]
          Length = 534

 Score =  421 bits (1083), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 237/562 (42%), Positives = 331/562 (58%), Gaps = 37/562 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+AIAQ+N V+GD+AGN AK   A + A + G  L+L  EL + GYPPEDL+ +  F +
Sbjct: 1   MKLAIAQINCVLGDLAGNSAKILHAAQRACQAGAQLMLTPELSLCGYPPEDLLLRNGFYK 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           +C++++  L  +  D    ++VG P +      N+  +L  G + A   K  LPNY+ F 
Sbjct: 61  SCAASLSELARNISD--IAVIVGHPHEQDGKRYNAASLLRDGRVEATYFKHFLPNYAVFD 118

Query: 125 EKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           E+R F  G  N P+VF    +  G+ ICED+W  S   +   + GA+ L  LNASPY   
Sbjct: 119 EERYFSCG--NAPMVFEMSGVHFGVNICEDVW-GSEAARVAAQAGADVLLVLNASPYSVE 175

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           KL  RHE+V  +++   + ++Y N VGGQDEL+FDG SF  D   +L  Q   F E    
Sbjct: 176 KLASRHEVVRQRVAETDMAVVYANMVGGQDELVFDGGSFAMDRSGRLIAQSAIFEET--- 232

Query: 243 TEWHYDQQLSQWNYMSDD-----SASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
                       +Y+S D     S     +P+QE  A Y A VL LRDYV KN F  V++
Sbjct: 233 -----------LSYVSLDAHGVPSGEIAVLPMQEA-AVYQAMVLGLRDYVGKNRFPGVLL 280

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSAL  A+AVDALG + V  +M+P  YT+  SL+D+    + LG +YD   I  
Sbjct: 281 GLSGGIDSALTLAVAVDALGADRVHAVMMPSPYTAQISLDDSREMIRILGVRYDEFSIEP 340

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           ++  + S++       P     EN+Q+RIRGN+LMALSN   A++LTT NKSE+SVGY T
Sbjct: 341 VMESYLSVLRASFAGRPEDTTEENLQARIRGNLLMALSNKLGALVLTTGNKSEMSVGYAT 400

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGF+ LKD+ K  V++LA +RN+ G         +VIP  I+ ++PSAELR  Q
Sbjct: 401 LYGDMAGGFSVLKDVGKLLVYRLARYRNTQG---------QVIPERIITRAPSAELRHDQ 451

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           TDQ++LPPY +LD I+   VE   S        Y +  VR V  L+  SEYKRRQ+  G 
Sbjct: 452 TDQDNLPPYEVLDGIMACYVEKNLSIPEVIAAGYQEADVRRVVRLIQSSEYKRRQSATGV 511

Query: 537 KITAKSFGRDRLYPISNKFRDH 558
           +IT + +G+D  YPI+ +++D 
Sbjct: 512 RITERGYGKDWRYPITVRYQDQ 533


>gi|256822303|ref|YP_003146266.1| NAD+ synthetase [Kangiella koreensis DSM 16069]
 gi|256795842|gb|ACV26498.1| NAD+ synthetase [Kangiella koreensis DSM 16069]
          Length = 539

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 228/559 (40%), Positives = 337/559 (60%), Gaps = 34/559 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IAIAQ N  VGDI  N+   + + ++A     D+++F+EL + GYPPEDL+ +     
Sbjct: 1   MRIAIAQNNYTVGDIQRNLELIKSSVKQAELDNADIVVFSELSLCGYPPEDLLLRPDLYT 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
              +A++ L +   D    +V+G P ++ EG+ N   ++  G ++    K  LPNYS F 
Sbjct: 61  IIDNAVEDLLA--LDSQVAMVIGHPIKEAEGLFNVATVIHRGQLLVQYKKQLLPNYSVFD 118

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F SG  +    F+ ++LG+L+CED+W      + +K  GA+ L S NASPY + K 
Sbjct: 119 EKRYFESGSEDCVFEFKGLKLGLLVCEDLWYPEPTAR-VKALGADILLSPNASPYCYGKG 177

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R   +  +     LPI+YVNQ+GGQDELIFDG S  ++ + Q  FQM   +E      
Sbjct: 178 TLRSAEMGSRARENELPIVYVNQIGGQDELIFDGCSAVYNEEGQRIFQMAEMAED----- 232

Query: 245 WHYDQQLSQWNYMSDDSASTMYIP-------LQEEEADYNACVLSLRDYVQKNNFHKVII 297
                    + Y+  D  +    P          EE  + A VL +RDY  KN F   ++
Sbjct: 233 ---------FAYIDFDPKTGAIKPSKPYLNQFHGEEEIWQALVLGVRDYAHKNGFKGALL 283

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSA+  A+AVDALGKENV  +M+P++YT+  S+EDA   AKALG ++DV+ I  
Sbjct: 284 GLSGGIDSAVTLAVAVDALGKENVNAVMMPFRYTASMSIEDAEEEAKALGIEFDVISIEP 343

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           +   F S +S   ++  + +  +NIQ+R RG +LMALSN    ++LTT NKSE++VGY T
Sbjct: 344 MYEAFMSQLSHQFKDTEADLTEQNIQARCRGTLLMALSNKFGRLVLTTGNKSEVAVGYCT 403

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GG + LKD+ KT V++LA +RN+         +++VIP  ++ + PSAEL P Q
Sbjct: 404 LYGDMAGGLDVLKDVSKTMVYRLARYRNT---------VSQVIPERVITRPPSAELAPDQ 454

Query: 478 TDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            D+++LPPY ILD I++  VE ++S  +     +++E VR V  L+  +E+KRRQAP G 
Sbjct: 455 KDEDNLPPYDILDAILEAYVEQDKSLDDIIALGHDEEVVRRVIRLVDINEHKRRQAPPGI 514

Query: 537 KITAKSFGRDRLYPISNKF 555
           +IT ++FGRDR YPI++ F
Sbjct: 515 RITQRAFGRDRRYPITSGF 533


>gi|253998620|ref|YP_003050683.1| NAD+ synthetase [Methylovorus sp. SIP3-4]
 gi|253985299|gb|ACT50156.1| NAD+ synthetase [Methylovorus sp. SIP3-4]
          Length = 550

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 234/557 (42%), Positives = 333/557 (59%), Gaps = 25/557 (4%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           ++++AIAQ+N VVGD+AGN A+      EA   G +L+L  EL +SGY P+DL+ ++ F 
Sbjct: 10  QMQVAIAQINCVVGDLAGNAARILSYAHEAKAAGANLMLTPELALSGYSPQDLLLREDFT 69

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
             C   +  L +        +VVG P ++     N+  +L  G I+    K  LPN+S F
Sbjct: 70  HHCQRELQAL-AKALPADITVVVGHPHREHGRCYNAASVLQGGRIVLTYHKHALPNHSVF 128

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E R F  G        + +R GILIC D+W+     K  K+ GAE L  LNASP++  K
Sbjct: 129 DEVRYFSPGNKAGVFEHQGVRCGILICADVWE-PGPAKVSKQAGAELLLVLNASPFHLEK 187

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
            ++R++++  ++    LP++Y N VGGQDEL+FDG S   D       Q+  F+EQ  + 
Sbjct: 188 QQQRYKVLGKRVEETGLPLVYANLVGGQDELVFDGNSVVIDRCGAPVQQLPAFTEQLALV 247

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
                 Q ++ N +  D A      L  EE+ Y A  L LRDYVQKN F   ++GLSGGI
Sbjct: 248 SIDLSPQ-NRANPLPADIAPG----LTREESAYQALTLCLRDYVQKNGFPGAVLGLSGGI 302

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL  AIAVDALG + V  +M+P ++T+  S++DA   A+ LG KY  LPI  L + F 
Sbjct: 303 DSALTLAIAVDALGADKVHAVMMPSEFTADMSVDDARQMAQLLGVKYTELPIKPLFDQFC 362

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           + +++        I  EN+Q+RIRG +LMALSN   +++LTT NKSE++VGY TLYGDM+
Sbjct: 363 ATLAEPFAGTSFDITEENLQARIRGMLLMALSNKFGSIVLTTGNKSEMAVGYSTLYGDMA 422

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF  LKD+ KT V++LA +RNS         L++VIP  I+ + PSAELR  QTDQ+SL
Sbjct: 423 GGFAVLKDISKTLVYRLARYRNS---------LSQVIPERIIIRPPSAELRHGQTDQDSL 473

Query: 484 PPYPILDDIIKRIVENEESFINNDQE-----YNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           PPY +LD I++  VE + S     QE     Y ++ V  V +L+  +EYKRRQ+P+G ++
Sbjct: 474 PPYDVLDAIMEAYVERDSS----RQEIIAMGYREQDVARVLNLIDRNEYKRRQSPIGVRV 529

Query: 539 TAKSFGRDRLYPISNKF 555
           T + FG DR YP+ ++F
Sbjct: 530 TERGFGLDRRYPVVSRF 546


>gi|170289348|ref|YP_001739586.1| NAD+ synthetase [Thermotoga sp. RQ2]
 gi|281412952|ref|YP_003347031.1| NAD+ synthetase [Thermotoga naphthophila RKU-10]
 gi|170176851|gb|ACB09903.1| NAD+ synthetase [Thermotoga sp. RQ2]
 gi|281374055|gb|ADA67617.1| NAD+ synthetase [Thermotoga naphthophila RKU-10]
          Length = 576

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 230/589 (39%), Positives = 345/589 (58%), Gaps = 44/589 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K+L++ +AQLNP +GD  GN+ KA  A   A  +G DL++F ELF+ GYPPEDL+ + S
Sbjct: 1   MKRLRVTLAQLNPTLGDFEGNLKKAIEALRVAEDRGSDLLVFPELFLPGYPPEDLMLRLS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++     +      T + G  +++GF   D++   N+  ++  G I+ V  KI+LPNY 
Sbjct: 61  FLRENRKYLQKFAQHTRNLGVTVLMGFIDSDEDA-YNAAAVVKGGEILGVYRKISLPNYG 119

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLK-KQGAEFLFSLNASPYY 180
            F E+R F  G     +   +I++G+ ICEDIW        L   +G   + +L+ASPY+
Sbjct: 120 VFDERRYFKPGEELLVVKIGNIKVGVTICEDIWNPVEPSASLSLGEGVHLIANLSASPYH 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R + ++ +    H+ + Y N VGGQDEL+FDG S   D   ++    K F E+ 
Sbjct: 180 VGKPVLRKDYLSMKAYDYHVAMAYCNMVGGQDELVFDGGSMVVDASGEVINYGKLFEEEI 239

Query: 241 FMTEWHYDQQLS------QWNYMSDDSASTMYI-------------------PLQEEEAD 275
              +   D+ L       +  YM   +     +                   P++EEE  
Sbjct: 240 ITVDLDLDENLRVSLVDPRRRYMKTQNYPVKTVEAGNLREKSGHFEPVVNPLPVREEEM- 298

Query: 276 YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQS 335
           + A +  LRDYV+KN F KV+IGLSGG+DS+L A IA +ALGKENV+ +++P  YTS +S
Sbjct: 299 FRALITGLRDYVRKNGFEKVVIGLSGGMDSSLVAVIATEALGKENVKGVLMPSMYTSKES 358

Query: 336 LEDAAACAKALGCKYDVLPIHDLVNHFF-SLMSQFLQEEPSGIVAENIQSRIRGNILMAL 394
           +EDA   AK LG +  ++PI D+ + +  +L   F   EP  I  EN+Q+RIRGN LMAL
Sbjct: 359 IEDAQTLAKNLGIETFIIPITDVFHSYLETLKGVFAGREPD-ITEENLQARIRGNYLMAL 417

Query: 395 SNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNS-HGITSGL 453
           SN    ++LTT NKSE++ GY TLYGDM+GGF  +KD+YKT V+++  W NS  G     
Sbjct: 418 SNKFGWLVLTTGNKSEMATGYATLYGDMAGGFAVIKDVYKTDVYRIGRWYNSWRG----- 472

Query: 454 GPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVE---NEESFINNDQEY 510
               E+IP +I  K P+AELRP QTDQE LPPY +LD+I++  +E   + E   +  + +
Sbjct: 473 ---KEIIPENIFVKPPTAELRPGQTDQEKLPPYEVLDEILRLYIEEGLDPEEIAS--KGF 527

Query: 511 NDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           + +TV  V  ++  +EYKR+QA +G KI+ ++FG+D   PI+N+F++ +
Sbjct: 528 DRKTVLDVTEMIRKNEYKRKQAAIGVKISTRAFGKDWRMPITNRFKEPL 576


>gi|126733697|ref|ZP_01749444.1| NAD(+) synthase [Roseobacter sp. CCS2]
 gi|126716563|gb|EBA13427.1| NAD(+) synthase [Roseobacter sp. CCS2]
          Length = 553

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 243/559 (43%), Positives = 338/559 (60%), Gaps = 10/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M K L++ +AQLN  VGDIAGN   AR A  EA     DL+   E+F++GY  +DLV K 
Sbjct: 1   MTKFLRLTMAQLNATVGDIAGNADLARAAWAEAKAAKADLVALPEMFLTGYQTQDLVAKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+      +  L  D  DG A + +G P  ++E + N+   L  G I+A   K  LPN+
Sbjct: 61  AFVADAMVHLMALAKDCADGPA-LSIGAPLVEEERLYNAYFTLRGGEIVARARKHFLPNF 119

Query: 121 SEFHEKRTFISGYSNDPIVFRD-IRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           + F E R F S     P    +  R+G  ICED W   ++C+ + + GAE L   N SPY
Sbjct: 120 NVFDEVRLFKSADIEGPYAHNNGARIGHPICEDAWY-PDVCEAMVESGAEILVVPNGSPY 178

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           + +K   R   +  ++    +P++Y+N VG QD+ +FDG SF  +   +LA QM      
Sbjct: 179 FRDKFPIRMNNMVSRVIENDVPLVYINLVGAQDDQMFDGGSFVLNRGGKLAVQMPLMES- 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
                 H D +L+   +++ D        + E+  DY   V +LRDY++K  F KV++GL
Sbjct: 238 ---ALAHVDFELTDSGWVALDGEKATLPDIIEQ--DYRVMVEALRDYMRKTGFKKVLLGL 292

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSA+ AAIA DALG +NV+ +MLP +YTS  SL+DAAA A ALGCKYD + I    
Sbjct: 293 SGGIDSAIVAAIATDALGADNVRCVMLPSEYTSQGSLDDAAAAADALGCKYDTISIAGPR 352

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
                 ++       + +  ENIQSRIRG +LMA SN    MLLTT NKSE++VGY T+Y
Sbjct: 353 AAVTDALAPLFAGLEADLTEENIQSRIRGLLLMAQSNKFGEMLLTTGNKSEVAVGYATIY 412

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GG+NP+KD+YKT+VF+ A WRN++      GP  EVIP +I++K PSAELRP Q D
Sbjct: 413 GDMAGGYNPIKDMYKTRVFEAARWRNANHRDWMNGPAGEVIPVAIIDKPPSAELRPDQKD 472

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           ++SLPPY +LD I+  +V+ E S  N     Y+ ETV+ VEHL+Y SEYKR Q+  G ++
Sbjct: 473 EDSLPPYDVLDGILMMLVDGEASVANCAAAGYDRETVKRVEHLIYISEYKRFQSAPGPRL 532

Query: 539 TAKSFGRDRLYPISNKFRD 557
           + ++F  DR YPI N++RD
Sbjct: 533 SDRAFWLDRRYPIVNRWRD 551


>gi|237756468|ref|ZP_04585003.1| glutamine-dependent NAD(+) synthetase [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237691369|gb|EEP60442.1| glutamine-dependent NAD(+) synthetase [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 573

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 236/586 (40%), Positives = 345/586 (58%), Gaps = 44/586 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +KK+++A+AQ+NPVVGD   N  K     E+A +   D++ F EL ++GYPPEDL+ K S
Sbjct: 1   MKKIRLALAQINPVVGDFEYNYNKILEFIEKAKKLEADIVAFPELALTGYPPEDLILKPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+     ++ LK +  +  A  +VGF  + QE V N+  ++    I+ V  K  LPNY 
Sbjct: 61  FIEKNLYYLEKLKENVDNIIA--IVGFIDK-QEDVFNAAAVIYNKEIVGVYHKQFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F  G     +   + ++G+ ICEDIW   N        GAE + ++NASPY  
Sbjct: 118 VFDENRYFQKGDGLLLLSIDNYKVGVSICEDIWYPENPVNDYAILGAEVVININASPYSQ 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+K+R E++  +     + I YVN VGGQDEL+FDG S   D Q ++  + + F E+  
Sbjct: 178 GKVKRREEMLKVRSRDNLISIAYVNMVGGQDELVFDGNSLILDTQGEILAKAESFEEELL 237

Query: 242 MTEWHYDQ---------QLSQWNYM------------------SDDSASTMYIPLQEEEA 274
           + +   D+         +L    Y+                  ++  +  + +  +E E 
Sbjct: 238 LADIDLDEIFRLQLKDNRLKNLRYLKKPINVKEIRLDYKIKNKNNQISQKIALDRKEIED 297

Query: 275 DYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQ 334
            Y A V+ LRDY+ KN F KV+IGLSGGIDS+L A IAVDALGKENV+ +++P +YTS +
Sbjct: 298 TYKALVVGLRDYINKNGFKKVVIGLSGGIDSSLTACIAVDALGKENVKGVLMPSQYTSKE 357

Query: 335 SLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMAL 394
           S+EDA   AK L  +   +PI ++ + +     +  +        EN+Q+RIRGNILMAL
Sbjct: 358 SIEDALELAKNLDIETFTIPIKNIFDKYLEEFQEIFKGLKPDTTEENLQARIRGNILMAL 417

Query: 395 SNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLG 454
           SN    +++ T NKSE+SVGY TLYGDM GGF  LKD+ KT+V++L+ +RNS        
Sbjct: 418 SNKFGWIVIATGNKSEMSVGYSTLYGDMVGGFAVLKDVLKTKVYELSYYRNS-------- 469

Query: 455 PLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENE---ESFINNDQEYN 511
            +++VIP  +L K PSAELRP+QTD+  L PYPILD II+  VE +   E  +    E  
Sbjct: 470 -ISKVIPDRVLTKPPSAELRPNQTDEAELLPYPILDQIIQFYVEQDLTVEEIVKLGFEEK 528

Query: 512 DETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           D  V+ + +L+  +EYKRRQAP+G KIT ++FG+DR  PI+N++++
Sbjct: 529 D--VKKIINLIDKNEYKRRQAPIGIKITERAFGKDRRMPITNRYKE 572


>gi|332530579|ref|ZP_08406516.1| NAD+ synthetase [Hylemonella gracilis ATCC 19624]
 gi|332039985|gb|EGI76374.1| NAD+ synthetase [Hylemonella gracilis ATCC 19624]
          Length = 565

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 246/576 (42%), Positives = 332/576 (57%), Gaps = 38/576 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L++ +AQ N VVGD++GN  K      +A  QG+ L+L  EL I GY  EDL+ + SFI 
Sbjct: 3   LRLGVAQSNFVVGDLSGNAQKIIATARQACTQGVHLLLTPELAICGYAAEDLLLRPSFIA 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFPRQDQEG-----------VLNSVVILDAGNIIAVR 112
           AC  A+ T+  +  D  G  +VVG P   ++G             N+  +L AG +IA  
Sbjct: 63  ACDEAVRTVAKELADLEGLTVVVGHPAATEDGGWRTRSVMRPGRFNAASVLRAGQVIARY 122

Query: 113 DKINLPNYSEFHEKRTFISGYSNDPIVFR------DIRLGILICEDIWKNSNICKHLKKQ 166
            K  LPNY  F E+R F  G  + P VF         R+G+LICED W + N  +  +  
Sbjct: 123 AKRELPNYQVFDERRYFEPG--DQPCVFEVEADGERTRVGLLICEDSWFD-NPARETRAA 179

Query: 167 GAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCF--- 223
           GAE L  +NASP++  K  +R   +  ++    LP++Y + VGGQDE +F+G SF     
Sbjct: 180 GAELLAVINASPFHAGKGDERETAMAQRVRDHGLPLVYAHLVGGQDEAVFEGRSFALQPS 239

Query: 224 -DGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVL 281
            +G+  LA +   F+E  F+ +   D         +    S    P ++ +AD ++A VL
Sbjct: 240 GEGEVSLAARAPSFAEDLFVMDARRDA--------AGLRLSGPIAPERDRDADLWDALVL 291

Query: 282 SLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAA 341
            +RDYV KN F   IIGLSGGIDSAL  AIAVDALG   V+T+M+P  YT+  S  DA  
Sbjct: 292 GVRDYVGKNGFPGAIIGLSGGIDSALVLAIAVDALGPAKVRTVMMPSPYTADISWIDARD 351

Query: 342 CAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAM 401
            A  L  +YD + I      F + ++Q     P     ENIQ+RIRG +LMALSN S  +
Sbjct: 352 MAARLRVQYDEISIVPEFEAFKTSLAQEFAGLPEDTTEENIQARIRGTLLMALSNKSGRI 411

Query: 402 LLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIP 461
           +LTT NKSE++ GY TLYGDM+GGF  +KD+ KT VF+LA WRN+H      G  T  IP
Sbjct: 412 VLTTGNKSEMATGYCTLYGDMAGGFAVIKDVLKTTVFRLARWRNAH---DPYGTGTAPIP 468

Query: 462 PSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESF-INNDQEYNDETVRYVEH 520
             I+ + PSAELRP QTDQ+SLPPY +LD I++R +EN++S        Y    V  V  
Sbjct: 469 ERIITRPPSAELRPDQTDQDSLPPYEVLDAIVERYMENDDSVEAIVAAGYARADVERVTR 528

Query: 521 LLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           LL  +EYKRRQAPVG ++T + FG+D  YPI+NKFR
Sbjct: 529 LLRLNEYKRRQAPVGIRVTHRGFGKDWRYPITNKFR 564


>gi|148270642|ref|YP_001245102.1| NAD synthetase [Thermotoga petrophila RKU-1]
 gi|147736186|gb|ABQ47526.1| NH(3)-dependent NAD(+) synthetase [Thermotoga petrophila RKU-1]
          Length = 576

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 226/588 (38%), Positives = 341/588 (57%), Gaps = 42/588 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K+L++ +AQLNP +GD  GN+ KA  A   A  +G DL++F ELF+ GYPPEDL+ + S
Sbjct: 1   MKRLRVTLAQLNPTLGDFEGNLKKAIEALRVAEDRGSDLLVFPELFLPGYPPEDLMLRLS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++     +      T + G  +++GF   D++   N+  ++  G I+ V  KI+LPNY 
Sbjct: 61  FLRENRKYLQKFAQHTRNLGVTVLMGFIDSDEDA-YNAAAVVKGGEILGVYRKISLPNYG 119

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLK-KQGAEFLFSLNASPYY 180
            F E+R F  G     +   +I++G+ ICEDIW        L   +G   + +L+ASPY+
Sbjct: 120 VFDERRYFKPGEELLVVKIGNIKVGVTICEDIWNPVEPSASLSLGEGVHLIANLSASPYH 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R + ++ +    H+ + Y N VGGQDEL+FDG S   D   ++    K F E+ 
Sbjct: 180 VGKPVLRKDYLSMKAYDYHVAMAYCNMVGGQDELVFDGGSMVVDASGEVINYGKLFEEEI 239

Query: 241 FMTEWHYDQQLS------QWNYMSDDSASTMYI-------------------PLQEEEAD 275
              +   D+ L       +  YM   +     +                   P++EEE  
Sbjct: 240 ITVDLDLDENLRVSLVDPRRRYMKTQNYPVKTVEAGNLREKSGHFEPVVNPLPVREEEM- 298

Query: 276 YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQS 335
           + A +  LRDYV+KN F KV+IGLSGG+DS+L A IA +ALGKENV+ +++P  YTS +S
Sbjct: 299 FRALITGLRDYVRKNGFEKVVIGLSGGMDSSLVAVIATEALGKENVKGVLMPSMYTSKES 358

Query: 336 LEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALS 395
           +EDA   AK LG +  ++PI D+ + +   +          I  EN+Q+RIRGN LMALS
Sbjct: 359 IEDAQTLAKNLGIETFIIPITDVFHSYLGALEDVFAGREPDITEENLQARIRGNYLMALS 418

Query: 396 NHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNS-HGITSGLG 454
           N    ++LTT NKSE++ GY TLYGDM+GGF  +KD+YKT V+++  W NS  G      
Sbjct: 419 NKFGWLVLTTGNKSEMATGYATLYGDMAGGFAVIKDVYKTDVYRIGRWYNSWRG------ 472

Query: 455 PLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVE---NEESFINNDQEYN 511
              E+IP +I  K P+AELRP QTDQE LPPY +LD+I++  +E   + E   +  + ++
Sbjct: 473 --KEIIPENIFVKPPTAELRPGQTDQEKLPPYEVLDEILRLYIEEGLDPEEIAS--KGFD 528

Query: 512 DETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
            +TV  V  ++  +EYKR+QA +G KI+ ++FG+D   PI+N+F++ +
Sbjct: 529 RKTVLDVTEMIRKNEYKRKQAAIGVKISTRAFGKDWRMPITNRFKEPL 576


>gi|212710640|ref|ZP_03318768.1| hypothetical protein PROVALCAL_01706 [Providencia alcalifaciens DSM
           30120]
 gi|212686721|gb|EEB46249.1| hypothetical protein PROVALCAL_01706 [Providencia alcalifaciens DSM
           30120]
          Length = 540

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 227/560 (40%), Positives = 336/560 (60%), Gaps = 31/560 (5%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL I++AQLN +VGDI GN  +  +  EE  +   D+++F+EL ++GY PEDL+F+ 
Sbjct: 1   MSRKLNISLAQLNWLVGDIEGNCERMLQTVEEQGKN-TDIVMFSELALTGYSPEDLLFRH 59

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F + C++ +  L+  +     GI+VG P  ++  + N++     G ++A   K  LPNY
Sbjct: 60  DFEERCTAQLKRLQQASSQ--CGIIVGHPWYEENEIYNALSFFYQGKLLARYFKQELPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F +      + F+  +LG+LICEDIW +  I   +K  GA+ + ++NASPY 
Sbjct: 118 GVFDEPRYFTAAEKTCVVEFKGYQLGLLICEDIWYDEPI-DAVKGAGADLVLTINASPYD 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK   R +++        LPI+Y+NQVGGQDEL+FDG S     + +  +QM  F+EQ 
Sbjct: 177 LNKEHIRSDLLVEHAQRTGLPIVYLNQVGGQDELVFDGGSKVLANKGKQVYQMVEFAEQV 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD----YNACVLSLRDYVQKNNFHKVI 296
               +             +D       P Q E +     Y A VL+ RDY+ KN F+  I
Sbjct: 237 ATVTF-------------EDVKLVTEQPKQPEASQIAQVYQALVLATRDYINKNGFNGAI 283

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDS L  AIA DA+GK+ VQ +M+P++YTS  S+ DA   A+ LG ++D++ I 
Sbjct: 284 LGLSGGIDSGLTVAIAADAIGKDRVQAVMMPFRYTSEMSIHDAKEQAELLGVEFDIVSIE 343

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            + + F + +    +        EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY 
Sbjct: 344 PMFDAFMAQLQPMFEGTQPDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYS 403

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGF+ LKD+ KT VF+LA +RN+         ++  IP  ++++ PSAEL P 
Sbjct: 404 TLYGDMAGGFDVLKDVPKTLVFELAKYRNT---------ISPAIPQRVIDRPPSAELAPG 454

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q DQ+SLPPY +LD I+   VE + S  +  +  ++ E VR V  L+  +EYKRRQAPVG
Sbjct: 455 QLDQDSLPPYDVLDAILDGYVEKDLSVADLIKLGFDREIVRKVVRLVDINEYKRRQAPVG 514

Query: 536 TKITAKSFGRDRLYPISNKF 555
            +IT ++FG+DR YPI++ F
Sbjct: 515 PRITMRNFGKDRRYPITSGF 534


>gi|15644009|ref|NP_229058.1| NAD synthetase [Thermotoga maritima MSB8]
 gi|8928238|sp|Q9X0Y0|NADE2_THEMA RecName: Full=Probable glutamine-dependent NAD(+) synthetase;
           AltName: Full=NAD(+) synthase [glutamine-hydrolyzing]
 gi|4981808|gb|AAD36328.1|AE001780_12 NH(3)-dependent NAD(+) synthetase [Thermotoga maritima MSB8]
          Length = 576

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 230/589 (39%), Positives = 345/589 (58%), Gaps = 44/589 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K+L++ +AQLNP +GD  GN+ KA  A   A  +G DL++F ELF+ GYPPEDL+ + S
Sbjct: 1   MKRLRVTLAQLNPTLGDFEGNLKKAIEALRVAEDRGSDLLVFPELFLPGYPPEDLMLRLS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++     +      T + G  +++GF   D++   N+  ++  G I+ V  KI+LPNY 
Sbjct: 61  FLRENRKYLQKFAQHTRNLGVTVLMGFIDSDEDA-YNAAAVVKDGEILGVYRKISLPNYG 119

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLK-KQGAEFLFSLNASPYY 180
            F E+R F  G     +   +I++G+ ICEDIW        L   +G   + +L+ASPY+
Sbjct: 120 VFDERRYFKPGEELLVVKIGNIKVGVTICEDIWNPVEPSASLSLGEGVHLIANLSASPYH 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R + ++ +    H+ + Y N VGGQDEL+FDG S   D   ++    K F E+ 
Sbjct: 180 VGKPVLRKDYLSMKAYDYHVAMAYCNMVGGQDELVFDGGSMVVDASGEVINYGKLFEEEI 239

Query: 241 FMTEWHYDQQLS------QWNYMSDDSASTMYI-------------------PLQEEEAD 275
              +   D+ L       +  YM   +     +                   P++EEE  
Sbjct: 240 ITVDLDLDENLRVSLVDPRRRYMKTQNYPVKTVEAGNLREKSGHFEPVVNPLPVREEEM- 298

Query: 276 YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQS 335
           + A +  LRDYV+KN F KV+IGLSGG+DS+L A IA +ALGKENV+ +++P  YTS +S
Sbjct: 299 FRALITGLRDYVRKNGFEKVVIGLSGGMDSSLVAVIATEALGKENVKGVLMPSMYTSKES 358

Query: 336 LEDAAACAKALGCKYDVLPIHDLVNHFF-SLMSQFLQEEPSGIVAENIQSRIRGNILMAL 394
           +EDA   AK LG +  ++PI D+ + +  +L   F   EP  I  EN+Q+RIRGN LMAL
Sbjct: 359 IEDAQTLAKNLGIETFIIPITDVFHSYLETLKGVFAGREPD-ITEENLQARIRGNYLMAL 417

Query: 395 SNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNS-HGITSGL 453
           SN    ++LTT NKSE++ GY TLYGDM+GGF  +KD+YKT V+++  W NS  G     
Sbjct: 418 SNKFGWLVLTTGNKSEMATGYATLYGDMAGGFAVIKDVYKTDVYRIGRWYNSWRG----- 472

Query: 454 GPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVE---NEESFINNDQEY 510
               E+IP +I  K P+AELRP QTDQE LPPY +LD+I++  +E   + E   +  + +
Sbjct: 473 ---KEIIPENIFVKPPTAELRPGQTDQEKLPPYEVLDEILRLYIEEGLDPEEIAS--KGF 527

Query: 511 NDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           + +TV  V  ++  +EYKR+QA +G KI+ ++FG+D   PI+N+F++ +
Sbjct: 528 DRKTVLDVTEMIRKNEYKRKQAAIGVKISTRAFGKDWRMPITNRFKEPL 576


>gi|329902389|ref|ZP_08273093.1| NAD synthetase [Oxalobacteraceae bacterium IMCC9480]
 gi|327548804|gb|EGF33438.1| NAD synthetase [Oxalobacteraceae bacterium IMCC9480]
          Length = 537

 Score =  418 bits (1075), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 237/558 (42%), Positives = 331/558 (59%), Gaps = 30/558 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+AIAQ+N  VGD++GN AK     E A  QG D+++  E+ + GYPPEDL+ + +F  
Sbjct: 3   VKVAIAQINSTVGDLSGNRAKIFAFAERAAGQGADIVVTPEMSLVGYPPEDLLLRDAFYA 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
             +  +  L +D     G  ++VG P        N+VV+L  G+I+A   K  LPN + F
Sbjct: 63  QSAEQVAGLAADLAVFAGLHVLVGLPLLKDGARFNAVVVLADGHIVATYCKSELPNDAVF 122

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            EKR F SG     +  + +  GI ICED W +           A+ L   N SPY+ NK
Sbjct: 123 DEKRYFSSGDQACVLTIKGVTFGINICEDTWFDRAPALARAAG-AQVLLVPNGSPYHMNK 181

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
           L  R++I+   +    L ++YVN VGGQDELIFDG SF  D   QL  Q+ H  E     
Sbjct: 182 LHLRYDIMRANVCAQGLSLVYVNLVGGQDELIFDGNSFVMDQSGQLQAQLSHVDE----- 236

Query: 244 EWHYDQQLSQWNYMSDDSASTM---YIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
               D QL ++     D A+ +   + P    EA  Y A VL +RDY+ KN F  V++GL
Sbjct: 237 ----DLQLVEF-----DGATPLPGKFAPRLSVEAQVYQALVLGVRDYIGKNGFPGVLLGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGG+DSAL  A+AVDALG + V+T+M+P  YT+  S  D+   A+  G +YD + I +  
Sbjct: 288 SGGVDSALTLAVAVDALGADKVRTVMMPSPYTAEISWIDSRDMAQRTGVRYDEIAIGNCF 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           + F   +++     P     ENIQ+RIRG ILMALSN   +++LTT NKSE++VGY TLY
Sbjct: 348 DAFLGTLAEDFAGLPLDATEENIQARIRGTILMALSNKHGSIVLTTGNKSEMAVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGF  LKD+ KT V++L ++RN+         ++ VIP  IL ++PSAELRP QTD
Sbjct: 408 GDMAGGFAVLKDIAKTLVYRLCAYRNA---------ISPVIPERILTRAPSAELRPDQTD 458

Query: 480 QESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLPPY ILD I++  +E   S  +     +  E VR + HL+  +EYKRRQ+PVG ++
Sbjct: 459 QDSLPPYEILDGIMQLFMEENRSVDDVIAAGFQAEDVRRITHLIKINEYKRRQSPVGIRV 518

Query: 539 TAKSFGRDRLYPISNKFR 556
           T ++FGRD  YPI++KFR
Sbjct: 519 THRAFGRDWRYPITSKFR 536


>gi|297183634|gb|ADI19760.1| hypothetical protein [uncultured gamma proteobacterium EB000_37F04]
          Length = 538

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 228/555 (41%), Positives = 331/555 (59%), Gaps = 23/555 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KI +AQ+N +VGDI GN  +      + +  G+D+++F EL ++GYPPEDL+ ++    
Sbjct: 1   MKIVMAQINTLVGDIKGNTQRILDVCVDQSALGVDMVVFPELTLTGYPPEDLLLRQHTTD 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
             ++A++ L  D  DG A +VVG+PR+    + NS  +L  G ++A  DK  LPNY  F 
Sbjct: 61  LTAAALERLCQDLPDGLA-VVVGYPRRQGGLLFNSAGVLYNGAVVAEYDKQCLPNYQVFD 119

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F +G     +  +D+ +G+ ICEDIW +     +    GA+ L +LNASP++  K 
Sbjct: 120 EKRYFEAGADTCVVTIKDLPIGLTICEDIW-HPQPAANAAAAGAQLLINLNASPFHRGKQ 178

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +R   V+       LPI+YVNQVGGQDEL+FDG SF  D +  +  +   F+E     E
Sbjct: 179 SERTAQVSALARTHQLPILYVNQVGGQDELVFDGGSFVVDARGDVQHRAIEFAEVMLSVE 238

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
                QL         ++  +  PL E +A +   VL +RDYV KN F  V++GLSGGID
Sbjct: 239 IETSPQLKV-------ASGALATPLDELDAVWQVLVLGMRDYVNKNGFPGVVLGLSGGID 291

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+  A+AVDALG E V+ +M+P++YT+  S+EDAA  A   G  +    I  L   F +
Sbjct: 292 SAVTLAVAVDALGPERVEAVMMPFRYTASMSIEDAAEQANTQGVAFSNRSIEPLYEAFMT 351

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++   +     I  EN+Q+R RG +LM++SN    ++LTT NKSE++VGY TLYGDM+G
Sbjct: 352 TLAPAFEGLEPNITEENLQARCRGVLLMSISNKKNLLVLTTGNKSELAVGYSTLYGDMAG 411

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF+ LKD  K  V+ LA +RN+ G         + IP  ++ + PSAEL P Q D++SLP
Sbjct: 412 GFDVLKDCPKMLVYALAQYRNTLG---------QCIPERVISRPPSAELAPDQKDEDSLP 462

Query: 485 PYPILDDIIKRIVENEESFINNDQ---EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           PY +LD II+  VE + S   +D     ++ E V  V  L+  +EYKRRQAPVG +I+ +
Sbjct: 463 PYEVLDQIIEHYVERDAS--RDDMIAAGFSPEDVHRVVRLIDLNEYKRRQAPVGVRISPR 520

Query: 542 SFGRDRLYPISNKFR 556
           +FGRDR YPI+  +R
Sbjct: 521 AFGRDRRYPITWAWR 535


>gi|253996052|ref|YP_003048116.1| NAD+ synthetase [Methylotenera mobilis JLW8]
 gi|253982731|gb|ACT47589.1| NAD+ synthetase [Methylotenera mobilis JLW8]
          Length = 539

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 229/557 (41%), Positives = 330/557 (59%), Gaps = 27/557 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQ+N +VGD+AGN  K       A  QG  L++  EL + GY PEDL+ +  F++
Sbjct: 1   MKIAIAQINCIVGDLAGNAKKIVAYAASAKEQGATLVVTPELSLCGYSPEDLLLRPDFLR 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC   + TL     D    ++VG P Q+ E   N+  +L+ G+I+A   K  LPNY  F 
Sbjct: 61  ACEDTLQTLAQQLSD--ITVIVGHPHQEGEQCFNAASVLEGGSIVATYHKQVLPNYGVFD 118

Query: 125 EKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           EKR F SG   + +VF    +++G+LIC D+W+        K  GAE L ++N SPY+  
Sbjct: 119 EKRYFSSG--AEALVFNHCGVKVGVLICADVWEPKPALLA-KMAGAELLIAMNGSPYHMK 175

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K   R E++  +    +LP++YVN VGGQDEL+FDGASF  + Q ++  ++  F  Q  +
Sbjct: 176 KQSARFEVLKQRAVENNLPVVYVNMVGGQDELVFDGASFVLNAQGEVVAELDAFESQLEV 235

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
            E+ + Q +             +   L  E   Y A  L L DY+ KN F  V+IGLSGG
Sbjct: 236 IEFDHAQPIY----------GEITPSLSLEATVYKALKLGLADYINKNGFPGVVIGLSGG 285

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           +DSAL  A+AVDA+G + V  +M+P ++T+  S+ DA   A  +G KY+ + I  L + +
Sbjct: 286 VDSALTLALAVDAIGADKVHAVMMPSEFTADISVNDAREMADIVGVKYEEIAIKPLFDSY 345

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            S +S    + P     EN+Q+RIRG +LMA+SN   ++++TT NKSE++VGY TLYGDM
Sbjct: 346 LSALSPQFGDMPFDATEENLQARIRGMLLMAISNKFGSIVVTTGNKSEMAVGYCTLYGDM 405

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF  LKD+ KT V++L ++RN          L+ VIP  I+ + PSAELR +Q DQ+S
Sbjct: 406 AGGFALLKDVPKTLVYRLCAYRNQ---------LSRVIPERIITRPPSAELRANQVDQDS 456

Query: 483 LPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY +LD II+  VEN+ S        Y    +  V  ++  +EYKRRQ+PVG +IT K
Sbjct: 457 LPPYDVLDAIIEAYVENDLSRAEIVALGYPISDINRVIAMIDRNEYKRRQSPVGVRITDK 516

Query: 542 SFGRDRLYPISNKFRDH 558
            FG+DR YPI+ K  ++
Sbjct: 517 GFGKDRRYPITAKLSEY 533


>gi|145297764|ref|YP_001140605.1| NAD synthetase [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142850536|gb|ABO88857.1| NH(3)-dependent NAD+ synthetase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 540

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 230/556 (41%), Positives = 337/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M K L + +AQLN  VG I  N  K   A  +A +QG DL++ +EL ++GYPPEDL+ + 
Sbjct: 1   MAKALSLMLAQLNLTVGAIEDNCDKVLAAAVQAEQQGADLLVCSELALTGYPPEDLLLRS 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +    +A+  +   T  G   I+VG P ++   + N+  + + G ++A   K +LPNY
Sbjct: 61  DLMIRVDAALARIA--TWQGRCAILVGHPWREGAALYNAASLYEQGKLVARYFKQDLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G     + FR  +LG+LICED+W+   +    K  GAE L ++NASPY 
Sbjct: 119 GVFDEKRYFTAGTDTCVVPFRGHKLGLLICEDLWQPGPVLAA-KAAGAELLLTINASPYD 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R E++T + S   LP++Y+NQV GQDELIFDG S  F+ Q +L  ++  F+E+ 
Sbjct: 178 QEKPWIRRELMTERCSQTGLPLVYLNQVCGQDELIFDGCSKVFNSQGELTHKLAPFAEEL 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +  +   Q + +    +         PL+     Y A VL++ DY+ KN F   ++GLS
Sbjct: 238 ALVHFADGQPVKEREPAA---------PLEPLAETYQALVLAVHDYITKNGFQGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIA DA+G + VQ +M+P++YT+  S+EDA   A+ +G ++D++ I  +  
Sbjct: 289 GGIDSALTLAIAADAIGADKVQAVMMPFRYTAQMSVEDAKEQAERMGVEFDIISIEPMFE 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + ++            EN+Q+R RG +LMALSN  + ++LTT NKSE++VGY TLYG
Sbjct: 349 GFMTQLAPLFAGTARDTTEENLQARCRGVLLMALSNKRRRIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L  +RNS         +  VIP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLCEYRNS---------VDYVIPQRVIDRPPSAELAPDQVDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I+KR VE + S  +   E + +  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILKRYVEEDASVADMVAEGFEEVVVRKVIRLVDLNEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|313200694|ref|YP_004039352.1| nad+ synthetase [Methylovorus sp. MP688]
 gi|312440010|gb|ADQ84116.1| NAD+ synthetase [Methylovorus sp. MP688]
          Length = 540

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 232/556 (41%), Positives = 331/556 (59%), Gaps = 25/556 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +++AIAQ+N VVGD+AGN A+      EA   G  L+L  EL +SGY P+DL+ ++ F  
Sbjct: 1   MQVAIAQINCVVGDLAGNAARILSYAHEAKAAGASLMLTPELALSGYSPQDLLLREDFTH 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
            C   +  L +        +VVG P ++     N+  +L  G I+    K  LPN+S F 
Sbjct: 61  HCQRELQAL-AKALPADITVVVGHPHREHGRCYNAASVLQGGRIVLTYHKHALPNHSVFD 119

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E R F  G        + +R GILIC D+W+     K  K+ GAE L  LNASP++  K 
Sbjct: 120 EVRYFSPGNKAGVFEHQGVRCGILICADVWE-PGPAKVSKQAGAELLLVLNASPFHLEKQ 178

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           ++R++++  ++    LP++Y N VGGQDEL+FDG S   D       Q+  F+EQ  +  
Sbjct: 179 QQRYKVLGKRVEETGLPLVYANLVGGQDELVFDGNSVVIDRCGAPVQQLPAFTEQLALVS 238

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
                Q ++ N +  + A      L  EE+ Y A  L LRDYVQKN F   ++GLSGGID
Sbjct: 239 IDLSPQ-NRANPLPAEIAPG----LTREESAYQALTLCLRDYVQKNGFPGAVLGLSGGID 293

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL  AIAVDALG + V  +M+P ++T+  S++DA   A+ LG KY  LPI  L + F +
Sbjct: 294 SALTLAIAVDALGADKVHAVMMPSEFTADMSVDDARQMAQLLGVKYTELPIKPLFDQFCA 353

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +++        +  EN+Q+RIRG +LMALSN   +++LTT NKSE++VGY TLYGDM+G
Sbjct: 354 TLAEPFTGTSFDLTEENLQARIRGMLLMALSNKFGSIVLTTGNKSEMAVGYSTLYGDMAG 413

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF  LKD+ KT V++LA +RNS         L++VIP  I+ + PSAELR  QTDQ+SLP
Sbjct: 414 GFAVLKDISKTLVYRLARYRNS---------LSQVIPERIIIRPPSAELRHGQTDQDSLP 464

Query: 485 PYPILDDIIKRIVENEESFINNDQE-----YNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           PY +LD I++  VE + S     QE     Y ++ V  V +L+  +EYKRRQ+P+G ++T
Sbjct: 465 PYDVLDAIMEAYVERDSS----RQEIIAMGYREQDVARVLNLIDRNEYKRRQSPIGVRVT 520

Query: 540 AKSFGRDRLYPISNKF 555
            + FG DR YP+ ++F
Sbjct: 521 ERGFGLDRRYPVVSRF 536


>gi|237745825|ref|ZP_04576305.1| NAD+ synthase [Oxalobacter formigenes HOxBLS]
 gi|229377176|gb|EEO27267.1| NAD+ synthase [Oxalobacter formigenes HOxBLS]
          Length = 537

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 237/558 (42%), Positives = 333/558 (59%), Gaps = 30/558 (5%)

Query: 6   KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQA 65
           K+AIAQ+N  VGD++GN A+  +   EA  +G D++L  EL ++GYPPEDL+ + SF  A
Sbjct: 4   KVAIAQINSTVGDLSGNRARIAQFAREAAAKGADIVLTPELSLTGYPPEDLLLQHSFHSA 63

Query: 66  CSSAIDTLKSDTHD-GGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
               +D LK++  D     ++VG          N+  IL  G+II    K  LPNY+ F 
Sbjct: 64  TRLELDRLKNELADLDNVHVLVGHHCIRDGLCYNACSILANGSIIGTYFKQELPNYTVFD 123

Query: 125 EKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           EKR F  G   +P+VF  + +  G+ ICEDIW      +  +  GA+ L  +N+SPY+  
Sbjct: 124 EKRYFTPG--TEPLVFHVKGVSFGVTICEDIWF-PEPAERTRAAGADVLLIMNSSPYHMG 180

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K+ +R  IV   + H  L  +YVN VGGQDELIFDG SF  +   ++  Q+K   E    
Sbjct: 181 KMHQRPVIVRQNVIHHGLAALYVNLVGGQDELIFDGCSFAMNRDGKVCVQLKQCEE---- 236

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
                D ++  +   +  +      P  E+E  Y A VL +RDYV KN F  VIIGLSGG
Sbjct: 237 -----DMEIVSFENGNPVNGRMEEHPTVEKEV-YRALVLGVRDYVNKNGFPGVIIGLSGG 290

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           +DSAL  AIAVDALG E V+TIM+P  YTS  S  DA+  A  +   YD +PI D  + F
Sbjct: 291 VDSALVLAIAVDALGPEKVRTIMMPSPYTSEISRIDASDMAARMKVSYDEIPITDCFSSF 350

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
              ++      P     EN+Q+RIRG +LMALSN   +++LTT NKSE++VGY TLYGDM
Sbjct: 351 LQTLAPQFANLPEDSTEENLQARIRGTLLMALSNKFGSIVLTTGNKSEMAVGYCTLYGDM 410

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF  +KD+YKT V++L  +RN+         +++VIP  +L ++P+AEL+P+Q DQ++
Sbjct: 411 AGGFAVIKDIYKTLVYRLCRYRNT---------ISDVIPERMLTRAPTAELKPNQFDQDT 461

Query: 483 LPPYPILDDIIKRIVENEES---FINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           LPPY +LD I+K  +E  +S    + N   Y+   V  +  L+  +EYKRRQAP+G +IT
Sbjct: 462 LPPYEVLDAIVKMFMEENKSVNEIVRNG--YSHIVVERIVRLMRINEYKRRQAPIGIRIT 519

Query: 540 AKSFGRDRLYPISNKFRD 557
            + FGRD   PI++KFRD
Sbjct: 520 PRGFGRDWRCPITSKFRD 537


>gi|117926867|ref|YP_867484.1| NAD+ synthetase [Magnetococcus sp. MC-1]
 gi|117610623|gb|ABK46078.1| NAD+ synthetase [Magnetococcus sp. MC-1]
          Length = 577

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 242/582 (41%), Positives = 331/582 (56%), Gaps = 37/582 (6%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           +  +AIAQ+N  VG +  N      A + A R G  L+LF EL ++GYPPEDL+ K SF+
Sbjct: 2   EFTLAIAQINAHVGALEKNRLAMVSAAKHARRMGAKLVLFPELALTGYPPEDLLHKPSFL 61

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVL-NSVVILDAGNIIAVRDKINLPNYSE 122
           +        L+    + G   + G PR++  G L N+  +++ G    +  K  LPNY  
Sbjct: 62  RRVEQEELELRDALREIGVDAIYGVPRRNAAGTLWNAAALIEQGIESQLCIKQALPNYGV 121

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F E+R F  G       +++I +GI ICEDIW+       L +QGA+ + +LNASPY   
Sbjct: 122 FDERRYFEPGGETHSFNYQEIPMGINICEDIWQAKGAAAQLARQGAKLIINLNASPYRVG 181

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K + R EI+  ++    LP+IYVN VGGQDEL+FDG SF  D   +L  + + FSE+  +
Sbjct: 182 KWQDREEIIRARVQETGLPVIYVNLVGGQDELVFDGGSFAMDHTGKLVERCRFFSEELRL 241

Query: 243 TEWHYD-QQLSQWNYMS--DDSASTMYIPLQE----------EEAD---------YNACV 280
               +D Q    W  +   D+    +  P++           E+ +         Y A  
Sbjct: 242 MRVKWDGQNPVVWVPVHGIDNGPVRLVAPMEGGDWRAPRAHGEDVEPPMEPLHEIYTAMK 301

Query: 281 LSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAA 340
           + L DYV+KN F  V++GLSGG+DSAL AA+AVDALG + V+++M+P  +TS +SL DA 
Sbjct: 302 IGLHDYVRKNGFQGVVLGLSGGVDSALTAAVAVDALGADKVESVMMPSAFTSGESLSDAE 361

Query: 341 ACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEE----PSGIVAENIQSRIRGNILMALSN 396
            CA  LG K   L I  L    F L  Q L EE    P  +  EN+Q RIRG +LMALSN
Sbjct: 362 LCAANLGIKLGNLTIGPL----FELFKQTLAEEFAGLPEDVTEENLQPRIRGTLLMALSN 417

Query: 397 HSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPL 456
               +LLTT NKSE+SVGY TLYGDM+GG++ LKDL KT VF+L  WRN      G  PL
Sbjct: 418 KKGTLLLTTGNKSEMSVGYATLYGDMAGGYSVLKDLLKTTVFELCEWRNEQARKEG-KPL 476

Query: 457 TEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESF--INNDQEYNDET 514
              IP +I++K P+AELR  Q D +SLPPY ILD I+   VE EE    I        E 
Sbjct: 477 P--IPQNIIDKPPTAELRHDQKDTDSLPPYDILDTILHHYVELEEGLDEIVAAGIERAEA 534

Query: 515 VRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           VR +  ++  +EYKRRQAP G +I  ++FG+ R YP++N F+
Sbjct: 535 VRVIA-MVDRNEYKRRQAPPGVRIVDRNFGKARRYPLTNGFK 575


>gi|187478133|ref|YP_786157.1| NAD synthetase [Bordetella avium 197N]
 gi|115422719|emb|CAJ49246.1| glutamine-dependent NAD synthetase [Bordetella avium 197N]
          Length = 542

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 233/563 (41%), Positives = 334/563 (59%), Gaps = 26/563 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  +++ IAQ+N  VGD+AGN A+  +A  EA  +G D++L  EL ++GYPPEDL+ +  
Sbjct: 1   MSVVRVGIAQINACVGDLAGNAARVLKAAREAYGRGADILLTPELVLTGYPPEDLLLRPL 60

Query: 62  FIQACSSAIDTLKSDTHD-GGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           FI+   + +  L +D     G  ++VG   + +  + N+  +L  G ++    K  LPNY
Sbjct: 61  FIERQQAVLAQLAADLAGLPGLHVLVGHVERREGHLYNAASVLCEGRVLGSYRKRELPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           S F E+R F+S     P+VF  + +R+G+ ICEDIW +           A+ L   NASP
Sbjct: 121 SVFDEQRYFLS--DTQPLVFEVKGVRVGVNICEDIWFDRAPQAAADAG-AQVLLVPNASP 177

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K  +R  +    ++     ++Y N VGGQDEL+FDGASF  D + +L+ ++  F+E
Sbjct: 178 YNLGKPTERLTVARRVVAATGCSLVYANLVGGQDELVFDGASFALDREGRLSARLPDFAE 237

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIP-LQEEEADYNACVLSLRDYVQKNNFHKVII 297
                       L   +      AS +  P L EEE  +NA VL  RDY+ KN F   II
Sbjct: 238 ---------GLSLVDVDARGAVGASAVVAPSLSEEEQVWNALVLGTRDYLGKNRFPGAII 288

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSA+  AIAVDA+G +NV+ +M+P +YT+  SL DA   A+ LG +YD + I  
Sbjct: 289 GLSGGIDSAVVLAIAVDAVGADNVRAVMMPSRYTADISLTDARDMAQRLGVRYDEIVIGP 348

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           +V+ F + ++      P     ENIQ+R RG +LMALSN +  ++LTT NKSE+S GY T
Sbjct: 349 IVDAFETALAPQFAGLPVDATEENIQARARGTLLMALSNKTGQLVLTTGNKSEMSTGYCT 408

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGF  +KD+ KT V++LA WRN+          +++IP  I+ + PSAELRP Q
Sbjct: 409 LYGDMAGGFAVIKDVPKTLVYRLAVWRNTK---------SDIIPERIITRPPSAELRPDQ 459

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGT 536
           TDQ+SLP Y +LD I+ R +E   S  +   E Y    V  V  L+  +EYKRRQAP G 
Sbjct: 460 TDQDSLPSYDVLDGIVLRHMEQNASAADLLAEGYPPAAVEQVLRLIRINEYKRRQAPPGP 519

Query: 537 KITAKSFGRDRLYPISNKFRDHI 559
           ++TA++FGRD  YP++N FRD +
Sbjct: 520 RVTARAFGRDWRYPVTNGFRDAV 542


>gi|254517171|ref|ZP_05129229.1| NAD+ synthetase [gamma proteobacterium NOR5-3]
 gi|219674676|gb|EED31044.1| NAD+ synthetase [gamma proteobacterium NOR5-3]
          Length = 540

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 237/559 (42%), Positives = 337/559 (60%), Gaps = 29/559 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSFI 63
           + I +AQ+N  VGD  GN  +   A E+A  Q    +++F EL +SGYPPEDL+ + +  
Sbjct: 1   MHILMAQINTTVGDFTGNTDQVIVAAEQACAQHDSPIVVFPELTLSGYPPEDLLLRPALC 60

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +  S A++ L SD   G A ++VG+P + +  + N   ++  G ++A   K  LPNY  F
Sbjct: 61  KRVSDALERLCSDLP-GSAWVIVGYPIRREGALYNCAGVIHQGELVAEYRKCELPNYQVF 119

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            EKR F +G     +    +R+G+ ICEDIW            GA+ L +LNASPY+  K
Sbjct: 120 DEKRYFTAGSQPCVLDIEGVRVGLSICEDIWVPGPT-AATAAAGAQLLINLNASPYHRGK 178

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
            ++R E+V+ +     L ++YVNQVGGQDEL+FDG SF  + +  +A Q   F  QN  T
Sbjct: 179 QQQRLELVSQRCKDNKLAVVYVNQVGGQDELVFDGGSFAMNPEGSVAVQAPRF--QNATT 236

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
              Y  +       +    S++  PL E  A + A VL +RDYV KN F  V++GLSGG+
Sbjct: 237 WCEYSGEAGAGALRT----SSIEPPLDELAAIWQALVLGMRDYVNKNGFPGVVLGLSGGV 292

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL  A+AVDALG E VQ +M+P++YTS  S+ DAA  +  LG ++ V+ I  +   F 
Sbjct: 293 DSALTLAVAVDALGPERVQAVMMPFRYTSDISIADAAQQSATLGVRHSVISIEPIYESFL 352

Query: 364 S-LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
           + L  +F   EP     EN+Q+R RG +LM+LSN  ++++LTT NKSE++VGY TLYGDM
Sbjct: 353 AALQDEFAGLEPD-TTEENLQARCRGVLLMSLSNKKRSLVLTTGNKSELAVGYSTLYGDM 411

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF+ LKD+ KT V+ L  +RNS      LGP    IP  ++E+ PSAEL P Q D++S
Sbjct: 412 AGGFDVLKDVPKTLVYALCHYRNS------LGP---CIPERVIERPPSAELAPDQKDEDS 462

Query: 483 LPPYPILDDIIKRIVENE---ESFINN--DQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           LPPY +LD I++  VE +   E+ I    D+   +  VR V+     +EYKRRQAPVG +
Sbjct: 463 LPPYEVLDRILELYVERDYSAEAIIAEGIDRADVERAVRLVDI----NEYKRRQAPVGVR 518

Query: 538 ITAKSFGRDRLYPISNKFR 556
           IT + FGRDR YPI++ +R
Sbjct: 519 ITQRGFGRDRRYPITSAWR 537


>gi|225849058|ref|YP_002729222.1| glutamine-dependent NAD(+) synthetase (NAD(+)
           synthase[glutamine-hydrolyzing]) [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225644679|gb|ACN99729.1| glutamine-dependent NAD(+) synthetase (NAD(+)
           synthase[glutamine-hydrolyzing]) [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 574

 Score =  415 bits (1067), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 236/587 (40%), Positives = 339/587 (57%), Gaps = 45/587 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           ++K+++A+ Q+NP+VGD   N+ K     ++A    +D+I F EL ++GYPPEDL+ K S
Sbjct: 1   MRKIRVALGQINPIVGDFDYNLQKILDYIKKAKDLQVDIIAFPELALTGYPPEDLILKPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+     I  L  +  D    ++VGF  + +E + N+  I+   NIIA   K  LPNY 
Sbjct: 61  FIEKNLQYIKKLTENVED--IVVIVGFIDK-KEDIYNAAAIIHNKNIIATYHKQFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F  G           + G+ ICEDIW   N       +G E +F++NASPY  
Sbjct: 118 VFDENRYFQKGNGLTVFEIEGYKFGVSICEDIWYPENPINTYAVEGCEVIFNINASPYSE 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+KKR E++  +     + I YVN VGGQDEL+FDG SF  +   ++  + + F E   
Sbjct: 178 GKVKKREELLKVRSRDNLVSIAYVNLVGGQDELVFDGNSFFVNPNGEILGKGESFKEDLV 237

Query: 242 MTEWHYDQ----QLS-------QWNYMSDDSASTMYIPLQEEEAD--------------- 275
           + +   D+    QL        +  Y   D  + + +  Q +E                 
Sbjct: 238 VADIDLDEIFRYQLKDNRLKNLRSEYRRSDKVNYIKVDYQIKEKTVNIEQKIVLDKPDIE 297

Query: 276 --YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             YN  VL LRDY+ KN F KV+IGLSGG+DS+L A IAVDALG ENV+ +++P  YTS 
Sbjct: 298 NTYNTLVLGLRDYITKNGFKKVVIGLSGGVDSSLVATIAVDALGNENVKGVLMPSPYTSK 357

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMA 393
           +S+EDA   AK L  +  ++PI ++   +     +  +        EN+Q+RIRGNILMA
Sbjct: 358 ESIEDALELAKNLNIETFIIPITNIFQTYLDEFKEIFKGLKPDTTEENLQARIRGNILMA 417

Query: 394 LSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGL 453
           LSN    ++L T NKSE+SVGY TLYGDM GGF  +KD+ KT+V+QL  +RNS       
Sbjct: 418 LSNKFGWIVLATGNKSEMSVGYSTLYGDMVGGFAVIKDVLKTKVYQLCEYRNS------- 470

Query: 454 GPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENE---ESFINNDQEY 510
             +++VIP  +L K PSAELRP+QTD+  L PY ILD+IIK  VE +   E  I     +
Sbjct: 471 --ISKVIPDRVLIKPPSAELRPNQTDEAELAPYHILDEIIKMYVEQDCSVEEIIK--AGF 526

Query: 511 NDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           +++TV+ +  L+  +EYKRRQ+P+G KIT ++FG+DR  PI+N+F++
Sbjct: 527 DEKTVKKIVKLIDTNEYKRRQSPIGIKITERAFGKDRRMPITNRFKE 573


>gi|329895227|ref|ZP_08270891.1| Glutamine amidotransferase chain of NAD synthetase [gamma
           proteobacterium IMCC3088]
 gi|328922465|gb|EGG29807.1| Glutamine amidotransferase chain of NAD synthetase [gamma
           proteobacterium IMCC3088]
          Length = 546

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 228/561 (40%), Positives = 328/561 (58%), Gaps = 17/561 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFK 59
           M + +++ +AQ N  VGD  GN+A  +   E A  +    +I+F EL ++GYPPEDL+ +
Sbjct: 1   MTEAMQLVLAQCNTHVGDFEGNLALCKSIVERAQSEFSRPVIVFPELTLTGYPPEDLLLR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
            S       A+  L        A ++VG+PR+    + N+  ++  G +I    K  LPN
Sbjct: 61  PSIEPRVQVALSQLCDVVTT--AYVIVGYPRRIDGVLYNAAGVIHQGALIGEYHKWCLPN 118

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           Y  F EKR F  G     +    +++G+ ICEDIW         K  GAE + +LNASP+
Sbjct: 119 YQVFDEKRYFEPGTEPCVVAIHGVQVGLSICEDIWAPEPALAA-KTAGAELILNLNASPF 177

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           +  K  +R  IV  +++   +P++YVNQVGGQDEL+FDG SF  + Q Q+  Q+  F + 
Sbjct: 178 HRCKQNERLSIVAERVAETGIPVVYVNQVGGQDELVFDGGSFVMNSQGQVIKQLPRFDDA 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
             M  + +         ++D  A      LQE    + A V+ +RDYV KN F  V++GL
Sbjct: 238 CEMVTYPFGPADVSEQAVTDQLAGFALTDLQEV---WQALVVGVRDYVNKNGFPGVVLGL 294

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGG+DSAL  A+A  ALG + VQ +M+P+KYTS  SLEDAA  A  +G  Y V+PI  + 
Sbjct: 295 SGGVDSALTLAVAEAALGADRVQAVMMPFKYTSQMSLEDAAEQANRMGVNYSVIPIEPIY 354

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F S + +  +        EN+Q+R RG +LM++SN +  ++LTT NKSEI+VGY TLY
Sbjct: 355 NAFMSALEEEFEGRKPDTTEENLQARARGVVLMSISNKTGKLVLTTGNKSEIAVGYSTLY 414

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGF+ LKD+ KT VF L  +RNS      LGP    IP  ++ + PSAEL P Q D
Sbjct: 415 GDMAGGFDVLKDVPKTLVFALCWYRNS------LGP---CIPERVITRPPSAELAPDQKD 465

Query: 480 QESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           ++SLPPY +LD II   VE + S  N  D+ + +  V     L+  +EYKRRQAP+G ++
Sbjct: 466 EDSLPPYEVLDQIIDLYVEQDCSAQNIIDKGFAEADVHRAVRLIDLNEYKRRQAPIGVRL 525

Query: 539 TAKSFGRDRLYPISNKFRDHI 559
           T + FGRDR YPI++K++  +
Sbjct: 526 TRRGFGRDRRYPITSKWKPGV 546


>gi|82703650|ref|YP_413216.1| NAD+ synthetase [Nitrosospira multiformis ATCC 25196]
 gi|82411715|gb|ABB75824.1| NAD+ synthetase [Nitrosospira multiformis ATCC 25196]
          Length = 538

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 233/562 (41%), Positives = 326/562 (58%), Gaps = 33/562 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+AIAQ+N  VGD+ GN  K      +A   G  L++  EL +SGYPPEDL+ +  F  
Sbjct: 1   MKLAIAQINCTVGDLGGNTRKILDYANQAKNAGARLVVTPELALSGYPPEDLLLRHGFRH 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC +A+  L   T D    +VVG P    + + N+  ++  G IIA   K  LPN S F 
Sbjct: 61  ACQNALTELAGKTGD--ITVVVGHPHLAADKLYNAASVIRNGKIIATYLKNLLPNDSVFD 118

Query: 125 EKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           E+R F  G+   P VF    IR  I IC+DIW+  +  +  K+ GAE L  LNASPY+ N
Sbjct: 119 ERRYFEPGFR--PCVFELDGIRFAINICQDIWQEGSATRA-KEGGAEVLLVLNASPYHMN 175

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K   R+++   +I    L I+Y N +GGQDELIFDGASF  + +  +  Q     E   M
Sbjct: 176 KQALRYDLARKRIDETGLSIVYANLIGGQDELIFDGASFAMNARGDVTHQFDALVEALGM 235

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGLSG 301
            E                  +T   PL+  EA+ Y A  L ++DY+ KN    V++GLSG
Sbjct: 236 VELE-----------GAAPVTTEIAPLESLEANVYKALCLGVKDYIGKNRIPGVLLGLSG 284

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           G+DSAL   IA DALG + V+ +M+P ++T+  SL DA   A+ LG +Y   PI  +   
Sbjct: 285 GVDSALTMTIAADALGADKVKAVMMPSRFTADMSLLDARTMAQTLGVRYTEFPIEPVFGE 344

Query: 362 FF-SLMSQFLQEEPSGI---VAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           F  +L  +F    PS +     EN+Q+RIRG +LMALSN S A++L T NKSE +VGY T
Sbjct: 345 FKDTLAKEFAALPPSDVPDLTEENLQARIRGTLLMALSNKSGAIVLITGNKSETAVGYST 404

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGD +GGF  LKD+ KT V++L  +RN  G         +VIP  +L ++PSAELRP Q
Sbjct: 405 LYGDTAGGFAVLKDVTKTMVYKLCQYRNGVG---------KVIPDRVLSRAPSAELRPDQ 455

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           TDQ+SLPPY +LD I++  VE++ S        Y++   R V  L+  +EYKRRQ+P G 
Sbjct: 456 TDQDSLPPYAVLDAILEEYVEHDMSLEEILRMGYDERDARRVVQLIRQNEYKRRQSPPGI 515

Query: 537 KITAKSFGRDRLYPISNKFRDH 558
           ++T+++FG+D  YPI+ +++D 
Sbjct: 516 RVTSRAFGKDWRYPITARYQDQ 537


>gi|88811118|ref|ZP_01126374.1| NAD(+) synthetase [Nitrococcus mobilis Nb-231]
 gi|88791657|gb|EAR22768.1| NAD(+) synthetase [Nitrococcus mobilis Nb-231]
          Length = 543

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 233/560 (41%), Positives = 326/560 (58%), Gaps = 26/560 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGN----IAKARRAREEANRQGMDLILFTELFISGYPPEDL 56
           M  +L+IA+AQLN +VGD+ GN    I  A RAR+E   +   +++F EL ++GYPP+DL
Sbjct: 1   MNDRLRIAMAQLNLLVGDVRGNTLAVIDAACRARDELRAR---VVIFPELALTGYPPDDL 57

Query: 57  VFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKIN 116
           + +  F+   S+AI  L     D    ++VG P +   G++N+ ++++ G I A   K  
Sbjct: 58  LLRNDFLGEVSAAIAQLCRAVRD--VTLIVGAPVRSATGLMNAALVIEQGRIAATYAKHY 115

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LP Y  F + R F  G +   +     R+G+ ICED W    +   ++  GAE + +LNA
Sbjct: 116 LPTYGVFDDTRYFEPGSAPCVVEVAGCRIGVTICEDAWHPEPVAWAVQ-MGAEVVVNLNA 174

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SP+   K   R  ++  +I    + ++Y N  GGQDE+++DGAS  F     L  +   F
Sbjct: 175 SPFDQYKRAAREAVIRERIGESGVAMLYCNMAGGQDEVVYDGASCAFGRHGDLRVRAPRF 234

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
             +  +      Q+   W  +     S    P  EE   Y+A V  +RDYV+KN F  VI
Sbjct: 235 --RPGLVPVDLLQRGGGWEALE---GSIEEDP-SEEAVLYDALVWGVRDYVEKNGFPGVI 288

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           IGLSGGIDSAL   +AVDALG E V+T+M+P +YTS  S  DAAA A +L  ++ V+ I 
Sbjct: 289 IGLSGGIDSALVTCVAVDALGAERVETVMMPTQYTSEISWTDAAALAGSLRIRHRVIAIE 348

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            +   F   +     + P+ +  EN+QSRIRG +LMALSN    ++L T NKSE++VGY 
Sbjct: 349 GVFKAFSETLQPVFADAPADVTEENLQSRIRGTLLMALSNKQGKLVLATGNKSELAVGYA 408

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM GGF PLKD++KT V+ LA +RN  G         EVIP SIL + PSAELRP+
Sbjct: 409 TLYGDMVGGFAPLKDIFKTDVYSLARYRNELG---------EVIPQSILTRPPSAELRPN 459

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q D +SLP Y +LD I+   VE + S      E Y+  TV  V  L++ +EYKRRQAP G
Sbjct: 460 QLDTDSLPEYIVLDTILAAYVEEDRSVEEIVAEGYDRATVEEVVRLVHRNEYKRRQAPPG 519

Query: 536 TKITAKSFGRDRLYPISNKF 555
            K+T K+FGRDR YPI++ F
Sbjct: 520 VKVTTKAFGRDRRYPITSGF 539


>gi|90022198|ref|YP_528025.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Saccharophagus degradans 2-40]
 gi|89951798|gb|ABD81813.1| NAD+ synthetase [Saccharophagus degradans 2-40]
          Length = 540

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 238/565 (42%), Positives = 338/565 (59%), Gaps = 38/565 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKA-RRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           +  L IA+AQ+NP+VGDI GN       A   AN+   D+I+F EL ++GYPPEDL+ + 
Sbjct: 1   MSTLNIALAQINPLVGDIDGNTQLIIDEALALANKH--DVIVFPELTLTGYPPEDLLLRP 58

Query: 61  SFIQACSSAID-TLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
           S       AI   L S+     A +VVG+P+++   + N   +L  G ++    K  LPN
Sbjct: 59  SIALRVDRAIQQILDSNIS---AAVVVGYPKREGGKLFNMAGVLAQGQVLFEYAKQCLPN 115

Query: 120 YSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           Y  F EKR F +G  + P VF+   + LG+ ICEDIW  S +   L+      + +LNAS
Sbjct: 116 YQVFDEKRYFEAG--SKPGVFQLNGVNLGLSICEDIWDGSPL-DQLQSADVHAVLNLNAS 172

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           P++  K  +R  ++  +   +  PI+YVNQVGGQDEL+FDG S     Q ++  + + F 
Sbjct: 173 PFHQEKQAEREALIAARAKKLGAPILYVNQVGGQDELVFDGGSMVATAQGEIVGRTELFK 232

Query: 238 EQNFMTEW-----HYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNF 292
                 E          Q S+  + +D  A T           Y A V+ +RDYV KN F
Sbjct: 233 NACLSVELDTATKQVSPQASKSGHPADPLADT-----------YEALVVGVRDYVNKNRF 281

Query: 293 HKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDV 352
             V++GLSGGIDSAL  AIAVDALGKE V+ +M+P+KYTS  SL+ A   A+ LG KY V
Sbjct: 282 KGVVLGLSGGIDSALTLAIAVDALGKERVEAVMMPFKYTSQLSLDGAEDEARRLGVKYRV 341

Query: 353 LPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEIS 412
           + I  + + F   +++  + +      ENIQ+R RG +LMALSN    ++LTT NKSE++
Sbjct: 342 IHIEPMYDAFTQALNEAFEGQQKDTTEENIQARSRGVLLMALSNKLGYLVLTTGNKSEMA 401

Query: 413 VGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAE 472
           VGY TLYGDM+GG + LKD+ KTQVF L+ +RN+ G         EVIPP+++++ PSAE
Sbjct: 402 VGYATLYGDMAGGLDVLKDVPKTQVFALSRYRNTLG---------EVIPPAVIDRPPSAE 452

Query: 473 LRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQ 531
           L P Q D++SLPPY ILD I++  +E +ES  +   + ++ E V  V  L+  +EYKRRQ
Sbjct: 453 LAPDQKDEDSLPPYEILDQILELYIEQDESAESIVAKGFDKEQVYRVLRLVDLNEYKRRQ 512

Query: 532 APVGTKITAKSFGRDRLYPISNKFR 556
           APVG +I+ ++FGRDR YPI+N ++
Sbjct: 513 APVGIRISKRAFGRDRRYPITNGWK 537


>gi|217077779|ref|YP_002335497.1| NAD synthetase [Thermosipho africanus TCF52B]
 gi|217037634|gb|ACJ76156.1| glutamine-dependent NAD+ synthetase [Thermosipho africanus TCF52B]
          Length = 576

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 225/584 (38%), Positives = 341/584 (58%), Gaps = 42/584 (7%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++  +AQLN  +GD  GN+ K   A E A     + ++F ELF++GYPPEDL+ + SF++
Sbjct: 3   IRTTVAQLNSTLGDFEGNMKKIISAIEIAENNNSEFLIFPELFLTGYPPEDLILRTSFLK 62

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
                ++ + + +      I++GF   + +   NS+ ++  G ++    K++LPNYS F 
Sbjct: 63  KNIEYLEKIINFSRGKNVIILLGFIDIEDDA-YNSLAVIRDGKLLGKYHKMHLPNYSVFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E R F SG     I + +I++GI ICEDIW       +    GA+ + + +ASPY+H K 
Sbjct: 122 ENRYFKSGNEIVIINYNNIKIGINICEDIWSPLGPMFYQAINGAQLILNASASPYFHGKR 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ----- 239
           + R   ++ +    H PI+Y N VGGQDE++FDG S       ++ F+ K F E+     
Sbjct: 182 ELRKNYLSKKSYDHHCPIVYCNMVGGQDEVVFDGGSVVTSSDGKIIFEGKPFEEEIFTID 241

Query: 240 -----NFMTEWHYDQQLSQWNYMSDDSASTMYI------------------PLQEEEADY 276
                N  T  H D +    N ++D   + +++                   L +EE  +
Sbjct: 242 IPIEDNLRTNLH-DPRRRYINIVNDKPINYIFVKSENINKLKPINYKNKNYTLTKEEEIF 300

Query: 277 NACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSL 336
            A  L L+DY+QKN F KV+IGLSGG+DS+L AAIAV+ALG +NV  I++P  Y+S  S+
Sbjct: 301 RAITLGLKDYIQKNGFKKVLIGLSGGMDSSLVAAIAVEALGNKNVVGILMPSMYSSSHSI 360

Query: 337 EDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSN 396
           EDA   A+ L  +Y ++ I D+   F + +    +     I  EN+Q+RIRG +LMA+SN
Sbjct: 361 EDAKKLAENLEIEYHIIKISDIYYSFKNSLKDIFKGTSEDITEENLQARIRGTLLMAVSN 420

Query: 397 HSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPL 456
               ++L T NKSEI+ GY TLYGDM GGF+P+KD+YKT V+++A W N           
Sbjct: 421 KFGYIVLATGNKSEIATGYSTLYGDMVGGFSPIKDIYKTDVYKIARWYNKF-------KG 473

Query: 457 TEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENE---ESFINNDQEYNDE 513
            E+IP ++  K PSAELRP Q DQ++LPPY ILD+I+K  +E E   +  IN  + ++ +
Sbjct: 474 KEIIPENVFIKPPSAELRPDQKDQDTLPPYEILDEILKMYIEKELSVDEIIN--KGFDKD 531

Query: 514 TVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           TV+YV  L+  +EYKRRQ  +G K++ +SFG+DR  PI+NK+R+
Sbjct: 532 TVKYVAKLVDRNEYKRRQGVIGVKVSERSFGKDRRMPITNKYRE 575


>gi|260553998|ref|ZP_05826263.1| glutamine-dependent NAD+ synthetase [Acinetobacter sp. RUH2624]
 gi|260404884|gb|EEW98389.1| glutamine-dependent NAD+ synthetase [Acinetobacter sp. RUH2624]
          Length = 541

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 235/557 (42%), Positives = 329/557 (59%), Gaps = 27/557 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTQKMIEQANQAKKQDADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L S+  D    +V GF  Q ++G   NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQL-SEVKD--IVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   + +  LN+SPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTVLVLNSSPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL I+YVNQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRKQTLSELAKQLHLNIVYVNQVGGQDDLIFDGTSFVSNQNGEIALQAPSFKEDL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
           ++ E+  D +L    Y   +SA     P  E  A+ Y   V++ RDYV+++ F  VI+GL
Sbjct: 237 YIAEFDRDTKL----YKVTESA-----PALETFAEIYQGLVMATRDYVERSGFPGVILGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +V
Sbjct: 288 SGGIDSALTLAIAVDAIGAERVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSIV 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSE+SVGY TLY
Sbjct: 348 NSFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSELSVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GGF  LKD+YKT VF+LA +RNS   T        VIP  ++ + PSAELRP Q D
Sbjct: 408 GDMVGGFAVLKDVYKTIVFELAKYRNSLSETP-------VIPERVITRPPSAELRPDQKD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           Q+SLP Y +LD I+   +  EE     D   + ++ E V  V  L+  +EYKRRQ  +G 
Sbjct: 461 QDSLPAYDVLDAILYAYI--EEDLGQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGP 518

Query: 537 KITAKSFGRDRLYPISN 553
           +IT+++F R+R YPI N
Sbjct: 519 RITSRAFSRERRYPIVN 535


>gi|114321696|ref|YP_743379.1| NAD+ synthetase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228090|gb|ABI57889.1| DNA-directed RNA polymerase, subunit H [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 541

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 229/553 (41%), Positives = 329/553 (59%), Gaps = 23/553 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEA-NRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           L++ +AQL   VGDI GN  +   A E A +R+G  L++F EL ++GYPP+DL+ +  F 
Sbjct: 3   LRVTMAQLTCPVGDIEGNTRRIVGAIETARDREGAQLVVFPELAVTGYPPDDLLLRDDFT 62

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +A  +A+  +++ +   G   VVG P +D+ G+ N+ V++  G +IA   K  LP YS F
Sbjct: 63  RAAENALQAIQAASR--GVTAVVGVPLRDRRGLHNAAVVVQDGRVIARYAKRELPTYSVF 120

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            + R F++G S   +     R+G+ ICEDIW  +   +     GAEF+ +LNASP++  K
Sbjct: 121 DDSRHFVAGDSPCVVDVAGTRVGLSICEDIWWPTP-AREAVAAGAEFVVNLNASPFHRRK 179

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
             +R  ++  +    H P++YVN VGG DE+++DG S   D    +  +   F       
Sbjct: 180 QAEREAVLRERALDTHRPLLYVNMVGGHDEVVYDGGSLAVDAGGTVQARAPRFRSGLCTV 239

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
           E   D      N   + S         EE A Y A V  LRDYVQ+N F  V++GLSGGI
Sbjct: 240 EVDTDH----GNVNGEQSTQP-----SEEGAVYQALVTGLRDYVQRNGFPGVVLGLSGGI 290

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSA+ AA+AVDALG + VQ +M+P +YT+P SL+DA A A+ LG +Y    I  +   F 
Sbjct: 291 DSAVAAAVAVDALGADRVQAVMMPSRYTAPMSLDDAQAIARMLGIRYQTTSIEPIFQSFL 350

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++   +     +  EN+QSRIRG +LMALSN +  M+L   NKSE++VGY TLYGDM 
Sbjct: 351 SSLAPSFEGLDPDVTEENLQSRIRGTLLMALSNKTGRMVLACGNKSELAVGYATLYGDMC 410

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GG+ PLKD+YKT+V++LA +R S         L    P +I  + P+AEL   Q D++SL
Sbjct: 411 GGYAPLKDVYKTEVYRLARYRQS---------LKPAFPDNIFSRPPTAELAAGQKDEDSL 461

Query: 484 PPYPILDDIIKRIVENEES-FINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           PPYP+LDDI++R VE++ES  +     +   TV  V  LL  +EYKRRQ+  G K+T ++
Sbjct: 462 PPYPVLDDILERYVEHDESEALIVAAGHEPATVAQVTRLLRRNEYKRRQSAPGPKVTPRA 521

Query: 543 FGRDRLYPISNKF 555
           FGRDR YPIS+ +
Sbjct: 522 FGRDRRYPISSGW 534


>gi|169796959|ref|YP_001714752.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Acinetobacter baumannii
           AYE]
 gi|184157129|ref|YP_001845468.1| NAD synthase [Acinetobacter baumannii ACICU]
 gi|213156635|ref|YP_002318296.1| glutamine-dependent NAD+ synthetase [Acinetobacter baumannii
           AB0057]
 gi|215484420|ref|YP_002326653.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter
           baumannii AB307-0294]
 gi|239501190|ref|ZP_04660500.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter
           baumannii AB900]
 gi|260555750|ref|ZP_05827970.1| glutamine-dependent NAD+ synthetase [Acinetobacter baumannii ATCC
           19606]
 gi|301347384|ref|ZP_07228125.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter
           baumannii AB056]
 gi|301513386|ref|ZP_07238623.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter
           baumannii AB058]
 gi|301596831|ref|ZP_07241839.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter
           baumannii AB059]
 gi|332854834|ref|ZP_08435584.1| NAD+ synthase [Acinetobacter baumannii 6013150]
 gi|332876339|ref|ZP_08444111.1| NAD+ synthase [Acinetobacter baumannii 6014059]
 gi|169149886|emb|CAM87777.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Acinetobacter baumannii
           AYE]
 gi|183208723|gb|ACC56121.1| NAD synthase [Acinetobacter baumannii ACICU]
 gi|213055795|gb|ACJ40697.1| glutamine-dependent NAD+ synthetase [Acinetobacter baumannii
           AB0057]
 gi|213986356|gb|ACJ56655.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter
           baumannii AB307-0294]
 gi|260410661|gb|EEX03959.1| glutamine-dependent NAD+ synthetase [Acinetobacter baumannii ATCC
           19606]
 gi|322507027|gb|ADX02481.1| NadE [Acinetobacter baumannii 1656-2]
 gi|323516895|gb|ADX91276.1| NAD synthase [Acinetobacter baumannii TCDC-AB0715]
 gi|332727766|gb|EGJ59171.1| NAD+ synthase [Acinetobacter baumannii 6013150]
 gi|332735458|gb|EGJ66513.1| NAD+ synthase [Acinetobacter baumannii 6014059]
          Length = 541

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 235/557 (42%), Positives = 329/557 (59%), Gaps = 27/557 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTQKMIEQANQAKKQDADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L S+  D    +V GF  Q ++G   NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQL-SEVKD--IVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   + +  LN+SPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTVLVLNSSPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL I+YVNQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRKQTLSELAKQLHLNIVYVNQVGGQDDLIFDGTSFVSNQNGEIALQAPSFKEDL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
           ++ E+  D +L    Y   +SA     P  E  A+ Y   V++ RDYV+++ F  VI+GL
Sbjct: 237 YIAEFDRDTKL----YKVVESA-----PALETFAEIYQGLVMATRDYVERSGFPGVILGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +V
Sbjct: 288 SGGIDSALTLAIAVDAIGAERVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSIV 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSE+SVGY TLY
Sbjct: 348 NSFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSELSVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GGF  LKD+YKT VF+LA +RNS   T        VIP  ++ + PSAELRP Q D
Sbjct: 408 GDMVGGFAVLKDVYKTIVFELAKYRNSLSETP-------VIPERVITRPPSAELRPDQKD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           Q+SLP Y +LD I+   +  EE     D   + ++ E V  V  L+  +EYKRRQ  +G 
Sbjct: 461 QDSLPAYDVLDAILYAYI--EEDLGQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGP 518

Query: 537 KITAKSFGRDRLYPISN 553
           +IT+++F R+R YPI N
Sbjct: 519 RITSRAFSRERRYPIVN 535


>gi|332868347|ref|ZP_08438106.1| NAD+ synthase [Acinetobacter baumannii 6013113]
 gi|332733453|gb|EGJ64632.1| NAD+ synthase [Acinetobacter baumannii 6013113]
          Length = 541

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 235/557 (42%), Positives = 329/557 (59%), Gaps = 27/557 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTQKMIEQANQAKKQDADLIIFHELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L S+  D    +V GF  Q ++G   NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQL-SEVKD--IVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   + +  LN+SPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTVLVLNSSPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL I+YVNQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRKQTLSELAKQLHLNIVYVNQVGGQDDLIFDGTSFVSNQNGEIALQAPSFKEDL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
           ++ E+  D +L    Y   +SA     P  E  A+ Y   V++ RDYV+++ F  VI+GL
Sbjct: 237 YIAEFDRDTKL----YKVVESA-----PALETFAEIYQGLVMATRDYVERSGFPGVILGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +V
Sbjct: 288 SGGIDSALTLAIAVDAIGAERVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSIV 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSE+SVGY TLY
Sbjct: 348 NSFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSELSVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GGF  LKD+YKT VF+LA +RNS   T        VIP  ++ + PSAELRP Q D
Sbjct: 408 GDMVGGFAVLKDVYKTIVFELAKYRNSLSETP-------VIPERVITRPPSAELRPDQKD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           Q+SLP Y +LD I+   +  EE     D   + ++ E V  V  L+  +EYKRRQ  +G 
Sbjct: 461 QDSLPAYDVLDAILYAYI--EEDLGQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGP 518

Query: 537 KITAKSFGRDRLYPISN 553
           +IT+++F R+R YPI N
Sbjct: 519 RITSRAFSRERRYPIVN 535


>gi|118602530|ref|YP_903745.1| NAD+ synthetase [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
 gi|118567469|gb|ABL02274.1| NAD+ synthetase [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
          Length = 626

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 230/558 (41%), Positives = 334/558 (59%), Gaps = 32/558 (5%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           K +KI IAQ+NP+VGD+ GN  K  +  +EA+ +G DL++F EL + GYPPEDL+ ++ F
Sbjct: 96  KSIKIDIAQINPIVGDLDGNTQKIIKLTKEAHIRGCDLLVFPELSLIGYPPEDLLLREEF 155

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           IQ     + TL S T      I+ G P +  + + N   ++    +  V  K NLPNY  
Sbjct: 156 IQQVQDKV-TLISQTISEDISIIFGAPSKKNDVLYNGAYLVQNSKL-WVYHKQNLPNYGV 213

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F  G+       +  R+G++ICED W    I      QGA+ + S+NASP+   
Sbjct: 214 FDEKRYFEPGHKAFIFECQGKRIGLVICEDAW-TPKIISTTANQGAQIIISINASPFQVG 272

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K  +R E +  ++       IYVN VG QDEL+FDGASF  +    +  Q+  F E+   
Sbjct: 273 KHSQRIEQIKQRVLTTKTNFIYVNMVGAQDELVFDGASFVMNSNADITLQLPLFKEK--- 329

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNN-FHKVIIGLSG 301
                         +S  S +T+      E+  YNA VL+ +DY++KN  F+ V++GLSG
Sbjct: 330 -----------IQSVSFTSPTTLPDTDPIEKTIYNALVLATKDYIEKNGVFNGVVMGLSG 378

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSAL  AIA DA+G  N++ IM+ Y+YTS  SLEDA   A A+   Y  + IH +V+ 
Sbjct: 379 GIDSALTLAIAADAIGTRNIKAIMMFYEYTSSMSLEDAKIQATAMNIDYHEISIHTIVDS 438

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F + ++       +    EN+Q+RIRG +LMA+SN    ++LTTSNKSE++VGY TLYGD
Sbjct: 439 FNTQLNILFNGMKADTTEENLQARIRGTLLMAISNKLGKIVLTTSNKSEMAVGYATLYGD 498

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           MSGGF PLKD+ KT V+QLA +RN+         L+ +IP  +++++PSAEL P+Q DQ+
Sbjct: 499 MSGGFAPLKDVSKTLVYQLAKYRNT---------LSTIIPKRVIDRAPSAELTPNQIDQD 549

Query: 482 SLPPYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           SLPPY  LD I++  +E     E  I   Q +N++TV+ +  ++  +EYKRRQ+  G KI
Sbjct: 550 SLPPYDELDAILELFIEQRYSVERIIK--QGFNEQTVKRIIQMVLNNEYKRRQSAPGPKI 607

Query: 539 TAKSFGRDRLYPISNKFR 556
           +  +FG++R YPI++KF+
Sbjct: 608 SQNAFGKERRYPITSKFQ 625


>gi|239815343|ref|YP_002944253.1| NAD+ synthetase [Variovorax paradoxus S110]
 gi|239801920|gb|ACS18987.1| NAD+ synthetase [Variovorax paradoxus S110]
          Length = 564

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 238/564 (42%), Positives = 320/564 (56%), Gaps = 20/564 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           LK+AIAQLN VVGD+AGN  K   A  +A+ QG  L+L  EL I+GY  EDL  + +F +
Sbjct: 3   LKLAIAQLNFVVGDLAGNARKIVDAARQAHAQGARLLLTPELSIAGYAAEDLFLRPAFTE 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFP-----RQDQEGV---LNSVVILDAGNIIAVRDKI 115
           AC  A+  + +   D     +VVG P     R     V    N+  ++  G I+    K 
Sbjct: 63  ACDDAVKGIAAALADLKDMVVVVGHPTGGSLRSRSVAVQMRYNAASVIKEGRILETYAKR 122

Query: 116 NLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLN 175
            LPNY  F E+R F  G          + +G+LICED W +    +  +  GAE L  +N
Sbjct: 123 ELPNYQVFDERRYFTPGQGTCVFEAGGVSVGVLICEDAWFDEP-AELARAAGAEVLAVIN 181

Query: 176 ASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKH 235
           ASPY+  K  +R   +  +   V LP++Y + VGGQDE++FDGASF       LA Q + 
Sbjct: 182 ASPYHVGKEGERVARMADRARAVGLPLVYAHLVGGQDEVVFDGASFALQADGALAMQAES 241

Query: 236 FSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKV 295
           F E     +     Q          + S +  P + E   ++A VL +RDY+ KN F   
Sbjct: 242 FKESLVFMQMERSPQ----GVEVVAAPSAIAAPREAEAQLWDALVLGVRDYIGKNGFPGA 297

Query: 296 IIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPI 355
           I+GLSGGIDSAL  AIAVDALGK+ V+ +M+P  YT+  S  DA   A  LG +YD + I
Sbjct: 298 ILGLSGGIDSALVLAIAVDALGKDKVRAVMMPSPYTADISWIDAREMATRLGVRYDEISI 357

Query: 356 HDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGY 415
                 F   ++   +  P     ENIQ+RIRG +LMALSN   +++LTT NKSE++ GY
Sbjct: 358 KHTFESFKGALADEFKGLPEDTAEENIQARIRGTLLMALSNKFGSIVLTTGNKSEMATGY 417

Query: 416 GTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG-ITSGLGPLTEVIPPSILEKSPSAELR 474
            TLYGDM+GGF  +KDL KT VF LA WRN+H    +G  P    IP  I+ + PSAELR
Sbjct: 418 CTLYGDMAGGFAVIKDLLKTTVFALARWRNAHDPYGTGASP----IPDRIITRPPSAELR 473

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAP 533
           P QTDQ+SLPPY ILD I+ R ++++E         Y    V  V  L+  +EYKRRQAP
Sbjct: 474 PDQTDQDSLPPYDILDGILARYMQDDEGIDEIIAAGYERAVVERVARLIKINEYKRRQAP 533

Query: 534 VGTKITAKSFGRDRLYPISNKFRD 557
           VG ++T +SFG+D  YPI++KF +
Sbjct: 534 VGIRVTHRSFGKDWRYPITSKFNE 557


>gi|91776238|ref|YP_545994.1| NH(3)-dependent NAD(+) synthetase [Methylobacillus flagellatus KT]
 gi|91710225|gb|ABE50153.1| NH(3)-dependent NAD(+) synthetase [Methylobacillus flagellatus KT]
          Length = 535

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 239/558 (42%), Positives = 320/558 (57%), Gaps = 34/558 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQ+N   GD+ GN AK       A   G  L+L  EL +SGY PEDL+ +  F  
Sbjct: 1   MKIAIAQINATAGDLTGNAAKIVEQARRAEAAGATLLLCPELALSGYSPEDLLLRDDFYH 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L  +       +VVG PR+      N+  +L+AG I     K  LPN S F 
Sbjct: 61  ACERALYALAQEL-PATLTVVVGHPRKYLGNRYNAASVLEAGRICHTYHKALLPNDSVFD 119

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E R F  G     I     +LGI+IC D+W      +  +  GA  L  LNASPY+  K 
Sbjct: 120 EVRYFSEGSEALVINHLGCKLGIVICADVWA-PEPARRARDAGATVLLVLNASPYHIGKQ 178

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           ++R+ +V  +I    LP++Y N VGGQDEL+FDGASF  + +  L  Q+  F E   +  
Sbjct: 179 QERYAVVRDRIKETGLPVVYANLVGGQDELVFDGASFVMNDEGALTQQLPSFDEALGIVS 238

Query: 245 WHYDQQLSQWNYMSDDSASTMYI-PLQE-EEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
           +            SD +     I PL   E A Y A  L  RDYV KNNF  V++GLSGG
Sbjct: 239 F------------SDGAPEPAEIHPLPGLEPAVYQALSLGFRDYVLKNNFPGVLLGLSGG 286

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL  AIAVDALG   VQ +M+P  +T+  SLEDA A A  L  +Y  + I  +   F
Sbjct: 287 IDSALTLAIAVDALGAGKVQAVMMPSAFTASISLEDAQAMAAGLNVRYSEIAIGPVFESF 346

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            + ++      P     EN+Q+RIRG +LMALSN   +M++TT NKSE +VGY TLYGDM
Sbjct: 347 CAALAPEFAGRPFDTAEENLQARIRGTLLMALSNKFGSMVVTTGNKSETAVGYSTLYGDM 406

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF  LKD+ KT V+QLA +RN+         +++VIP  I+ + PSAELR  QTDQ+S
Sbjct: 407 AGGFALLKDVSKTLVYQLAKYRNT---------ISQVIPERIILRPPSAELRHGQTDQDS 457

Query: 483 LPPYPILDDIIKRIVENEESFINNDQE-----YNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           LP Y +LD I++  VEN+ S+    +E     Y ++ V  V  L+  +EYKRRQAP+G +
Sbjct: 458 LPDYAVLDGIMEAYVENDYSW----EEILALGYREQDVLRVTRLVDRNEYKRRQAPIGVR 513

Query: 538 ITAKSFGRDRLYPISNKF 555
           +T + FG+DR YP++NKF
Sbjct: 514 VTKRGFGKDRRYPLTNKF 531


>gi|239617986|ref|YP_002941308.1| NAD+ synthetase [Kosmotoga olearia TBF 19.5.1]
 gi|239506817|gb|ACR80304.1| NAD+ synthetase [Kosmotoga olearia TBF 19.5.1]
          Length = 578

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 232/578 (40%), Positives = 337/578 (58%), Gaps = 40/578 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +++ +AQ+N  VGD+ GN+ K     + A ++G+ +++F EL I+GYPPEDLV +  FI+
Sbjct: 3   VRLGLAQINTTVGDLKGNVTKINEYIDLAEKKGVSILVFPELAITGYPPEDLVLRTGFIK 62

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
              SA++ ++  T D    +++GF   D E + N+  +L  G  +AV  K++LPNYS F 
Sbjct: 63  DNLSALEKVREYTIDKELLVILGFVDFDFE-IYNAAAVLHNGEKVAVYRKMHLPNYSVFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F +G     +  +++R+G+ ICED+W  S         GA  + +L+ASP+   K 
Sbjct: 122 EKRYFSAGKKALILRNKNLRIGVNICEDLWVPSGPINEQTIFGANLIINLSASPFTAGKS 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCF--DGQQQLAFQMKHFSEQNFM 242
           +KR E+++ + S     I Y N VGGQDEL+FDG S     DG+   +F  + F E+ F+
Sbjct: 182 RKRLELLSTRASEYSCAIAYCNLVGGQDELVFDGLSAVVLPDGR---SFIARGFEEELFI 238

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADY----------------------NACV 280
           T+   D       Y     +      L+E+E  +                      NA V
Sbjct: 239 TDLDLDIATRYNLYEGKRKSFKANAELEEKEISFTLRDNIEFLTSHRIAEGIEEIFNALV 298

Query: 281 LSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAA 340
           L LRDYV+KN F  V +GLSGG+DS+L A IAV+ALG+ENV  +++P +YTS  S+EDA 
Sbjct: 299 LGLRDYVKKNGFSTVTLGLSGGMDSSLAACIAVEALGRENVVGVLMPSEYTSNTSIEDAK 358

Query: 341 ACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKA 400
             AK LG K   +PI  + + +   +S   +     +  ENIQ+RIRGNILMALSN    
Sbjct: 359 MLAKNLGIKTLTVPITAIYHSYLGTLSDAFKGREQDVTEENIQARIRGNILMALSNKFGW 418

Query: 401 MLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVI 460
           ++L T NKSE++ GY TLYGDM+GGF  LKD+YKT V++LA + N           TE+I
Sbjct: 419 LVLATGNKSELATGYATLYGDMAGGFAVLKDVYKTDVYRLADYFNRT-------KKTEII 471

Query: 461 PPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN---DQEYNDETVRY 517
           P  + EK PSAELRP+QTDQ++LPPY  LD I+K  +  EE    N   +  +++ TV +
Sbjct: 472 PRRVFEKPPSAELRPNQTDQDTLPPYETLDKILKLFI--EEGLSANEILEHGFDNNTVNF 529

Query: 518 VEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
              LL  +EYKRRQ   G KI+ ++FG+D   PI+N +
Sbjct: 530 TLKLLKKNEYKRRQGAPGIKISRRAFGKDWRMPITNDY 567


>gi|134098194|ref|YP_001103855.1| glutamine-dependent NAD(+) synthetase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|291009113|ref|ZP_06567086.1| glutamine-dependent NAD(+) synthetase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|133910817|emb|CAM00930.1| glutamine-dependent NAD(+) synthetase [Saccharopolyspora erythraea
           NRRL 2338]
          Length = 610

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 230/600 (38%), Positives = 328/600 (54%), Gaps = 52/600 (8%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           ++ +L+IA+AQ+N  VGDIAGN +       EA +QG  L+ F E  ++GYP EDL  +K
Sbjct: 17  VMPQLRIALAQVNASVGDIAGNSSMVLDWTREAVQQGAHLVAFPETVLAGYPVEDLALRK 76

Query: 61  SFIQACSSAIDTLKSDTHDGGAG---IVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
           SF  A  + +++L       G G   +VVG   +D EGV NS  +L  G ++A  DK +L
Sbjct: 77  SFAAANRAEVESLAQRLQQAGCGDALVVVGHLDRDDEGVRNSASLLYDGRVVATYDKHHL 136

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           PNY  F E R F  G+    +    + +G++ICEDIW+N      L + G + +  +N+S
Sbjct: 137 PNYGVFDEARYFAPGFDLPIVRLHGLDVGVVICEDIWQNGGPVSALGEVGVDLVVCINSS 196

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY   K  +R  +V G+ +    P+ YVN VGGQDEL+FDG S       Q+  +   F+
Sbjct: 197 PYERAKDDQRTPLVAGRAAEAGAPMAYVNMVGGQDELVFDGDSMVVGTDGQVLARAPQFT 256

Query: 238 EQ------NFMTEWHYDQQLSQWNYMSDDS------------------------------ 261
           E       +     H    + +    ++                                
Sbjct: 257 EHLLVLDMDLTAGGHTATTVPEPEVPAEGGMQFVPASRFLRPAFDITRTVLQADPLPGYE 316

Query: 262 ---ASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGK 318
              A  +  PL +E   + A V  LRDYVQKN F  V  G SGGIDSA+CAA+  DA+G 
Sbjct: 317 PLPAQPLPEPLSDEAEVWAALVTGLRDYVQKNGFRSVTFGFSGGIDSAVCAALCADAIGA 376

Query: 319 ENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIV 378
           +++  + +P  Y+S  S  DAA  A+ LGC +DV PI D+V+ F S +      E SG+ 
Sbjct: 377 DSLYGVSMPSHYSSEHSRSDAADLARRLGCHFDVQPIGDMVDVFVSRL------ELSGLA 430

Query: 379 AENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVF 438
            EN+Q+R RG  LMALSN    ++L   NK+E++VGY T+YGD  GGF P+KD+ KT V+
Sbjct: 431 EENVQARCRGVTLMALSNQHGHLVLAPGNKTELAVGYSTIYGDAVGGFAPIKDVPKTLVW 490

Query: 439 QLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVE 498
           +LA WRN+     G  P    IP + + K PSAELRP Q D +SLPPY ILD ++   VE
Sbjct: 491 KLAQWRNAEAEKRGEVP---PIPENSISKPPSAELRPDQVDTDSLPPYEILDVVLDGYVE 547

Query: 499 NEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
            +  + +   E ++   V  +  L+  +EYKRRQ P GTKIT K+FGRDR  P++N++R+
Sbjct: 548 GDRGYADLVGEGFDAALVERIIQLVDRAEYKRRQYPPGTKITLKAFGRDRRLPVTNRWRE 607


>gi|294790940|ref|ZP_06756098.1| NAD+ synthetase [Scardovia inopinata F0304]
 gi|294458837|gb|EFG27190.1| NAD+ synthetase [Scardovia inopinata F0304]
          Length = 560

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 231/564 (40%), Positives = 326/564 (57%), Gaps = 34/564 (6%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           + L  A+AQ++  VGDI GN  K       A++QG D++LF E+ ++GYP EDL F+ +F
Sbjct: 22  QNLVFALAQIDTCVGDIEGNARKIIDFSRMAHQQGADIVLFPEMTLTGYPIEDLAFRATF 81

Query: 63  IQACSSAIDTLKSDTHDGGAG---IVVGFPRQDQEGV-LNSVVILDAGNIIAVRDKINLP 118
            +A     D +     D G G   +V+G    D +G+  N ++IL  G + A  DK  LP
Sbjct: 82  RKAAYRTADQVAVQLQDQGLGSLYVVIGTVGADVDGLPRNRLLILHNGRVEASYDKHFLP 141

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           NY  F E R F +G     +  +  R+G  ICEDIW+       L +   + L ++N SP
Sbjct: 142 NYGVFDEFRIFSAGQETLTLDIKGKRIGFAICEDIWQEGGTVAALAQDHIDVLATINGSP 201

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K   R ++   +   VH P+IY+NQVGGQD+L+FDG SF      Q+  Q   F E
Sbjct: 202 YEEGKYHTRVDLCRKRAGQVHAPVIYLNQVGGQDDLVFDGGSFVVGTDGQILAQAGKFQE 261

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
              +           W+ + + S + +  PL  +E  Y ACV  LRDY++KN+F  V++G
Sbjct: 262 SLLL-----------WS-LGNTSPTDLVSPLDPDEEVYQACVAGLRDYMRKNHFSGVVLG 309

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL A+IA DA G +NV  I +P +Y+S  S +DAA  A+ LG  YD+ PI  L
Sbjct: 310 LSGGIDSALVASIAADACGGDNVWGISMPSRYSSDGSRDDAADLARRLGAHYDIQPIEPL 369

Query: 359 VNHFFSLMSQFLQEEPS--GIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
              F        Q+E S  GI AEN+Q+RIRG I+MA SN    + L T NKSE++ GY 
Sbjct: 370 FQSF--------QQELSLEGIAAENLQARIRGVIVMAYSNSHGLLALATGNKSELACGYS 421

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           T+YGD  GGF P+KDL KT+V+QLA WRN     +G  P    IP + + K+PSAELRP 
Sbjct: 422 TIYGDAVGGFAPIKDLLKTRVWQLARWRNRAAQEAGEVP---PIPENSINKAPSAELRPG 478

Query: 477 QTDQESLPPYPILDDIIKRIVE---NEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAP 533
           Q D +SLP Y +LD ++   +E     +  +N+   ++ +TV  V  L+  +E+KRRQ P
Sbjct: 479 QKDSDSLPEYAVLDQVLAAYIEKAHGRQDLLNDG--FDPKTVDTVMRLVDKAEWKRRQYP 536

Query: 534 VGTKITAKSFGRDRLYPISNKFRD 557
           +G K+TA +FGRDR  P+++ FR+
Sbjct: 537 LGPKVTALAFGRDRRLPVTSAFRE 560


>gi|300087867|ref|YP_003758389.1| NAD+ synthetase [Dehalogenimonas lykanthroporepellens BL-DC-9]
 gi|299527600|gb|ADJ26068.1| NAD+ synthetase [Dehalogenimonas lykanthroporepellens BL-DC-9]
          Length = 541

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 224/559 (40%), Positives = 333/559 (59%), Gaps = 24/559 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  +++A+AQ+N  VGD  GN++  RR  ++A   G  L++F E+ +SGYPPEDL+ K S
Sbjct: 1   MNDIRLALAQINTTVGDYVGNVSLIRRYLKDAADGGAGLVVFPEMAVSGYPPEDLLHKPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+A   A+  +     D  A  VVGF     +G+ N+  ++  G I  +  K +LPNY 
Sbjct: 61  FIEAGQQALAEVAGTVGDLTA--VVGFVDTAPDGLYNAAAVIHQGEIRHIYHKRHLPNYG 118

Query: 122 EFHEKRTFISGYSNDPIVFRD---IRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
            F E+R F  G  +D  VF     +RLG+ +CEDIW++        + GA+ + +++ASP
Sbjct: 119 VFDEQRYFKPG--DDCPVFEGTGGLRLGVNVCEDIWRDDGPMVVQSRDGADIIINISASP 176

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           ++  K  +R  ++  + +   +P+++ N VGGQDEL+FDGAS   D   ++  + + F E
Sbjct: 177 FHRGKYHQRERMLKARAAGGGVPVVFCNLVGGQDELVFDGASVVIDAGGRVLGRARQFEE 236

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
           +    +   D +        D       +P + +E  Y A V   RDYV KN F +V++G
Sbjct: 237 ELLFVDLAGDGR--------DGRGIVAELPDEYDEI-YRALVTGTRDYVMKNAFRQVVVG 287

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDS+L AA+AVDALG   V  +++P ++++P+S   AA  A  LG + + +PI   
Sbjct: 288 LSGGIDSSLVAAVAVDALGASAVNGLIMPSRFSAPESAAYAAELADNLGIRVNEIPIEGP 347

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
              +   ++     +   I  ENIQ+RIRGN+LMALSN    ++L T NKSE + GY TL
Sbjct: 348 YAAYLESLTGVFTGQAPDITEENIQARIRGNLLMALSNKFGWLVLNTGNKSETATGYTTL 407

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGF  +KD+ KT V+ L  +RN    T+G      +IP SI++++PSAELRP Q 
Sbjct: 408 YGDMAGGFAVIKDVPKTLVYDLCRYRNR---TAG----RTLIPQSIIDRAPSAELRPGQK 460

Query: 479 DQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           D +SLPPY ++D I++  VE +    +     ++ ETVR +  L+ GSEYKRRQAP G K
Sbjct: 461 DADSLPPYDVMDPILEAYVEQDLGVADIIGLGHDPETVRRIAGLVDGSEYKRRQAPPGVK 520

Query: 538 ITAKSFGRDRLYPISNKFR 556
           IT K+FGRDR  PI+NKFR
Sbjct: 521 ITPKAFGRDRRLPITNKFR 539


>gi|254482845|ref|ZP_05096082.1| NAD synthase family protein [marine gamma proteobacterium HTCC2148]
 gi|214036926|gb|EEB77596.1| NAD synthase family protein [marine gamma proteobacterium HTCC2148]
          Length = 543

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 229/561 (40%), Positives = 337/561 (60%), Gaps = 27/561 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEA-NRQGMDLILFTELFISGYPPEDLVFKK 60
           +  L I +AQ+N +VGD  GN  +     + A +     +++F EL +SGYPPEDL+ + 
Sbjct: 1   MASLNILMAQMNTLVGDFDGNTKRVIEIVQSAIDTHEQPVVVFPELTLSGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S       +++ L S   +  A +V+G+P+++   + N+  ++  G ++A   K  LPNY
Sbjct: 61  SIELRVDQSLELLCSQLPEA-AWVVIGYPKREGGELYNAAGVIHDGKLVAEYRKQCLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F+ G +   +  + +++ + ICEDIW+  +      + GAE L +LN+SPY+
Sbjct: 120 QVFDEKRYFVPGSAPCVLNIQGVQVALSICEDIWEK-HPTADAAEAGAEILLNLNSSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R E+V  +      PI+YVNQVGGQDEL+FDG SF       +A     F E  
Sbjct: 179 RGKRGERWEMVAERARQAAFPIVYVNQVGGQDELVFDGGSFAVTADGTVAAAAPSFEEGE 238

Query: 241 FMTEW-HYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
           +   W HYD +    N     S   +  P+ E  A + A V+ +RDYV KN F  V++GL
Sbjct: 239 Y---WLHYDNE----NKNQPFSGQAVNAPMNEMAATWQALVMGVRDYVNKNGFKGVVLGL 291

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  A+AV+ALG E V+ IM+P++YTS  S++DAA  +K  G  + V+ I ++ 
Sbjct: 292 SGGIDSALTLAVAVEALGPERVEAIMMPFRYTSQMSVDDAAEQSKTQGVTHTVISIENIY 351

Query: 360 NHFF-SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
             F  SL  +F    P     EN+Q+R RG +LM++SN    ++LTT NKSE++VGY TL
Sbjct: 352 ASFMASLEEEFAGTTPD-TTEENLQARCRGVLLMSISNKKGVLVLTTGNKSEMAVGYSTL 410

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGF+ LKD+ KT VF+L  +RN+      LGP    IP  ++++ PSAEL P Q 
Sbjct: 411 YGDMAGGFDVLKDVPKTLVFELCRYRNT------LGP---CIPQRVIDRPPSAELAPDQK 461

Query: 479 DQESLPPYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           D++SLPPY ILD I++  VE +   E+ I  D  ++ E V+ V  L+  +EYKRRQAP+G
Sbjct: 462 DEDSLPPYDILDQILEMYVERDMSAEAII--DHGFDREQVQRVLRLVDINEYKRRQAPIG 519

Query: 536 TKITAKSFGRDRLYPISNKFR 556
            +IT + FGRDR YPI++ +R
Sbjct: 520 VRITRRGFGRDRRYPITSGWR 540


>gi|226951210|ref|ZP_03821674.1| glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [Acinetobacter sp. ATCC 27244]
 gi|226838040|gb|EEH70423.1| glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [Acinetobacter sp. ATCC 27244]
          Length = 541

 Score =  412 bits (1058), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 234/555 (42%), Positives = 330/555 (59%), Gaps = 23/555 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  KIA+AQ +P +G+I  N  K       A +Q  DLI+F EL   GYP EDL+ + +
Sbjct: 1   MKNFKIALAQFSPHIGNIDANTQKMVEQANLAKQQQADLIVFPELSTLGYPAEDLILRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
             +    A+  L S+  D    +V GF  Q ++G   NS  ++  G ++ + +K NLPNY
Sbjct: 61  LQKRTQKALAQL-SEVKD--IVMVFGFVHQTEDGHRYNSAAVMKDGQVLGIYNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICED+W + N  K L +   E +  LNASPY 
Sbjct: 118 GVFDEKRYFQEGHQHLVFEYLGHKFGVLICEDVW-SLNTVKQLSQLNVETVLILNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     ++L I+YVNQVGGQD+LIFDG+SF  +   +LA Q   F E  
Sbjct: 177 VGKPQHRIQTLSELAKQLNLNIVYVNQVGGQDDLIFDGSSFVNNHNGELALQAPSFKEAV 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
           + TE+     ++Q  +   D+     IP  +  A+ Y A V+S RDYVQ++ F  VI+GL
Sbjct: 237 YFTEY----DVAQKQFKKADA-----IPALDTFAEIYQALVMSTRDYVQRSGFPGVILGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDA+G + VQ +M+PY YTS  S+EDA   A+ +G  + +  IH +V
Sbjct: 288 SGGIDSALTLAIAVDAIGADKVQAVMMPYTYTSQMSVEDATEQARRMGVTFGIAEIHPIV 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSEISVGY TLY
Sbjct: 348 NSFMQTLFPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSEISVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GGF+ LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q D
Sbjct: 408 GDMVGGFSVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLP Y +LD I+   +E + S  +   + Y  + V  V  L+  +EYKRRQ  +G +I
Sbjct: 461 QDSLPAYDVLDAILYAYIEEDLSQADIIAKGYEADVVEKVIRLVDRNEYKRRQGAIGPRI 520

Query: 539 TAKSFGRDRLYPISN 553
           ++++F R+R YPI N
Sbjct: 521 SSRAFSRERRYPIVN 535


>gi|294649596|ref|ZP_06727014.1| glutamine-dependent NAD(+) synthetase [Acinetobacter haemolyticus
           ATCC 19194]
 gi|292824505|gb|EFF83290.1| glutamine-dependent NAD(+) synthetase [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 541

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 234/555 (42%), Positives = 329/555 (59%), Gaps = 23/555 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  KIA+AQ +P +G+I  N  K       A +Q  DLI+F EL   GYP EDL+ + +
Sbjct: 1   MKNFKIALAQFSPHIGNIDANTQKMVEQANLAKQQQADLIVFPELSTLGYPAEDLILRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L S+  D    +V GF  Q ++G   NS  ++  G ++ + +K NLPNY
Sbjct: 61  LQKRTQKAFAQL-SEVKD--IVMVFGFVHQTEDGHRYNSAAVMKDGQVLGIYNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICED+W + N  K L +   E +  LNASPY 
Sbjct: 118 GVFDEKRYFQEGHQHLVFEYLGHKFGVLICEDVW-SLNTVKQLSQLNVETMLILNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     ++L I+YVNQVGGQD+LIFDG+SF  +   +LA Q   F E  
Sbjct: 177 VGKPQHRIQTLSELAKQLNLNIVYVNQVGGQDDLIFDGSSFVNNHNGELALQAPSFKEAV 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
           + TE+     ++Q  +   D+     IP  +  A+ Y A V+S RDYVQ++ F  VI+GL
Sbjct: 237 YFTEY----DVTQKQFKKADA-----IPALDTFAEIYQALVMSTRDYVQRSGFPGVILGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDA+G + VQ +M+PY YTS  S++DA   A+ +G  + +  IH +V
Sbjct: 288 SGGIDSALTLAIAVDAIGADKVQAVMMPYTYTSQMSVKDATEQARRMGVTFGIAEIHPIV 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSEISVGY TLY
Sbjct: 348 NSFMQTLFPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSEISVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GGF+ LKD+YKT VF+LA +RNS   T        VIP  ++ + PSAELRP Q D
Sbjct: 408 GDMVGGFSVLKDVYKTIVFELAKYRNSLSETP-------VIPERVITRPPSAELRPDQKD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLP Y +LD I+   +E + S  +   + Y  E V  V  L+  +EYKRRQ  +G +I
Sbjct: 461 QDSLPAYDVLDAILYAYIEEDLSQADIIAKGYEAEVVEKVIRLVDRNEYKRRQGAIGPRI 520

Query: 539 TAKSFGRDRLYPISN 553
           ++++F R+R YPI N
Sbjct: 521 SSRAFNRERRYPIVN 535


>gi|293609041|ref|ZP_06691344.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829614|gb|EFF87976.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 541

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 234/557 (42%), Positives = 328/557 (58%), Gaps = 27/557 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTQKMIEQVNQAKKQDADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L ++  D    +V GF  Q ++G   NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQL-AEVKD--IVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   + +  LN+SPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTVLVLNSSPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL I+YVNQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRIQTLSELAKQLHLNIVYVNQVGGQDDLIFDGTSFVSNQNGEIALQAPSFKEDI 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
           ++ E+  D +L    Y   +SA     P  E  A+ Y   V++ RDYV+++ F  VI+GL
Sbjct: 237 YIAEFDRDTKL----YKVTESA-----PALETFAEIYQGLVMATRDYVERSGFPGVILGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +V
Sbjct: 288 SGGIDSALTLAIAVDAIGAEKVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSIV 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F   +  F    P+    EN+Q+R RG +LM LSN    ++L T NKSE+SVGY TLY
Sbjct: 348 NSFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLATGNKSELSVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GGF  LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q D
Sbjct: 408 GDMVGGFAVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           Q+SLP Y +LD I+   +  EE     D   + ++ E V  V  L+  +EYKRRQ  +G 
Sbjct: 461 QDSLPAYDVLDAILYAYI--EEDLGQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGP 518

Query: 537 KITAKSFGRDRLYPISN 553
           +IT+++F R+R YPI N
Sbjct: 519 RITSRAFSRERRYPIVN 535


>gi|297182590|gb|ADI18749.1| NAD synthase [uncultured gamma proteobacterium HF4000_36I10]
          Length = 538

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 238/569 (41%), Positives = 334/569 (58%), Gaps = 41/569 (7%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   + IA+AQ+NPVVGDI GN  K ++A  EA  +G  L +F EL ++GYPPEDL+ + 
Sbjct: 1   MGADVTIAMAQINPVVGDIVGNTEKIQQAAREAAAKGAQLAMFPELALTGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S       A+  L +++ D    ++VG P      + N   +L  G + A+  K  LPNY
Sbjct: 61  SLRIRVDEALRQLAAESTD--IALLVGLPLHADGKLYNGAALLRGGKVEALYRKHRLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F +G          +  GI ICEDIW +          GA+ + +LNASPY+
Sbjct: 119 RVFDEMRYFAAGSEASVFELDGVSFGITICEDIW-SPEPAAKAVAAGADLILNLNASPYH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K ++R  +V  +    ++P++YVNQVG QDEL+FDG SF       L  +    SE  
Sbjct: 178 VGKQREREAVVAERCRENNVPVLYVNQVGAQDELVFDGGSFALSSDGSLKARAHAVSET- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
                     LS       +  +    PL +E A  Y+A V+ +RDY+ KN F  V++GL
Sbjct: 237 ----------LSLITLRDGEPLAGEVQPLGDELATIYDALVVGVRDYINKNGFKGVVLGL 286

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDALG E V+ +M+P+KYTS  SLEDA A A  LG  Y V+ I  + 
Sbjct: 287 SGGIDSALTLAIAVDALGAERVEAVMMPFKYTSGMSLEDAEAEANTLGVSYKVISIEPMY 346

Query: 360 NHFFSLMSQFLQEEPSGI----VAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGY 415
             F    S+ L+EE +G+      ENIQSRIRG +LMA+SN   +++LTT NKSE++VGY
Sbjct: 347 EAF----SEALREEFAGLPVDKTEENIQSRIRGGLLMAISNKKGSLVLTTGNKSEMAVGY 402

Query: 416 GTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRP 475
            TLYGDM GGF  LKD+ K +VF L+ +RNS         L+ VIP  ++++ PSAEL P
Sbjct: 403 ATLYGDMCGGFAVLKDVSKQRVFALSEYRNS---------LSPVIPQRVIDRPPSAELAP 453

Query: 476 HQTDQESLPPYPILDDIIKRIVENEES-----FINNDQEYNDETVRYVEHLLYGSEYKRR 530
            Q D++SLPPY +LD I++  +E+++S      +  ++E   + VR V+     +EYKRR
Sbjct: 454 DQKDEDSLPPYEVLDQILEHYIEHDQSAEAIIAMGFEREAVGQVVRLVDI----NEYKRR 509

Query: 531 QAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           QA +GT+IT + FGRDR YPI+N+++  +
Sbjct: 510 QAAIGTRITERGFGRDRRYPITNRWQAGV 538


>gi|169634065|ref|YP_001707801.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Acinetobacter baumannii
           SDF]
 gi|169152857|emb|CAP01886.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Acinetobacter
           baumannii]
          Length = 541

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 234/557 (42%), Positives = 328/557 (58%), Gaps = 27/557 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTQKMIEQANQAKKQDADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L S+  D    +V GF  Q ++G   NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQL-SEVKD--IVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   + +  LN+SPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTVLVLNSSPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL  +YVNQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRKQTLSELAKQLHLNTVYVNQVGGQDDLIFDGTSFVSNQNGEIALQAPSFKEDL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
           ++ E+  D +L    Y   +SA     P  E  A+ Y   V++ RDYV+++ F  VI+GL
Sbjct: 237 YIAEFDRDTKL----YKVVESA-----PALETFAEIYQGLVMATRDYVERSGFPGVILGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +V
Sbjct: 288 SGGIDSALTLAIAVDAIGAERVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSIV 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSE+SVGY TLY
Sbjct: 348 NSFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSELSVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GGF  LKD+YKT VF+LA +RNS   T        VIP  ++ + PSAELRP Q D
Sbjct: 408 GDMVGGFAVLKDVYKTIVFELAKYRNSLSETP-------VIPERVITRPPSAELRPDQKD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           Q+SLP Y +LD I+   +  EE     D   + ++ E V  V  L+  +EYKRRQ  +G 
Sbjct: 461 QDSLPAYDVLDAILYAYI--EEDLGQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGP 518

Query: 537 KITAKSFGRDRLYPISN 553
           +IT+++F R+R YPI N
Sbjct: 519 RITSRAFSRERRYPIVN 535


>gi|171463824|ref|YP_001797937.1| NAD+ synthetase [Polynucleobacter necessarius subsp. necessarius
           STIR1]
 gi|171193362|gb|ACB44323.1| NAD+ synthetase [Polynucleobacter necessarius subsp. necessarius
           STIR1]
          Length = 539

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 234/562 (41%), Positives = 332/562 (59%), Gaps = 39/562 (6%)

Query: 6   KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQA 65
           KIA+AQ+NP++GD+AGN     +A  +A  QG  L++  EL ++GYPPEDL+ + +FI+A
Sbjct: 5   KIALAQINPLLGDLAGNAQLIYKAALDAYSQGAKLVVTPELSLTGYPPEDLLLRPAFIEA 64

Query: 66  CSSAIDTL-KSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
               ++ L K         ++VG P++   G+ N   +L +G +IA   K  LPN+  F 
Sbjct: 65  AQQQLELLMKELAQHSDLTVIVGHPKKTSVGLQNYASVLQSGKVIAGYAKQELPNHEVFD 124

Query: 125 EKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           E R F+ G  N   VF    IR G+++CED W ++   K     GA+ L   NASPY+  
Sbjct: 125 EVRYFVPG--NQACVFECDGIRYGMILCEDAW-HAGPAKQAHAAGAQVLLVPNASPYHLK 181

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K   R +++   I+   +P++YVN VGGQDEL+FDG SF  +    +   M  F     +
Sbjct: 182 KEALRIDVLREHIAQTKMPLVYVNTVGGQDELVFDGGSFALNSHGDVVMAMPQFETGLGV 241

Query: 243 TEWHYDQQLSQ-WNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGLS 300
                  +L + W             P Q  EA  Y A VL +RDYV KN+F  VIIGLS
Sbjct: 242 VSASSSGELEKGW-----------ITPPQSVEAQAYQALVLGVRDYVTKNHFPGVIIGLS 290

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL  AIAVDALG + V+ +M+   YT+  S  DA   A+ L  +YD +PI   V+
Sbjct: 291 GGVDSALVLAIAVDALGADKVRAVMMASHYTADISWIDAREMAENLSMQYDEIPISGPVD 350

Query: 361 HF-FSLMSQFLQEEPSGI----VAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGY 415
               SL  QF     +G+      ENIQ+R+RG +LMALSN +  ++LTT NKSE++VGY
Sbjct: 351 ALEASLAKQF-----TGLNVDATEENIQARVRGTLLMALSNKTGRLVLTTGNKSEMAVGY 405

Query: 416 GTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRP 475
            TLYGDM+GGF  +KD+ KT V++L ++RNS         +  +IP  IL ++PSAELRP
Sbjct: 406 CTLYGDMAGGFAVIKDIAKTLVYRLCAYRNS---------IAPIIPERILTRAPSAELRP 456

Query: 476 HQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPV 534
            Q DQ+SLP Y +LD I++R +E  +S        ++ E+V  V  L+  +EYKRRQAP 
Sbjct: 457 DQKDQDSLPSYEVLDGIVERYMEQNQSIAQIIAAGFDPESVEKVTRLIKLNEYKRRQAPP 516

Query: 535 GTKITAKSFGRDRLYPISNKFR 556
           G ++TA++FGRD  YPI+++FR
Sbjct: 517 GVRVTARAFGRDWRYPITSQFR 538


>gi|117620870|ref|YP_855239.1| NAD synthetase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117562277|gb|ABK39225.1| glutamine-dependent NAD(+) synthetase (NAD(+)
           synthase[glutamine-hydrolyzing]) [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 540

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 233/556 (41%), Positives = 338/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M K L + +AQLN  VG I  N  K   A  EA+RQG DL++ +EL ++GYPPEDL+ + 
Sbjct: 1   MAKALSLMLAQLNLTVGAIEDNCDKVLAAAAEADRQGADLLVCSELALTGYPPEDLLLRV 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +    +A+  L +    G   I+VG P +D E + N+  + + G ++A   K +LPNY
Sbjct: 61  DLMIRVEAALARLAA--WQGACAILVGHPWRDGEALYNAASLYEQGKLVARYFKQDLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +      + FR  +LG+LICED+W+        K  GAE L ++NASPY 
Sbjct: 119 GVFDEKRYFTAATETCVVPFRGHQLGLLICEDLWQPGPA-LAAKAAGAELLLTINASPYD 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R E++  +     LP++Y+NQV GQDELIFDG S  F+ Q +L  ++  F+E+ 
Sbjct: 178 QEKPWIRRELMAERCDQTGLPLVYLNQVCGQDELIFDGCSKVFNSQGELTHKLAPFAEEL 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +  +   Q + +    +         PL+     Y A VL++RDYV KN FH  ++GLS
Sbjct: 238 ALVRFADGQPVKEREPAA---------PLEPLAETYQALVLAVRDYVTKNGFHGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIA DA+G + VQ +M+P++YT+  S+EDA   A+ +G +++++ I  +  
Sbjct: 289 GGIDSALTLAIAADAIGADKVQAVMMPFRYTAQMSVEDAKEQAERMGVEFNIISIEPMFE 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + ++   +        EN+Q+R RG +LMALSN  + ++LTT NKSE++VGY TLYG
Sbjct: 349 GFMAQLAPLFEGTARDTTEENLQARCRGVLLMALSNKRRCIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L  +RNS         +  VIP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLCEYRNS---------VDYVIPQRVIDRPPSAELAPDQVDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I+KR VE + S  +   E + +  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILKRYVEEDASVADMVAEGFEEAVVRKVIRLVDLNEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|121608702|ref|YP_996509.1| NAD+ synthetase [Verminephrobacter eiseniae EF01-2]
 gi|121553342|gb|ABM57491.1| NAD+ synthetase [Verminephrobacter eiseniae EF01-2]
          Length = 552

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 241/566 (42%), Positives = 333/566 (58%), Gaps = 31/566 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L I  AQLN VVGD+  N  K   A  +A+ +G  L+L  EL I GY  EDL  + +FI 
Sbjct: 3   LSICTAQLNFVVGDMPANAQKIIAAARQAHARGARLLLTPELAICGYAAEDLFLRPAFIA 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFPR------QDQEGVLNSVVILDAGNIIAVRDKINL 117
           AC  A+ T+  +T D     IV+G PR            +N+  +L AG I     K  L
Sbjct: 63  ACDDAVKTVARETADLKDLAIVLGHPRGFAPEAAAFSACINAASVLRAGQIEQTYAKREL 122

Query: 118 PNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLN 175
           PNY  F E+R F++G+   P VF    +R+G+LICED W  +   +     GA+ L  +N
Sbjct: 123 PNYQVFDERRYFVAGHK--PCVFDMGGLRVGLLICEDAWFAAP-ARDCALAGAQLLAVIN 179

Query: 176 ASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKH 235
           ASP++  K  +R +I+  ++    LP++Y + VGGQDE++F+G SF  D    +A +   
Sbjct: 180 ASPFHLGKGAEREQIMRERVLETGLPLVYAHLVGGQDEVVFEGRSFALDADGSVAGRAPG 239

Query: 236 FSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHK 294
           F E+  +   H     S     +D +      P +  EAD ++A VL +RDYV KN F  
Sbjct: 240 FEEK--LVYAHIHPSSSAIRIEADIA------PERSLEADLWDALVLGVRDYVGKNGFAG 291

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
            ++GLSGGIDSAL  AIAVDALG + ++T+M+P  YT+  SL DA   A+ LG ++D + 
Sbjct: 292 ALLGLSGGIDSALVLAIAVDALGADKLRTVMMPSPYTADISLIDARELARRLGVRHDEIS 351

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I      F + ++      P     EN+Q+RIRG +LMALSN   A++LTT NKSE+S G
Sbjct: 352 ITPQWEAFKAALAPAFAGLPEDTTEENLQARIRGTLLMALSNKFGALVLTTGNKSEMSTG 411

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG-ITSGLGPLTEVIPPSILEKSPSAEL 473
           Y TLYGDM+GGF  +KD+ KT+VF LA WRN++    SG  P    IP  I+ + PSAEL
Sbjct: 412 YCTLYGDMAGGFAVIKDVAKTRVFDLARWRNANDPYGSGANP----IPQRIIARPPSAEL 467

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRR 530
           RP QTDQ+SLPPY +LD I+ R +EN+   ES I +     D  V  V  L+  +EYKRR
Sbjct: 468 RPDQTDQDSLPPYEVLDAIMSRYMENDEPIESIIASGFARAD--VERVTRLIKFNEYKRR 525

Query: 531 QAPVGTKITAKSFGRDRLYPISNKFR 556
           QAPVG ++T +SFG+D  YPI+++FR
Sbjct: 526 QAPVGIRVTRRSFGKDWRYPITSRFR 551


>gi|298571422|gb|ADI87762.1| NAD+ synthetase [uncultured Nitrospirae bacterium MY4-5C]
          Length = 577

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 233/587 (39%), Positives = 337/587 (57%), Gaps = 43/587 (7%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M+K L++A+AQ+NP VG I  N  K     E+A R   D++ F EL I+GYPPEDL+ K 
Sbjct: 1   MVKTLRLALAQINPTVGSIKKNSEKIISFIEDARRHSADIVAFPELCITGYPPEDLLLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           SF++    A+D +K  T+D    +VVGF  + Q+ + N+  +L    II +  KI LPNY
Sbjct: 61  SFLKDNIKALDEIKRHTND--IAVVVGFADK-QDDIYNAAALLYNHQIIDIYHKIFLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F SG  +         +G+ ICEDIW            GAE + ++NASPY 
Sbjct: 118 GVFDELRYFQSGVLSPVYEIAGCLVGLNICEDIWYPDGPAYKQSLAGAELIININASPYG 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ- 239
            NK K +  +++ +     + + Y+N VGGQDEL+FDG+S  FD   ++  +   F+E+ 
Sbjct: 178 FNKSKAKDTMLSARAFDNRVILAYLNTVGGQDELVFDGSSTVFDSTGEVLARGASFTEEL 237

Query: 240 ---------NFMTEWHYDQQLSQWNYMSDDSASTMYI-----------------PLQEEE 273
                     F++  H  ++  +   +  +    +++                 P+++ +
Sbjct: 238 IVVDLDMEGVFVSRLHDPRRRQKVKALCHNEIKRVFVCDRVPGEKSPIKLIKRMPVRQMD 297

Query: 274 AD---YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKY 330
            D   YNA VL  RDYV KN F  V+IGLSGGIDS++ A IAVDA+G ENV+ I +P  Y
Sbjct: 298 RDEEIYNALVLGTRDYVTKNGFKSVVIGLSGGIDSSIVACIAVDAIGPENVRGIFMPSPY 357

Query: 331 TSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNI 390
           TS  S ED    ++ L  +   +PI  + + +   ++     + +    EN+Q+RIRGNI
Sbjct: 358 TSQDSREDVCELSENLKIRTTEIPIAGIFSTYLGELTAAFDGKAADTTEENLQARIRGNI 417

Query: 391 LMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGIT 450
           LMA+SN    ++LTT NKSE+S GY TLYGDM+GGF  +KD+ K  V++L+ WRNS    
Sbjct: 418 LMAMSNKFGPLVLTTGNKSEMSAGYATLYGDMAGGFAVIKDVPKMMVYKLSRWRNS---- 473

Query: 451 SGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQE 509
                +TEVIP  +L K+P+AELR +Q D +SLPPY ILD II+  VE E          
Sbjct: 474 -----VTEVIPERVLTKAPTAELRHNQKDSDSLPPYEILDTIIESYVEKEMGLEEITTLG 528

Query: 510 YNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
            +++TVR    L+ GSEYKRRQ+P G KIT ++FG+DR +PI+N +R
Sbjct: 529 IDEQTVRKALALIDGSEYKRRQSPPGIKITGRAFGKDRRFPITNGYR 575


>gi|148244626|ref|YP_001219320.1| NAD+ synthase (glutamine-hydrolysing) [Candidatus Vesicomyosocius
           okutanii HA]
 gi|146326453|dbj|BAF61596.1| NAD+ synthase (glutamine-hydrolysing) [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 543

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 229/558 (41%), Positives = 337/558 (60%), Gaps = 32/558 (5%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           K +KI IAQ+NP+VGD+ GN  K  +  +EA  +G DL++F EL + GYPPEDL+  + F
Sbjct: 13  KSIKIDIAQINPIVGDLNGNTQKIIKLTQEAYIRGCDLLVFPELSLIGYPPEDLLLHEGF 72

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           +Q     + TL + T      I+ G P +  + + NS  ++    +     K NLPNY  
Sbjct: 73  VQQVQDKV-TLINQTISNNISIIFGAPYKKDDILYNSAYLIQNSQV-YFYHKQNLPNYGV 130

Query: 123 FHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           F EKR F SG  N+P +F  +  ++ ++ICED W  S+I      +G + + S+NASP+ 
Sbjct: 131 FDEKRYFESG--NEPFIFECQGKKISLVICEDAW-TSDIISISANKGVQIIISINASPFQ 187

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R E +  ++       IYVN VG QDEL+FDGASF  +    +  Q+  F E  
Sbjct: 188 IGKHSQRIEQIKQRVLETKTNFIYVNMVGAQDELVFDGASFAMNSNANITLQLPLFKEA- 246

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNN-FHKVIIGL 299
                           +S  S  T++     E+  Y+A VL+ +DY++KN+ F+ V+IGL
Sbjct: 247 -------------VQSVSFTSPITLFDTDPIEKTIYDALVLATKDYIEKNDVFNGVVIGL 293

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIA DA+G E+++ IM+PYKYTS  SLEDA   A  +   Y  + IH +V
Sbjct: 294 SGGIDSALTLAIAADAIGTEHIKAIMMPYKYTSNISLEDAKIQATTMNVDYHEINIHIIV 353

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           + F + ++       +    ENIQ+RIRG +LMA+SN    ++LTTSNKSEI+VGY TLY
Sbjct: 354 DSFNTQLNTLFIGMETDTTEENIQARIRGTLLMAISNKLGKIVLTTSNKSEIAVGYTTLY 413

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDMSGGF PLKD+ KT V+QLA +RN+         ++ +IP  ++++ PSAEL P+Q D
Sbjct: 414 GDMSGGFAPLKDVNKTLVYQLAKYRNT---------ISTIIPERVIDRKPSAELAPNQAD 464

Query: 480 QESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLP Y  LD I+   +E + S  +   Q +N++TV+Y+  ++  +EYKRRQ+  G KI
Sbjct: 465 QDSLPSYNELDAILTLFIEQKYSVKHIIKQGFNEQTVKYITQMVLNNEYKRRQSAPGPKI 524

Query: 539 TAKSFGRDRLYPISNKFR 556
           +  +FG++R YP+++KF+
Sbjct: 525 SPNAFGKERRYPMTSKFQ 542


>gi|149928337|ref|ZP_01916578.1| NAD synthetase [Limnobacter sp. MED105]
 gi|149822922|gb|EDM82167.1| NAD synthetase [Limnobacter sp. MED105]
          Length = 544

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 234/555 (42%), Positives = 328/555 (59%), Gaps = 21/555 (3%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           +AIAQLN  VGD+ GN AK      +A  QG+ ++L  EL I+GYPPEDL+ + SF +  
Sbjct: 1   MAIAQLNLTVGDLKGNCAKILEYAHKAAAQGVRILLTPELSITGYPPEDLLLRPSFQRQT 60

Query: 67  SSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEK 126
            +A + L+ +       +VVG P   +  + N+  +L  G ++ +  K +LPN   F E+
Sbjct: 61  DTAFEHLRQELAALDLYVVVGHPVSREGELFNAASVLYKGQVVGMYHKHDLPNREVFDEQ 120

Query: 127 RTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           R F     N P+VF    IR G+ ICED W N    +     GAE L   NASPY+  K 
Sbjct: 121 RYFTP--DNRPLVFEVDGIRFGLNICEDTW-NRYAPEAAAAAGAEVLLVPNASPYHMGKQ 177

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R  +V  ++    + I+Y N +GGQDEL+FDGASF  DG+Q +A ++  F E   M +
Sbjct: 178 TIRQSMVAKRVQETGMAIVYANMLGGQDELVFDGASFAMDGKQHVAMRLPQFQEALAMLD 237

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGLSGGI 303
                 +++        A    +P  E  A  Y A  + + DYV KN F   IIGLSGG+
Sbjct: 238 -----AVARPGEPIVLEAHQPCVPELELTAQVYEALKMGVHDYVTKNRFPGAIIGLSGGV 292

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSA+  AIAVDALG + V+ +M+P  YT+  SL+D+    + LG +YD + I D +N F 
Sbjct: 293 DSAITLAIAVDALGADKVRAVMMPSPYTADISLDDSRDMVRRLGIQYDEISIQDCMNAFD 352

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++   +   +    EN+Q+RIRG +LMA+SN +  ++LTT NKSE++ GY TLYGDM+
Sbjct: 353 SSLAPLFKGLAADTTEENLQARIRGTMLMAISNKTGRIVLTTGNKSEMATGYCTLYGDMA 412

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF  +KD++KT V+QL  +RNS         L+EVIP  I+ + PSAELRP Q DQ+SL
Sbjct: 413 GGFAVIKDIFKTLVYQLCEYRNS---------LSEVIPTRIITRPPSAELRPDQVDQDSL 463

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           PPY +LD I+ R +E +ES  N     +  E V     LL  +EYKRRQAPVG ++T ++
Sbjct: 464 PPYDVLDAILARYMEKDESVENIVASGFQKEDVFKAVKLLRINEYKRRQAPVGIRVTHRA 523

Query: 543 FGRDRLYPISNKFRD 557
           FGRD  YPI++KF D
Sbjct: 524 FGRDWRYPITSKFND 538


>gi|325121187|gb|ADY80710.1| putative glutamine-dependent NAD(+) synthetase [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 541

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 234/557 (42%), Positives = 327/557 (58%), Gaps = 27/557 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTQKMIEQVNQAKKQDADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L ++  D    +V GF  Q ++G   NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQL-AEVKD--IVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   +    LN+SPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTALVLNSSPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL I+YVNQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRIQTLSELAKQLHLNIVYVNQVGGQDDLIFDGTSFVSNQNGEIALQAPSFKEDI 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
           ++ E+  D +L    Y   +SA     P  E  A+ Y   V++ RDYV+++ F  VI+GL
Sbjct: 237 YIAEFDRDTKL----YKVTESA-----PALETFAEIYQGLVMATRDYVERSGFPGVILGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +V
Sbjct: 288 SGGIDSALTLAIAVDAIGAEKVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSIV 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F   +  F    P+    EN+Q+R RG +LM LSN    ++L T NKSE+SVGY TLY
Sbjct: 348 NSFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLATGNKSELSVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GGF  LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q D
Sbjct: 408 GDMVGGFAVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           Q+SLP Y +LD I+   +  EE     D   + ++ E V  V  L+  +EYKRRQ  +G 
Sbjct: 461 QDSLPAYDVLDAILYAYI--EEDLGQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGP 518

Query: 537 KITAKSFGRDRLYPISN 553
           +IT+++F R+R YPI N
Sbjct: 519 RITSRAFSRERRYPIVN 535


>gi|319793214|ref|YP_004154854.1| NAD+ synthetase [Variovorax paradoxus EPS]
 gi|315595677|gb|ADU36743.1| NAD+ synthetase [Variovorax paradoxus EPS]
          Length = 565

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 236/564 (41%), Positives = 324/564 (57%), Gaps = 19/564 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           LK+AIAQLN VVGD+ GN  K   A  E++ QG  L+L  EL I+GY  EDL  + +F +
Sbjct: 3   LKLAIAQLNFVVGDVDGNARKIVDAARESHAQGARLLLTPELSIAGYAAEDLFLRPAFTE 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFP-----RQDQEGVL---NSVVILDAGNIIAVRDKI 115
           AC  A+  + +   D     +VVG P     R     V    N+  ++  G I+    K 
Sbjct: 63  ACDDAVKGIAAALADLKDMVVVVGHPTGGSLRSRSVAVQMRHNAASVIKEGRILDTYAKR 122

Query: 116 NLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLN 175
            LPNY  F E+R F  G          + +G+LICED W +    +  +  GAE L  +N
Sbjct: 123 ELPNYQVFDERRYFTPGQGTCVFEAGGVSVGLLICEDAWFDQP-AELARAAGAEVLAVIN 181

Query: 176 ASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKH 235
           ASPY+  K  +R   +  +   V LP++Y + VGGQDE++FDGASF       LA Q++ 
Sbjct: 182 ASPYHVGKEGERVARMADRAHAVGLPLVYAHLVGGQDEVVFDGASFALQAGGALAMQVES 241

Query: 236 FSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKV 295
           F E+    +     +     ++ +  A  +  P   E   ++A VL +RDY+ KN F   
Sbjct: 242 FQEKLVFAQLERTPE-GGVGFVVEPGA--VAAPRDAEAQLWDALVLGVRDYIGKNGFPSA 298

Query: 296 IIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPI 355
           I+GLSGGIDSAL  AIAVDALGK+ V+ +M+P  YT+  S  DA   A  LG +YD + I
Sbjct: 299 ILGLSGGIDSALVLAIAVDALGKDKVRAVMMPSPYTADISWIDAREMANRLGVRYDEISI 358

Query: 356 HDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGY 415
                 F   +++  ++ P     ENIQ+RIRG +LMALSN   +++LTT NKSE++ GY
Sbjct: 359 KHTFESFKGALAEEFKDRPEDTAEENIQARIRGTLLMALSNKFGSIVLTTGNKSEMATGY 418

Query: 416 GTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG-ITSGLGPLTEVIPPSILEKSPSAELR 474
            TLYGDM+GGF  +KDL KT VF LA WRN+H    +G  P    IP  I+ + PSAELR
Sbjct: 419 CTLYGDMAGGFAVIKDLLKTTVFALARWRNAHDPYGTGAAP----IPDRIITRPPSAELR 474

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAP 533
           P QTDQ+SLPPY ILD I+ R ++++E         Y    V  V  L+  +EYKRRQAP
Sbjct: 475 PDQTDQDSLPPYDILDGILARYMQDDEGIDEIIAAGYERAVVERVARLIKVNEYKRRQAP 534

Query: 534 VGTKITAKSFGRDRLYPISNKFRD 557
           VG ++T +SFG+D  YPI++KF +
Sbjct: 535 VGIRVTHRSFGKDWRYPITSKFNE 558


>gi|169830368|ref|YP_001716350.1| NAD+ synthetase [Candidatus Desulforudis audaxviator MP104C]
 gi|169637212|gb|ACA58718.1| NAD+ synthetase [Candidatus Desulforudis audaxviator MP104C]
          Length = 543

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 235/572 (41%), Positives = 336/572 (58%), Gaps = 52/572 (9%)

Query: 5   LKIAIAQLNPVVGDIAGN----IAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           ++IA+AQ+NP VGDI GN    ++   RARE A     DL++F EL + GYPP+DL+ + 
Sbjct: 1   MRIAVAQINPTVGDINGNTDLIVSATGRAREAA----ADLVVFPELAVCGYPPKDLLCRA 56

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFP-RQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
            F+ A  + +D +++ T +    ++VG P R D  G+ N+ V+L    +     K  LP 
Sbjct: 57  DFLDAVEAGLDRIRAATTE--IAVLVGAPVRGDDGGLFNAAVLLRDRRVAGRVAKTLLPE 114

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNI----------CKHLKKQGAE 169
           Y  F E+R F  G +  P+  RD+RLG+ +CEDIW    +           K L  +G +
Sbjct: 115 YDVFDERRYFAPGAAQPPLTLRDLRLGVTVCEDIWNIGGVTGIPPYPVDPVKELADRGVD 174

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
              +L+ASPY+  K ++R E+V    +    P++YVNQ+GG D+L+FDGASF  D + ++
Sbjct: 175 LFINLSASPYHLRKQRQRLEVVGAVAARYSRPVLYVNQIGGNDDLVFDGASFLTDSRGRV 234

Query: 230 AFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQK 289
             Q   F    ++  +H    L       ++  S++Y           A VL L DY++K
Sbjct: 235 VLQGLSFETDFWVFSFHDINTLPVLEAKPEEGPSSVY----------RALVLGLADYLRK 284

Query: 290 NNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCK 349
             F K ++GLSGGIDSA+ AA+AV ALG ENV  + +P +Y+S  SLEDA   A+ LG +
Sbjct: 285 TGFRKAVVGLSGGIDSAVTAALAVAALGAENVLGVSMPSRYSSRSSLEDARELARRLGIE 344

Query: 350 YDVLPIHDLVNHFFSLMSQFLQEEPSG-----IVAENIQSRIRGNILMALSNHSKAMLLT 404
           + VLPI     HF S + QF    P G     +  ENIQ+R+RG ILM +SN    ++L+
Sbjct: 345 FRVLPID---VHFQSFLDQF---NPDGRPRLDVAEENIQARLRGMILMFISNREGYLVLS 398

Query: 405 TSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSI 464
           T NKSE++VGY TLYGDM+GG   L D+ KT V++LA+  N  G         EVIPPSI
Sbjct: 399 TGNKSEMAVGYTTLYGDMAGGLAVLADVPKTMVYELAALVNREG---------EVIPPSI 449

Query: 465 LEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLY 523
           + K+PSAELRP Q DQ+SLPPYP+LD I+K  +E   S      Q Y +  VR V  ++ 
Sbjct: 450 IRKAPSAELRPGQVDQDSLPPYPVLDGILKAYIEEGCSVSQIVKQGYAEPVVRRVVAMVD 509

Query: 524 GSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
            +EYKRRQAP G K+T+K+FG  R +PI+ ++
Sbjct: 510 RAEYKRRQAPPGLKVTSKAFGPGRRFPIAQRW 541


>gi|74316825|ref|YP_314565.1| NH(3)-dependent NAD(+) synthetase [Thiobacillus denitrificans ATCC
           25259]
 gi|74056320|gb|AAZ96760.1| NAD+ synthase (glutamine-hydrolyzing) [Thiobacillus denitrificans
           ATCC 25259]
          Length = 537

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 239/555 (43%), Positives = 331/555 (59%), Gaps = 27/555 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+A+AQ N  VGDIAGN AK   A + A+  G  L+L  E+ I GYP EDLV ++ F  
Sbjct: 1   MKLALAQFNFTVGDIAGNAAKLLDAAQAAHAAGAALLLTPEMSICGYPAEDLVCRRDFTA 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC++A+++L        A ++VG+P +   GV N+  +L  G I  V  K +LPN+S F 
Sbjct: 61  ACAAAVESLARQAPAELA-LIVGYPERTAAGVYNAAALLRGGRIEQVYRKHHLPNHSVFD 119

Query: 125 EKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           E+R F  G  +D  VF    IR GI IC DIW+       ++  GA++L  LNASPY+ +
Sbjct: 120 EQRVFCRG--DDACVFECAGIRFGINICGDIWEPGPATGAMEA-GADWLLVLNASPYHLS 176

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K + R  +   +     LP++Y N VGGQDEL+FDGASF FD   ++A Q   + E  F 
Sbjct: 177 KERDRIAVARARQIETRLPMVYANLVGGQDELVFDGASFVFDADGEVAVQCPAWREGLFY 236

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
            E   D            S     +P  EE A Y A VL++RDYV KN F  V +GLSGG
Sbjct: 237 LELDADGC----------SGPRHELP-GEEAAVYEALVLAVRDYVGKNGFRGVHLGLSGG 285

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL  AIA DA+G E V  +M+P  YT+  S+ED+    + LG +Y  + I  +V  F
Sbjct: 286 IDSALTLAIAADAVGAERVHAVMMPSDYTAGISVEDSREIVERLGVRYAEIAIGPIVEAF 345

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
              ++       S    EN+Q+R RG +LMALSN    ++LTT NKSE+  GY TLYGDM
Sbjct: 346 TGQLAGEFAGLASDTTEENLQARARGTLLMALSNKFGTLVLTTGNKSEMGTGYATLYGDM 405

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF  LKD+ KT+V++LA++RNS         ++ VIP  I+++ PSAELRP QTDQ+S
Sbjct: 406 AGGFAVLKDVAKTRVYRLANYRNS---------VSPVIPQRIIDRPPSAELRPDQTDQDS 456

Query: 483 LPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY +LD I+   VE +        Q ++   V+ V  ++  +EYKRRQ+P G +IT +
Sbjct: 457 LPPYEVLDAILAAYVERDLPAREIVAQGHDAAVVKKVIRMVDLAEYKRRQSPPGPRITPR 516

Query: 542 SFGRDRLYPISNKFR 556
           +FG+DR YPI++K+R
Sbjct: 517 NFGKDRRYPITSKYR 531


>gi|222111153|ref|YP_002553417.1| NAD(+) synthetase [Acidovorax ebreus TPSY]
 gi|221730597|gb|ACM33417.1| NAD+ synthetase [Acidovorax ebreus TPSY]
          Length = 554

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 234/565 (41%), Positives = 332/565 (58%), Gaps = 31/565 (5%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           I+IAQLN VVGD+ GN  K   A  +A+  G  L+L  EL + GY  EDL  + +F+QAC
Sbjct: 5   ISIAQLNFVVGDVPGNAQKILAAARDAHAAGARLLLTPELALCGYAAEDLYLRPAFVQAC 64

Query: 67  SSAIDTLKSDTHDG-GAGIVVGFPRQDQEGV--------LNSVVILDAGNIIAVRDKINL 117
             A++ L + T D  G  +VVG PR+   GV         N+  +L AG I     K  L
Sbjct: 65  EQALEGLAAATADWPGLTVVVGHPRRVAHGVGEGGRGLCHNAASVLRAGRIEHTYAKQYL 124

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           PNY  F E+R F+ G  N       +R+G+LICED W      +  ++ GA+ L +LNAS
Sbjct: 125 PNYEVFDERRYFVPGDENCVFEVDGVRMGLLICEDAWY-PGPARSAREAGAQVLVTLNAS 183

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY+  K  +R +++  ++    LP++Y + VGGQDE++F+G SF  +    +A +   F 
Sbjct: 184 PYHLGKAVEREQVMRERVLETGLPLVYAHLVGGQDEVVFEGRSFALNADGSVAARAPGFE 243

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD----YNACVLSLRDYVQKNNFH 293
           E+  + +    Q           +A  +  P+   E      ++A VL +RDYV KN F 
Sbjct: 244 EKTLLIKVQQAQ-----------AAIVLEAPVAPHEGWEAELWSALVLGVRDYVGKNGFP 292

Query: 294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVL 353
            V++GLSGG+DSAL  AIAVDALG + V+T+M+P  YT+  S  DA   A  LG +YD +
Sbjct: 293 GVLLGLSGGMDSALVLAIAVDALGADKVRTVMMPSPYTADISWIDARDMAGRLGVRYDEI 352

Query: 354 PIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISV 413
            I      F + ++      P     EN+Q+RIRG +LMALSN   +++LTT NKSE++ 
Sbjct: 353 AIAPQFEAFKTALAPQFASLPEDTTEENLQARIRGMLLMALSNKFGSLVLTTGNKSELAT 412

Query: 414 GYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG-ITSGLGPLTEVIPPSILEKSPSAE 472
           GY TLYGDM+GGF  +KD+ KT+VF LA WRN++    +G  P    IP  I+ + PSAE
Sbjct: 413 GYCTLYGDMAGGFAVIKDVVKTRVFALARWRNANDPYGTGANP----IPERIITRPPSAE 468

Query: 473 LRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQ 531
           LRP Q DQ+SLPPY +LD I++R +EN+E   +  +  +    V  V  L+  +EYKRRQ
Sbjct: 469 LRPDQKDQDSLPPYEVLDAIVERYMENDEPLEDIVRAGFERADVERVTRLIKLNEYKRRQ 528

Query: 532 APVGTKITAKSFGRDRLYPISNKFR 556
           APVG ++T +SFG+D  YPI+N+FR
Sbjct: 529 APVGVRVTRRSFGKDWRYPITNRFR 553


>gi|192362224|ref|YP_001983661.1| glutamine-dependent NAD+ synthetase signal peptide protein
           [Cellvibrio japonicus Ueda107]
 gi|190688389|gb|ACE86067.1| glutamine-dependent NAD+ synthetase signal peptide protein
           [Cellvibrio japonicus Ueda107]
          Length = 560

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 227/563 (40%), Positives = 334/563 (59%), Gaps = 34/563 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKA-RRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           + +L++ +AQ+N +VGDI GN AK    ARE   R  +D I++ EL ++GYPPEDL+ + 
Sbjct: 21  MSQLQLVLAQINTLVGDIPGNTAKVLASAREVLERGPVDAIIYPELTLTGYPPEDLLLRP 80

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S       A+D L          +VVG+PR+  + + N   ++ AG ++A   K  LPNY
Sbjct: 81  SLDGRIQRALDELLDARLP--TTLVVGYPRRRGDKLYNMAGVIQAGKLVAEYAKQCLPNY 138

Query: 121 SEFHEKRTFISGYSNDPIVFRDI---RLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
             F EKR F++G  + P +F D+      + +CEDIW    + +  +  GA  + +LNAS
Sbjct: 139 QVFDEKRYFVAG--DQPCLF-DLCGQPTALTVCEDIWHPEPMAQA-RAAGARLMLNLNAS 194

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY+  K ++R  ++  +     +P++YVN VGGQDEL+FDG S   D Q    +++  +S
Sbjct: 195 PYHQGKQQEREAMIAERAREGKMPVVYVNLVGGQDELVFDGGSVVVDAQGTTRYRVPAYS 254

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE-EADYNACVLSLRDYVQKNNFHKVI 296
           E N+           Q +  +     ++ +P+ E   A Y   VL L DYV KN F+ V+
Sbjct: 255 EGNYRL---------QLDLATGHCDPSLLVPVPERLSAVYQTLVLGLCDYVTKNRFNGVV 305

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL  AIAVDALG + V+ +M+P++YTS  S  DAA  A  LG +Y  + I 
Sbjct: 306 LGLSGGIDSALTLAIAVDALGADKVEAVMMPFRYTSDLSKNDAADEAARLGVRYGSISIE 365

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            +   F + ++            EN+Q+R RG +LMA+SN    ++LTT NKSE++VGY 
Sbjct: 366 PMYEAFMAALADEFAGTRRDTTEENLQARCRGVVLMAISNKKGYLVLTTGNKSEMAVGYS 425

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGF+ LKD+ KT VF+LA +RN+ G         EVIP +++ + PSAEL P 
Sbjct: 426 TLYGDMAGGFDVLKDVPKTLVFELARYRNTLG---------EVIPETVITRPPSAELAPD 476

Query: 477 QTDQESLPPYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAP 533
           Q D++SLPPY ILD I+   VE +   E+ I   + +  E V  V  L+  +EYKRRQAP
Sbjct: 477 QKDEDSLPPYEILDQILALYVEQDQSAEAIIA--RGFTREQVERVVRLVDINEYKRRQAP 534

Query: 534 VGTKITAKSFGRDRLYPISNKFR 556
           +G +I+ + FGRDR YPI++ ++
Sbjct: 535 IGVRISQRGFGRDRRYPITSGWQ 557


>gi|262373253|ref|ZP_06066532.1| NAD synthase [Acinetobacter junii SH205]
 gi|262313278|gb|EEY94363.1| NAD synthase [Acinetobacter junii SH205]
          Length = 541

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 231/555 (41%), Positives = 328/555 (59%), Gaps = 23/555 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  KIA+AQ +P +G+I  N  K       A +Q  DLI+F EL   GYP EDL+ + +
Sbjct: 1   MKNFKIALAQFSPHIGNIDANTQKMVEQANLAKQQQADLIIFPELSTIGYPAEDLLIRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGV-LNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L S+  D    +V GF  Q ++G   NS  ++  G ++ + +K NLPNY
Sbjct: 61  LSKRTQKAFAQL-SEVKD--IVMVFGFVHQTEDGYRYNSAAVMKDGQVLGIYNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICED+W + N  K L +   E    LNASPY 
Sbjct: 118 GVFDEKRYFQEGHQHLIFEYLGHKFGVLICEDVW-SLNTVKQLSQLNVETALVLNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + +      ++L ++YVNQVGGQD+LIFDG+SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRIQTLNELAKQLNLNLVYVNQVGGQDDLIFDGSSFVTNKNGEIALQAPSFQESI 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
           +  E+  +Q+     +   +SA     P  E  A+ Y A V++ RDYVQ++ F  VI+GL
Sbjct: 237 YFVEYDAEQK----EFKKTESA-----PALETFAEIYQALVMATRDYVQRSGFPGVILGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDA+G + VQ +M+PY YTS  S+EDA   A+ +G  + +  IH +V
Sbjct: 288 SGGIDSALTLAIAVDAIGADKVQAVMMPYTYTSQMSVEDATEQARRMGVTFGIAEIHPIV 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSEISVGY TLY
Sbjct: 348 NSFMQTLYPFFGNTPADATEENLQARTRGTLLMGLSNKFGNLVLSTGNKSEISVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GGF+ LKD+YKT VF+LA +RN+   T        VIP  ++ + PSAELRP QTD
Sbjct: 408 GDMVGGFSVLKDVYKTIVFELAKYRNTLSETP-------VIPERVISRPPSAELRPDQTD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLP Y +LD I+   +E ++S  +   + +  E V  V  L+  +EYKRRQ  +G +I
Sbjct: 461 QDSLPAYDVLDAILYAYIEEDQSQADIIARGFEAEVVEKVIRLVDRNEYKRRQGAIGPRI 520

Query: 539 TAKSFGRDRLYPISN 553
           ++++F R+R YPI N
Sbjct: 521 SSRAFSRERRYPIVN 535


>gi|254785219|ref|YP_003072647.1| glutamine-dependent NAD+ synthetase [Teredinibacter turnerae T7901]
 gi|237686319|gb|ACR13583.1| glutamine-dependent NAD+ synthetase [Teredinibacter turnerae T7901]
          Length = 542

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 227/562 (40%), Positives = 332/562 (59%), Gaps = 32/562 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANR-QGMDLILFTELFISGYPPEDLVFKK 60
           +  L IA+AQ+NP+VGDI GN  K  R  ++  R Q  D+++F EL ++GYPPEDL+ + 
Sbjct: 1   MTTLNIAMAQINPLVGDIDGNAKKILRVAQQLEREQHADIVVFPELTLTGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S  +    A++ L   +    + +V+G+P+     + N   ++  G +I    K  LPNY
Sbjct: 61  SCDRRVERALNWLCDQSL--ASYVVIGYPKTIAGRMYNMAGVICGGRVICEYAKQALPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G  +     + + +G+ ICEDIW    I +  + +GA+ L +LN SP+ 
Sbjct: 119 QVFDEKRYFSEGQESVTFDCKGVPVGLTICEDIWDGGPILRA-RAKGADLLLNLNGSPFD 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R  +V  + S + +P++YVNQVGGQDEL+FDG SFC +   ++      F E +
Sbjct: 178 AEKHAERERLVAARASEIGIPVVYVNQVGGQDELVFDGGSFCANPGGEILRMAPMFREHS 237

Query: 241 FMTEWHYDQ----QLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            +  ++  +     +S    + DD       PL      Y+A VL ++DYV KN F  V+
Sbjct: 238 AVVAFNAQEGTLAPVSNLQTLDDD-------PLA---VTYDALVLGVKDYVNKNGFKGVV 287

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL  AIAVDALG + V  +M+P++YTS  S  DA   A+ LG  Y  + I 
Sbjct: 288 LGLSGGIDSALTLAIAVDALGADRVNAVMMPFRYTSDMSKTDAEEEARRLGVSYQSISIE 347

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            + + F + ++            ENIQ+R RG +LMA+SN    ++LTT NKSE++VGY 
Sbjct: 348 PMYDAFSAQLAGAFANTQRDTTEENIQARSRGVLLMAISNKLGYLVLTTGNKSEMAVGYA 407

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GG + LKD+ KT VF L+ +RN+         ++ VIP S++ + PSAEL P 
Sbjct: 408 TLYGDMAGGLDVLKDVPKTLVFALSRYRNT---------VSAVIPESVITRPPSAELAPD 458

Query: 477 QTDQESLPPYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAP 533
           Q D++SLPPY ILD I+   VE +   E+ I  +  YN + V  V  L+  +EYKRRQAP
Sbjct: 459 QKDEDSLPPYEILDAILAMYVEQDLSAEAII--EAGYNRDDVMRVIRLIDINEYKRRQAP 516

Query: 534 VGTKITAKSFGRDRLYPISNKF 555
           VG +I+A++FGRDR YPI+N +
Sbjct: 517 VGIRISARAFGRDRRYPITNGW 538


>gi|262280051|ref|ZP_06057836.1| glutamine-dependent NAD+ synthetase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262260402|gb|EEY79135.1| glutamine-dependent NAD+ synthetase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 541

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 232/557 (41%), Positives = 328/557 (58%), Gaps = 27/557 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTKKMIEQVNQAKKQDADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L ++  D    +V GF  Q ++G   NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQL-AEVKD--IVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   + +  LNASPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTVLVLNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL I+YVNQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRTQTLSELAKQLHLNIVYVNQVGGQDDLIFDGTSFVSNKNGEIALQAPSFKEDL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
           ++ E+ +  +    ++   +SA     P  E  A+ Y   V++ RDYV+++ F  VI+GL
Sbjct: 237 YIAEFDHKNK----SFKVTESA-----PALETFAEIYQGLVMATRDYVERSGFPGVILGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +V
Sbjct: 288 SGGIDSALTLAIAVDAIGAEKVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSVV 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F   +  F    P+    EN+Q+R RG +LM LSN    ++L T NKSE+SVGY TLY
Sbjct: 348 NSFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLATGNKSELSVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GGF  LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q D
Sbjct: 408 GDMVGGFAVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           Q+SLP Y +LD I+   +  EE     D   + ++ E V  V  L+  +EYKRRQ  +G 
Sbjct: 461 QDSLPAYDVLDAILYAYI--EEDLGQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGP 518

Query: 537 KITAKSFGRDRLYPISN 553
           +IT+++F R+R YPI N
Sbjct: 519 RITSRAFSRERRYPIIN 535


>gi|261856576|ref|YP_003263859.1| NAD+ synthetase [Halothiobacillus neapolitanus c2]
 gi|261837045|gb|ACX96812.1| NAD+ synthetase [Halothiobacillus neapolitanus c2]
          Length = 561

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 234/566 (41%), Positives = 329/566 (58%), Gaps = 35/566 (6%)

Query: 5   LKIAIAQLNPVVGDIAGN----IAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           ++IA+AQ++  VG+   N    I    RAR+E   +   +++F EL ++GYPPEDL+ + 
Sbjct: 12  VRIALAQVSTQVGNCIANADRVIETIARARQELQAR---VVVFPELTLTGYPPEDLLLRH 68

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQ---------DQEGVL-NSVVILDAGNIIA 110
            F+  C + I+ + +  HD    +++G PR+         D    L N+ +++D G I+A
Sbjct: 69  DFLAQCDAQIERIAAAAHD--MAVIIGAPRRMNGDTHQPGDAPAALENAAIVIDRGQIVA 126

Query: 111 VRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEF 170
              K  LPNY  F EKR F  G     +    + LGI ICEDIW+ S   +     GA+ 
Sbjct: 127 HYAKRALPNYGVFDEKRYFKKGREACVVEIDGVPLGITICEDIWE-SRPAEEAAAAGAKV 185

Query: 171 LFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLA 230
           + +LNASPY+ +K  +R  +V+ ++     PIIYVN VGGQDEL+FDG SF  D   Q+ 
Sbjct: 186 ILTLNASPYHRHKTDERARVVSQRVRETGCPIIYVNLVGGQDELVFDGRSFVAD-HSQIV 244

Query: 231 FQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKN 290
            ++  F E     +   D +++           + + P  EEE  Y+A    +RDYV+KN
Sbjct: 245 SKLPAFKESLGWVDVFPDGRITA-------HGESHHWPHGEEEV-YSALTAGIRDYVRKN 296

Query: 291 NFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKY 350
            FH +++GLSGGIDSAL   +AVDALG ENV  + +P +YTSP SL DAA     +G   
Sbjct: 297 GFHGIVLGLSGGIDSALVLTLAVDALGAENVLAVRMPSRYTSPMSLTDAAEQCAHMGVAM 356

Query: 351 DVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSE 410
           + L I  + N   S +S            EN+Q+R RG +LMALSN    MLLTT NKSE
Sbjct: 357 ETLSIEPVFNELKSSLSPLFAGLAEDATEENLQARTRGVLLMALSNKFGRMLLTTGNKSE 416

Query: 411 ISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPS 470
           ++VGY TLYGDM+GGF P+KD+ K  V+ LA WRN+H   +G  P    IP  ++E+ PS
Sbjct: 417 LAVGYATLYGDMAGGFAPIKDVPKMLVYALARWRNTH--KTGEHP---PIPTRVIEREPS 471

Query: 471 AELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQEYNDET-VRYVEHLLYGSEYKR 529
           AELR  Q D +SLPPY +LD II   VE ++S  +      DE  VR +  L+  +EYKR
Sbjct: 472 AELRADQRDADSLPPYELLDRIITAFVEEDQSIEDMVAAGLDEAIVRRITRLILLNEYKR 531

Query: 530 RQAPVGTKITAKSFGRDRLYPISNKF 555
           RQAP G +I+ ++FGRDR YPI++ F
Sbjct: 532 RQAPPGIRISRRAFGRDRRYPITSGF 557


>gi|121594129|ref|YP_986025.1| NAD+ synthetase [Acidovorax sp. JS42]
 gi|120606209|gb|ABM41949.1| NAD+ synthetase [Acidovorax sp. JS42]
          Length = 554

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 233/565 (41%), Positives = 331/565 (58%), Gaps = 31/565 (5%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           I+IAQ N VVGD+ GN  K   A  +A+  G  L+L  EL + GY  EDL  + +F+QAC
Sbjct: 5   ISIAQRNFVVGDVPGNAQKILAAARDAHAAGARLLLTPELALCGYAAEDLYLRPAFVQAC 64

Query: 67  SSAIDTLKSDTHDG-GAGIVVGFPRQDQEGVL--------NSVVILDAGNIIAVRDKINL 117
             A++ L + T D  G  +VVG PR+   GV         N+  +L AG I     K  L
Sbjct: 65  EQALEGLAAATADWPGLTVVVGHPRRVAHGVGEGGRGLCHNAASVLRAGRIEHTYAKQYL 124

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           PNY  F E+R F+ G  N       +R+G+LICED W      +  ++ GA+ L +LNAS
Sbjct: 125 PNYEVFDERRYFVPGDENCVFEVEGVRMGLLICEDAWY-PGPARSAREAGAQVLVTLNAS 183

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY+  K  +R +++  ++    LP++Y + VGGQDE++F+G SF  +    +A +   F 
Sbjct: 184 PYHLGKAVEREQVMRERVQETGLPLVYAHLVGGQDEVVFEGRSFALNADGNVAARAPGFE 243

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD----YNACVLSLRDYVQKNNFH 293
           E+  + +    Q           +A  +  P+   E      ++A VL +RDYV KN F 
Sbjct: 244 EKTLLIKVQQAQ-----------AAIVLEAPVAPHEGWEAELWSALVLGVRDYVGKNGFP 292

Query: 294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVL 353
            V++GLSGG+DSAL  AIAVDALG + V+T+M+P  YT+  S  DA   A  LG +YD +
Sbjct: 293 GVLLGLSGGMDSALVLAIAVDALGADKVRTVMMPSPYTADISWIDARDMAARLGVRYDEI 352

Query: 354 PIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISV 413
            I      F + ++      P     EN+Q+RIRG +LMALSN   +++LTT NKSE++ 
Sbjct: 353 AIAPQFEAFKTALAPQFAGLPEDTTEENLQARIRGMLLMALSNKFGSLVLTTGNKSELAT 412

Query: 414 GYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG-ITSGLGPLTEVIPPSILEKSPSAE 472
           GY TLYGDM+GGF  +KD+ KT+VF LA WRN++    +G  P    IP  I+ + PSAE
Sbjct: 413 GYCTLYGDMAGGFAVIKDVVKTRVFALARWRNANDPYGTGANP----IPERIITRPPSAE 468

Query: 473 LRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQ 531
           LRP Q DQ+SLPPY +LD I++R +EN+E   +  +  +    V  V  L+  +EYKRRQ
Sbjct: 469 LRPDQKDQDSLPPYEVLDAIVERYMENDEPLEDIVRAGFERADVERVTRLIKLNEYKRRQ 528

Query: 532 APVGTKITAKSFGRDRLYPISNKFR 556
           APVG ++T +SFG+D  YPI+N+FR
Sbjct: 529 APVGVRVTRRSFGKDWRYPITNRFR 553


>gi|326796307|ref|YP_004314127.1| NAD+ synthetase [Marinomonas mediterranea MMB-1]
 gi|326547071|gb|ADZ92291.1| NAD+ synthetase [Marinomonas mediterranea MMB-1]
          Length = 545

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 223/560 (39%), Positives = 332/560 (59%), Gaps = 20/560 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEA-NRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           L++A+AQL+ +VGDI  N     +A  EA +    D+++F EL ++GYPPEDL+ + S  
Sbjct: 3   LRVAMAQLDMLVGDIKNNTESVIKAAHEARDHHQADVVVFPELTLTGYPPEDLLLRPSLD 62

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
                +I T+ ++ HD    +VVG+PR+    + N   +   G ++    K  LPN+  F
Sbjct: 63  SRIEDSIQTILNEVHD--IYVVVGYPRRIDGDLFNCAGVFHQGRMLGEYAKQKLPNFKVF 120

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            +KR F  G     +  +++++G+ ICEDIW +       ++ GAE + +L+ASP++  K
Sbjct: 121 DDKRYFEEGTEPLIVDVKNVKVGLSICEDIW-HPEPSLQAQEAGAELIINLSASPFHIEK 179

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
           +  R +++  +     LPI++VN +G QDEL+++G SF  + Q Q   Q   F    +  
Sbjct: 180 MGVREQLLHQRAVETQLPIVFVNYMGAQDELVYEGGSFVVNAQGQKIAQAPWFESGIYTV 239

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
           ++  ++  +Q        AST+   L  EE+ Y A VL LRDY++KN F  +++GLSGGI
Sbjct: 240 DFSVEETRTQKVI---PLASTVAPALSIEESVYQAMVLGLRDYIEKNRFKGIVLGLSGGI 296

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL  A+AVDA+G + VQ +M+PY YTS  SLEDA   A  LG  Y VLPI  +V  F 
Sbjct: 297 DSALSLAVAVDAIGADRVQAVMMPYTYTSSMSLEDAEEEATLLGVNYSVLPIEPMVTAFM 356

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
             ++   +        EN+Q+R RG  LMA+SN    M+LTT NKSE++VGY TLYGDM 
Sbjct: 357 ETLAPEFEGYAKDTTEENLQARTRGVTLMAISNKKGYMVLTTGNKSEMAVGYATLYGDMV 416

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GG++ LKD++KT VF+L  +RN+ G          VIP  ++ + PSAEL P Q D++SL
Sbjct: 417 GGYSVLKDVFKTLVFKLCRYRNTLGY---------VIPERVITRPPSAELAPDQIDEDSL 467

Query: 484 PPYPILDDIIKRIVENEES--FINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           P Y  LD+I+   +E + S   I    +++ ETV  V  L+  +EYKRRQAP G ++T +
Sbjct: 468 PSYDELDEILHLYIERDMSAEAILEIGQFDRETVYRVLRLVDLNEYKRRQAPTGVRLTER 527

Query: 542 SFGRDRLYPISNKFRDHISE 561
            FGRDR YPI+N +  HI +
Sbjct: 528 GFGRDRRYPITNGW--HIGD 545


>gi|319762455|ref|YP_004126392.1| nad+ synthetase [Alicycliphilus denitrificans BC]
 gi|317117016|gb|ADU99504.1| NAD+ synthetase [Alicycliphilus denitrificans BC]
          Length = 552

 Score =  408 bits (1049), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 239/564 (42%), Positives = 332/564 (58%), Gaps = 27/564 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L I+IAQLN VVGD+ GN  K   A  +A   G  L+L  EL I GY  EDL  + +F+ 
Sbjct: 3   LAISIAQLNFVVGDLQGNAQKIIDAARQAYAAGARLLLTPELAICGYAAEDLFLRPAFLA 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFPRQDQ------EGVLNSVVILDAGNIIAVRDKINL 117
           AC  A+  +   T D  G  IV+G PR            LN+  +L AG +     K  L
Sbjct: 63  ACDEAVQAVARGTADLAGLAIVLGHPRAAAPGAPAFSSCLNAASVLRAGRVEQTYTKREL 122

Query: 118 PNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLN 175
           PNY  F E+R F++G  + P VF    +R+G+LICED W ++   +     GA+ L  +N
Sbjct: 123 PNYQVFDERRYFVAG--DAPCVFEVEGVRVGLLICEDAWFSAP-ARDAATAGAQLLAVIN 179

Query: 176 ASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKH 235
           ASP++  K  +R + +  +++   LP++Y + VGGQDE++F+G SF  +    +A +   
Sbjct: 180 ASPFHLGKGAEREQTMRERVAETGLPLVYAHLVGGQDEVVFEGRSFALNADGTVAMRAPA 239

Query: 236 FSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHK 294
           F E+    + H  Q   +   M  D A     P +  EAD ++A VL +RDYV KN F  
Sbjct: 240 FEEKLVFAQVHQAQAAIE---MEADVA-----PERSLEADLWDALVLGVRDYVGKNGFPG 291

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
            ++GLSGGIDSAL  AIAVDALG + V+T+M+P  YT+  S  DA   A  LG +YD + 
Sbjct: 292 ALLGLSGGIDSALVLAIAVDALGADKVRTVMMPSPYTADISWIDARDMAARLGVRYDEIA 351

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I      F + ++   +        EN+Q+RIRG +LMALSN   A++LTT NKSE++ G
Sbjct: 352 IAPQFEAFKAALAPLFEGRAEDTTEENLQARIRGTLLMALSNKFGAVVLTTGNKSEMATG 411

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG-ITSGLGPLTEVIPPSILEKSPSAEL 473
           Y TLYGDM+GGF  +KD+ KT+VF LA WRN++    +G  P    IP  I+ + PSAEL
Sbjct: 412 YCTLYGDMAGGFAVIKDVVKTRVFDLARWRNANDPYGTGANP----IPERIIIRPPSAEL 467

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQA 532
           RP Q DQ+SLPPY +LD I+ R +EN+E   +  +  Y+   V  V  L+  +EYKRRQA
Sbjct: 468 RPDQKDQDSLPPYEVLDAILARYMENDEPVEDIVRAGYDRADVERVTRLIKINEYKRRQA 527

Query: 533 PVGTKITAKSFGRDRLYPISNKFR 556
           PVG ++T +SFG+D  YPI+NKFR
Sbjct: 528 PVGVRVTRRSFGKDWRYPITNKFR 551


>gi|57234088|ref|YP_181837.1| glutamine-dependent NAD(+) synthetase [Dehalococcoides ethenogenes
           195]
 gi|57224536|gb|AAW39593.1| glutamine-dependent NAD(+) synthetase [Dehalococcoides ethenogenes
           195]
          Length = 566

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 232/576 (40%), Positives = 338/576 (58%), Gaps = 36/576 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + KL++A+AQ++ VVGD+AGN A   R  +EA   G D+I+F EL I GYPPEDL+ K  
Sbjct: 1   MGKLRLAMAQIDSVVGDLAGNTACIIRHIQEARSLGADVIVFPELAICGYPPEDLLHKPR 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++    ++D++   +   G  ++VG+      G+ NS  I+   ++I    KI LPNY 
Sbjct: 61  FVEGNLHSLDSVIKASE--GITVIVGY-VDSHNGLHNSAAIIHNASLIDSYHKIFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F+ G          +R+G+ ICEDIW  S        +GAE + +++ASPY+ 
Sbjct: 118 VFDENRYFLPGNRCPVYTICGLRVGVNICEDIWFASGPSTAQSNKGAELIINISASPYHF 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K  +R ++++ +     + I Y N VGGQDEL+FDGAS  FD    L  + K F E   
Sbjct: 178 GKRNQREKMLSDRARENRVYIAYTNMVGGQDELVFDGASNVFDYTGNLVLRGKQFQEDLL 237

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYI------------------PLQEEEADYNACVLSL 283
           + +      L++   MS +   ++++                  PL  +   Y A +L  
Sbjct: 238 VLDLDI-PALTRQGDMSTEIPDSIFVSASGLSEPKLPFENSDSVPLDADAEVYQALLLGT 296

Query: 284 RDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACA 343
           +DY+ KN F KV+IGLSGGIDS+L AAIA DALG +NV  +++P +Y+S  S+ D+   A
Sbjct: 297 KDYINKNGFKKVVIGLSGGIDSSLVAAIATDALGADNVVGVIMPSRYSSAGSISDSLRLA 356

Query: 344 KALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLL 403
           + LG K   +PI  +   F S +S+      +    ENIQ+RIRGN+LMALSN    ++L
Sbjct: 357 ENLGIKTLQIPIDPIFKSFLSTLSEVFAGTETDTTEENIQARIRGNLLMALSNKFHWLVL 416

Query: 404 TTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPS 463
            TSNKSE ++GY TLYGDM+GGF  +KD+ K  V++LA  RN    ++G     E+IP +
Sbjct: 417 NTSNKSETAIGYSTLYGDMAGGFAIIKDVPKVLVYRLAHNRNK---SAGF----ELIPHN 469

Query: 464 ILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ----EYNDETVRYVE 519
           +L K PSAEL+P+Q D +SLPPY +LD I++  VE ++S    DQ     + +  V+ V 
Sbjct: 470 VLTKPPSAELKPNQLDTDSLPPYELLDPILEAYVEQDKSI---DQIVALGFEESIVKRVV 526

Query: 520 HLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
            ++  SEYKRRQAP G KIT K+FGRDR  PI+N++
Sbjct: 527 KMVDRSEYKRRQAPPGIKITPKAFGRDRRLPITNRY 562


>gi|224826930|ref|ZP_03700029.1| NAD+ synthetase [Lutiella nitroferrum 2002]
 gi|224600917|gb|EEG07101.1| NAD+ synthetase [Lutiella nitroferrum 2002]
          Length = 530

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 228/554 (41%), Positives = 328/554 (59%), Gaps = 28/554 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IA+AQ NPVVGDIAGN  K      +A  QG D+++  EL ++GY PEDL+ +  F +
Sbjct: 1   MRIALAQFNPVVGDIAGNTRKILDLARQAMAQGADVLVTPELALTGYSPEDLLLRDHFYR 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
            CS A+D L       G  +VVG P +      N+  ++  GN +    K+ LPN   F 
Sbjct: 61  ECSKALDEL---LELDGITLVVGHPVKLGNERFNAATVMRDGNRLGQYHKMLLPNNEVFD 117

Query: 125 EKRTFISGYSNDPIVFRD--IRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           E R F  G +  P+VF    + +G+LICED+W + +        GA+ +  LNASP++ N
Sbjct: 118 ECRYFTPGGA--PLVFPQDGVNVGVLICEDVW-SLDPAAEAADAGADVVVVLNASPFHRN 174

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K++ RHE V  ++    LP  YVN  GGQDEL+FDGASF  +   ++  Q   + ++  +
Sbjct: 175 KIETRHETVRYRVEETGLPFAYVNLTGGQDELVFDGASFALNKAGEVVAQAAAYDDELLI 234

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
                  Q++  + +     +T+  PL   E+ Y   V+ +RDY+ KN F  V++GLSGG
Sbjct: 235 V------QMADGD-LQPAGKATLPCPL---ESVYRTLVIGVRDYIGKNGFPGVLLGLSGG 284

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL  AIA DALG + V  +M+P +YT+  S++D+    + LG KY+ + I  +   F
Sbjct: 285 IDSALTLAIAYDALGADKVHAVMMPSRYTADISVDDSRDMVERLGVKYEEIAIWPMYESF 344

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            + ++   +        EN+Q+RIRG +LMALSN +  ++LTT NKSE++ GY TLYGDM
Sbjct: 345 MAALAPSFEGLAEDTTEENLQARIRGTLLMALSNKTGKLVLTTGNKSEMTTGYCTLYGDM 404

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF  LKD+ KT V+QL  WRN+          +E+IP  I+ + PSAELRP Q DQ+S
Sbjct: 405 AGGFAVLKDVAKTLVYQLCHWRNAQ---------SEIIPLRIITRPPSAELRPDQKDQDS 455

Query: 483 LPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY +LD I+ R VE   S      E + +  VR V  LL  +EYKRRQAPVG ++T +
Sbjct: 456 LPPYDVLDAIMARYVEENLSAAEIIAEGFAEADVRRVVRLLKINEYKRRQAPVGPRVTHR 515

Query: 542 SFGRDRLYPISNKF 555
            FG+D  YPI+N+F
Sbjct: 516 GFGKDWRYPITNRF 529


>gi|257454474|ref|ZP_05619734.1| glutamine-dependent NAD(+) synthetase [Enhydrobacter aerosaccus
           SK60]
 gi|257448132|gb|EEV23115.1| glutamine-dependent NAD(+) synthetase [Enhydrobacter aerosaccus
           SK60]
          Length = 614

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 224/552 (40%), Positives = 328/552 (59%), Gaps = 15/552 (2%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           LKIA+AQ   +VGD+  N  K     ++A  +G ++I+F EL + GYPPEDL+ + S   
Sbjct: 70  LKIAVAQQQFIVGDVINNAKKMVELAKDARDKGANIIVFPELSLLGYPPEDLLLRPSLAS 129

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
               A + L +        ++VG+P  D  G  NSV I+  G       K  LPNY  F 
Sbjct: 130 RVKLAFELLYTVKD---IVMLVGYPHIDPNGTFNSVAIIHNGQQKGFYHKQCLPNYGVFD 186

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E+R F +G++     ++ + +G+LICED+W+++ I + LK++GAE + SLNASP+  NK 
Sbjct: 187 ERRYFNTGHNQVLFDYQGLTIGLLICEDLWQDAPI-RALKEKGAEIIISLNASPFEQNKQ 245

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           ++R  ++  + +  ++PI+Y N VGGQD+L+FDG S   + Q ++  +   F +      
Sbjct: 246 EQRKALLKSRATEHNIPIVYANSVGGQDDLVFDGGSMVVNAQGKIVQEAPRFLQHTLYVV 305

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
             +D Q  Q   +S+   S +   L +    Y A V+ LRDYV  + F  V++GLSGGID
Sbjct: 306 ARHDAQSGQV-ILSEQRKSPL--ALSQIAETYQALVVGLRDYVNHSGFKGVLVGLSGGID 362

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL   IAVDALG + V  +M+PY+YTS  SL+DA A A  L   Y V PIH  V     
Sbjct: 363 SALTLCIAVDALGADKVYAVMMPYEYTSQISLQDAQAQAHRLNVSYTVCPIHAAVEGMRH 422

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        +    ENIQ+R RG ILMALSN    +++TT NKSE++VGY TLYGDM+G
Sbjct: 423 TLEPMFSNTTADTTEENIQARARGMILMALSNKFGHLVITTGNKSEMAVGYATLYGDMAG 482

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF+ LKD+YKTQV+ LA++RN           T VIP  ++ + PSAELRP Q DQ+SLP
Sbjct: 483 GFDVLKDVYKTQVYALANYRNRL-------EETPVIPERVITRPPSAELRPDQKDQDSLP 535

Query: 485 PYPILDDIIKRIVENEESF-INNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
            Y  LD +++  ++ +  +    +  Y+ + V+ V  ++  +EYKRRQA +GTKIT ++F
Sbjct: 536 DYDTLDKMLELYIDRDFGYDAIVEAGYDKDVVKKVLSMVDRNEYKRRQAAIGTKITHRAF 595

Query: 544 GRDRLYPISNKF 555
           GR+R YP+ N +
Sbjct: 596 GRERRYPLVNHW 607


>gi|299771316|ref|YP_003733342.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter sp.
           DR1]
 gi|298701404|gb|ADI91969.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter sp.
           DR1]
          Length = 541

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 232/555 (41%), Positives = 326/555 (58%), Gaps = 23/555 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTKKMIEQVNQAKKQNADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L ++  D    +V GF  Q ++G   NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQL-AEVKD--IVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   + +  LNASPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTVLVLNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL I+YVNQVGGQD+LIFDG SF  +    +A Q   F E  
Sbjct: 177 VGKPQHRTQTLSELAKQLHLNIVYVNQVGGQDDLIFDGTSFVSNKDGGIALQAPSFKEDL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
           ++ E+    +     +   +SA     P  E  A+ Y   VL+ RDYV+++ F  VI+GL
Sbjct: 237 YIAEFDPKNKA----FKVTESA-----PALETFAEIYQGLVLATRDYVERSGFPGVILGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +V
Sbjct: 288 SGGIDSALTLAIAVDAIGAEKVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSVV 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F   +  F    P+    EN+Q+R RG +LM LSN    ++L T NKSE+SVGY TLY
Sbjct: 348 NSFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLATGNKSELSVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GGF  LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q D
Sbjct: 408 GDMVGGFAVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLP Y +LD I+   +E + S  +   + ++ E V  V  L+  +EYKRRQ  +G +I
Sbjct: 461 QDSLPAYDVLDAILYAYIEEDLSQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGPRI 520

Query: 539 TAKSFGRDRLYPISN 553
           T+++F R+R YPI N
Sbjct: 521 TSRAFSRERRYPIVN 535


>gi|126666675|ref|ZP_01737652.1| NAD synthase [Marinobacter sp. ELB17]
 gi|126628720|gb|EAZ99340.1| NAD synthase [Marinobacter sp. ELB17]
          Length = 554

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 218/561 (38%), Positives = 333/561 (59%), Gaps = 29/561 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSFI 63
           L++ + Q + +VGDI GN  +   A  +A+ Q   D+++F EL ++GYPPEDL+ + S  
Sbjct: 17  LRLVMVQQDFLVGDIPGNAQRIVAAVRQADDQHQADIVVFPELALTGYPPEDLLLRPSLD 76

Query: 64  QACSSAIDTLKSDTHDGGAG----IVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
               +AID +       GAG    +V G P ++   + N+ ++++ G I     K   PN
Sbjct: 77  IRVQAAIDEI------CGAGLAPVVVFGAPVRENGKLYNAALVMENGKISHRYFKQCPPN 130

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           Y  F EKR F SG+ +  +  R + +GI +CED+W    + +     GA+ + +LNASPY
Sbjct: 131 YQVFDEKRYFASGFESSVVSLRGVNVGITVCEDLWAEGPV-ETAAAAGAKLVLNLNASPY 189

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
              K  +R  +V  +     +PI+YVN VG QDEL+FDG S   DG+ ++A +   F + 
Sbjct: 190 SKGKQLRRKALVQRKAKAAGVPIVYVNLVGAQDELVFDGGSLVADGKGEIAAEAPQFEQG 249

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
            F+ ++   +       +       +  PL    A Y A V+ +RDYV KN F  V++GL
Sbjct: 250 LFVVDFKCGE-------ICQPVTQPLPQPLSASAAVYQALVMGVRDYVGKNGFKSVVLGL 302

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDALGK  V+ +M+P++YTS  SL+DA A A  +G  YDV  I  + 
Sbjct: 303 SGGIDSALTLAIAVDALGKAQVRAVMMPFRYTSDISLQDAEAQASTMGVHYDVFSIEPMY 362

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           + F + +++           EN+Q+R+RG +LM+LSN   +++LTT NKSE++VGY TLY
Sbjct: 363 DTFMATLAEPFTGTTVDTTEENLQARLRGVLLMSLSNKFGSLVLTTGNKSEMAVGYSTLY 422

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGF+ LKD+ KTQVF+L+ +RN+         +  VIP  ++ + PSAEL P Q D
Sbjct: 423 GDMAGGFDVLKDVAKTQVFELSRYRNT---------VAPVIPERVITRPPSAELAPDQKD 473

Query: 480 QESLPPYPILDDIIKRIVENEESF-INNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           +++LP Y +LD I++R VE +ES  +     ++   V  V  L+  +EYKRRQAP+G ++
Sbjct: 474 EDNLPGYDVLDAILQRYVEQDESAEVIIAAGFDRTDVERVIRLVDINEYKRRQAPIGVRV 533

Query: 539 TAKSFGRDRLYPISNKFRDHI 559
           + + FG+DR YPI+N ++  +
Sbjct: 534 SERGFGKDRRYPITNGWKSGV 554


>gi|326570757|gb|EGE20782.1| NAD+ synthetase [Moraxella catarrhalis BC1]
 gi|326573020|gb|EGE22996.1| NAD+ synthetase [Moraxella catarrhalis CO72]
 gi|326573542|gb|EGE23505.1| NAD+ synthetase [Moraxella catarrhalis 101P30B1]
          Length = 563

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 229/553 (41%), Positives = 320/553 (57%), Gaps = 19/553 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           ++  AI Q N  VGDIAGN+ K      +A  +G D+++F EL + GYPPEDL+ + +  
Sbjct: 25  QMTFAIIQTNFWVGDIAGNVKKMHALTLDAKARGADIVIFPELALVGYPPEDLLLRPTLG 84

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +    A+  L       G  +++G+P  D  G  NS  IL  G+      K  LPNY  F
Sbjct: 85  ERVREAMAKLAEIE---GIVVILGYPHIDHHGTFNSAAILQDGSQKGFYHKQCLPNYGIF 141

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F  G +     ++ + +G+LICEDIW +  I + LK+ GA+ +  +NASP+   K
Sbjct: 142 DEQRYFQKGLNQVLFDYKGVTIGLLICEDIWHDEPI-QALKQAGADLVIVINASPFEIGK 200

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
              R  ++T   S  HLPIIYVN VG QD+++FDG S       ++A +   F  Q  M 
Sbjct: 201 QTARKSLLTRHSSTHHLPIIYVNTVGAQDDIVFDGGSLITQSDGRVAHEGVRFLNQLLMA 260

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
              +D Q   +     D+ +   + L EE   Y A V+ LRDYV ++ F  VI+GLSGGI
Sbjct: 261 --RFDTQNKTF-----DTQAKAPLVLSEESEMYQALVVGLRDYVNRSGFKGVIVGLSGGI 313

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IAVDALG + V  +M+PY+YT+  SLEDA A A  L   Y V PIHD V    
Sbjct: 314 DSALTLCIAVDALGCDRVYAVMMPYEYTAQISLEDAEAQAARLNVSYTVCPIHDAVAGLR 373

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++  L      +  EN+Q+R RG ILMALSN    M+++T NKSE +VGY TLYGDM 
Sbjct: 374 SALAPLLANSEPDVTEENLQARARGTILMALSNKFGHMVISTGNKSENAVGYSTLYGDMV 433

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+YKT V++LA++RN             VIP  ++ + PSAELRP+Q DQ+SL
Sbjct: 434 GGFDVLKDVYKTDVYRLANYRNRL-------EDNPVIPERVITRPPSAELRPNQKDQDSL 486

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
             Y  LD I+K  ++++  +       +  +TV  +  ++  +EYKRRQ  +GTKIT KS
Sbjct: 487 GDYETLDSILKMYIDDDLGYKAIVAAGFEPKTVEKILSMVDRAEYKRRQGAIGTKITKKS 546

Query: 543 FGRDRLYPISNKF 555
           FGR+R YP+ N +
Sbjct: 547 FGRERRYPLVNGW 559


>gi|326564236|gb|EGE14470.1| NAD+ synthetase [Moraxella catarrhalis 46P47B1]
          Length = 563

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 229/553 (41%), Positives = 320/553 (57%), Gaps = 19/553 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           ++  AI Q N  VGDIAGN+ K      +A  +G D+++F EL + GYPPEDL+ + +  
Sbjct: 25  QMTFAIIQTNFWVGDIAGNVKKMHALTLDAKARGADIVIFPELALVGYPPEDLLLRPTLG 84

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +    A+  L       G  +++G+P  D  G  NS  IL  G+      K  LPNY  F
Sbjct: 85  ERVREAMAKLAEIE---GIVVILGYPHIDHHGTFNSAAILQDGSQKGFYHKQCLPNYGIF 141

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F  G +     ++ + +G+LICEDIW +  I + LK+ GA+ +  +NASP+   K
Sbjct: 142 DEQRYFQKGLNQVLFDYKGVTIGLLICEDIWHDEPI-QALKQAGADLVIVINASPFEIGK 200

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
              R  ++T   S  HLPIIYVN VG QD+++FDG S       ++A +   F  Q  M 
Sbjct: 201 QTARKSLLTRHSSTHHLPIIYVNTVGAQDDIVFDGGSLITQSDGRVAHEGVRFLNQLLMA 260

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
              +D Q   +     D+ +   + L EE   Y A V+ LRDYV ++ F  VI+GLSGGI
Sbjct: 261 --RFDTQNKTF-----DTQAKAPLVLSEESEMYQALVVGLRDYVNRSGFKGVIVGLSGGI 313

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IAVDALG + V  +M+PY+YT+  SLEDA A A  L   Y V PIHD V    
Sbjct: 314 DSALTLCIAVDALGCDRVYAVMMPYEYTAQISLEDAEAQAARLNVSYTVCPIHDAVAGLR 373

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++  L      +  EN+Q+R RG ILMALSN    M+++T NKSE +VGY TLYGDM 
Sbjct: 374 SALAPLLANSEPDVTEENLQARARGTILMALSNKFGHMVISTGNKSENAVGYSTLYGDMV 433

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+YKT V++LA++RN             VIP  ++ + PSAELRP+Q DQ+SL
Sbjct: 434 GGFDVLKDVYKTDVYRLANYRNRL-------EDNPVIPERVITRPPSAELRPNQKDQDSL 486

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
             Y  LD I+K  ++++  +       +  +TV  +  ++  +EYKRRQ  +GTKIT KS
Sbjct: 487 GDYETLDSILKMYIDDDLGYKAIVAAGFEPKTVEKILGMVDRAEYKRRQGAIGTKITKKS 546

Query: 543 FGRDRLYPISNKF 555
           FGR+R YP+ N +
Sbjct: 547 FGRERRYPLVNGW 559


>gi|34497071|ref|NP_901286.1| NAD synthetase [Chromobacterium violaceum ATCC 12472]
 gi|34102928|gb|AAQ59292.1| glutamine-dependent NAD+ synthetase signal peptide protein
           [Chromobacterium violaceum ATCC 12472]
          Length = 530

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 225/554 (40%), Positives = 327/554 (59%), Gaps = 28/554 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IA+AQ NPVVGDI GN  K       A  QG D++L  EL ++GY PEDL+ + SF +
Sbjct: 1   MRIALAQFNPVVGDIVGNAQKIVDLANAALAQGADILLTPELALTGYSPEDLLLRDSFYR 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
             +  +D ++      G  ++VG P +      N+  +L  GN +    K+ LPNY  F 
Sbjct: 61  EVARGLDIIE---QLDGITVIVGHPARIGNERFNAATVLRDGNRLGQYHKMLLPNYEVFD 117

Query: 125 EKRTFISGYSNDPIVFRD--IRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           E R F  G +  P+VF    +++G+LICED W+     +      AE L SLNASP++ +
Sbjct: 118 ECRYFTPGAA--PLVFEQNGVKVGVLICEDAWQLEPAAEAADAG-AELLLSLNASPFHRD 174

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K++ RH+++  ++    LP+ Y N VGGQDEL+FDG SF  D    +A Q   + ++  +
Sbjct: 175 KIETRHQVMRYRVEETGLPLAYANLVGGQDELVFDGGSFALDKAGNVAAQAAAYDDELLL 234

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
            ++ Y       ++     A+   +P  +E   Y A V+ +RDY+ KN F   ++GLSGG
Sbjct: 235 VDFAYG------DFQPGRQAA---LPGAQESV-YRALVVGVRDYIGKNGFPGALLGLSGG 284

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL  A+AVDALG + V  +M+P +YT+  S+ D+      LG KYD + I  +   F
Sbjct: 285 IDSALTLAVAVDALGADKVHAVMMPSRYTADISVTDSRDMIGRLGVKYDEIEIWPMYESF 344

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            + ++            EN+Q+RIRG +LMALSN S  ++LTT NKSE++ GY TLYGDM
Sbjct: 345 MAALAPSFAGLEMDTTEENLQARIRGTLLMALSNKSGKLVLTTGNKSEMTTGYCTLYGDM 404

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF  LKD+ KT VF+L  WRN+         ++++IP  I+ + PSAELRP Q DQ+S
Sbjct: 405 AGGFAVLKDVAKTLVFELCRWRNT---------VSDIIPERIITRPPSAELRPDQKDQDS 455

Query: 483 LPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY +LD I+ R VE+ +S  +     + +  V  V  LL  +EYKRRQAPVG ++T +
Sbjct: 456 LPPYEVLDAIMARYVEDNQSAADIIAAGFAEADVNRVVRLLKINEYKRRQAPVGPRVTQR 515

Query: 542 SFGRDRLYPISNKF 555
            FG+D  YPI+NKF
Sbjct: 516 GFGKDWRYPITNKF 529


>gi|84514343|ref|ZP_01001707.1| NAD(+) synthase [Loktanella vestfoldensis SKA53]
 gi|84511394|gb|EAQ07847.1| NAD(+) synthase [Loktanella vestfoldensis SKA53]
          Length = 553

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 239/559 (42%), Positives = 349/559 (62%), Gaps = 10/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +  ++ +AQLNP +GD+AGN A A +A  E    G DL++  E+F++GY  +DLV K 
Sbjct: 1   MTRIFRLTMAQLNPTLGDLAGNAALAAQAWAEGKAAGADLVVLPEMFLTGYQTQDLVRKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+   +S +D L     DG   + +G P  + + + N  V L  G I A   K  LPN+
Sbjct: 61  AFVADAASRLDALARACADGPV-LGIGLPMVEDDNLYNCYVYLAGGKITARFRKHFLPNF 119

Query: 121 SEFHEKRTFISGYSNDPIVFRD-IRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           + F E R F S   + P+      R+G  ICED W + ++C+ + + GA+ L   N SPY
Sbjct: 120 NVFDEVRLFNSAAISGPVTLAGGPRIGTPICEDAW-SPDVCETMVESGAQILVVPNGSPY 178

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           + +K   R + +  ++    +P++Y+N +GGQD+ +FDG SF  +   +LA Q+  F   
Sbjct: 179 FRDKFPIRLQTMIARVVENDVPLVYLNMIGGQDDQMFDGGSFVLNRGGKLAVQLPVFDAA 238

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
             +T  H D Q +   +++ D    + +P  + E DY A V +LRDY++K  F KV++GL
Sbjct: 239 --IT--HVDFQETDQGWVTLDGPKAL-LP-DDLEQDYRAMVEALRDYLRKTGFGKVLLGL 292

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSA+ AAIAVDALG + V+ +MLP +YTS  SL+DAAA A+ALGC+YD + I    
Sbjct: 293 SGGIDSAIVAAIAVDALGADQVRCVMLPSEYTSQASLDDAAAAARALGCRYDTVSIAGPR 352

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
                 ++    + P+ +  ENIQSRIRG +LMA SN    MLLTT NKSE++VGY T+Y
Sbjct: 353 AAVTEALAPLFGDMPADLTEENIQSRIRGLLLMAQSNKFGEMLLTTGNKSEVAVGYATIY 412

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GG+NP+KD+YKT+VF +  WRN+H      GP  +VIPP+I++K PSAELRP Q D
Sbjct: 413 GDMAGGYNPIKDMYKTRVFDICRWRNAHHRDWMQGPAGQVIPPAIIDKPPSAELRPDQRD 472

Query: 480 QESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
            +SLPPY +LD I+  +V+ + S  +     Y+  TV+ +EHL+Y SEYKR QA  G ++
Sbjct: 473 DDSLPPYDVLDGILAMLVDGDASVADCVAAGYDRATVKKIEHLVYISEYKRFQAAPGVRL 532

Query: 539 TAKSFGRDRLYPISNKFRD 557
           + ++F  DR YPI N++RD
Sbjct: 533 SDRAFWLDRRYPIVNRWRD 551


>gi|326561328|gb|EGE11686.1| NAD+ synthetase [Moraxella catarrhalis 7169]
          Length = 563

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 229/553 (41%), Positives = 319/553 (57%), Gaps = 19/553 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           ++  AI Q N  VGDIAGN+ K      +A  +G D+++F EL + GYPPEDL+ + +  
Sbjct: 25  QMTFAIIQTNFWVGDIAGNVKKMHALTLDAKARGADIVIFPELALVGYPPEDLLLRPTLG 84

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +    A+  L       G  +++G+P  D  G  NS  IL  G+      K  LPNY  F
Sbjct: 85  ERVREAMAKLAEIE---GIVVILGYPHIDHHGTFNSAAILQDGSQKGFYHKQCLPNYGIF 141

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F  G +     ++ + +G+LICEDIW +  I   LK+ GA+ +  +NASP+   K
Sbjct: 142 DEQRYFQKGLNQVLFDYKGVTIGLLICEDIWHDEPIYM-LKQAGADLVIVINASPFEIGK 200

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
              R  ++T   S  HLPIIYVN VG QD+++FDG S       ++A +   F  Q  M 
Sbjct: 201 QTARKSLLTRHSSTHHLPIIYVNTVGAQDDIVFDGGSLITQSDGRVAHEGVRFLNQLLMA 260

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
              +D Q   +     D+ +   + L EE   Y A V+ LRDYV ++ F  VI+GLSGGI
Sbjct: 261 --RFDIQNKTF-----DTQAKAPLVLSEESEMYQALVVGLRDYVNRSGFKGVIVGLSGGI 313

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IAVDALG + V  +M+PY+YT+  SLEDA A A  L   Y V PIHD V    
Sbjct: 314 DSALTLCIAVDALGSDRVYAVMMPYEYTAQISLEDAEAQAARLNVSYTVCPIHDAVAGLR 373

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++  L      +  EN+Q+R RG ILMALSN    M+++T NKSE +VGY TLYGDM 
Sbjct: 374 SALAPLLANSEPDVTEENLQARARGTILMALSNKFGHMVISTGNKSENAVGYSTLYGDMV 433

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+YKT V++LA++RN             VIP  ++ + PSAELRP+Q DQ+SL
Sbjct: 434 GGFDVLKDVYKTDVYRLANYRNRL-------EDNPVIPERVITRPPSAELRPNQKDQDSL 486

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
             Y  LD I+K  ++++  +       +  +TV  +  ++  +EYKRRQ  +GTKIT KS
Sbjct: 487 GDYETLDSILKMYIDDDLGYKAIVAAGFEPKTVEKILGMVDRAEYKRRQGAIGTKITKKS 546

Query: 543 FGRDRLYPISNKF 555
           FGR+R YP+ N +
Sbjct: 547 FGRERRYPLVNGW 559


>gi|198282730|ref|YP_002219051.1| NAD+ synthetase [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667784|ref|YP_002424924.1| glutamine-dependent NAD+ synthetase [Acidithiobacillus ferrooxidans
           ATCC 23270]
 gi|198247251|gb|ACH82844.1| NAD+ synthetase [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519997|gb|ACK80583.1| glutamine-dependent NAD+ synthetase [Acidithiobacillus ferrooxidans
           ATCC 23270]
          Length = 549

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 237/553 (42%), Positives = 327/553 (59%), Gaps = 20/553 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IA+AQ+N  VGD+AGN  +   A  EA   G DL+L  EL +SGYPPEDL+ +  F+Q
Sbjct: 1   MRIALAQVNCRVGDVAGNADRLLAAAAEAQAAGADLLLTPELALSGYPPEDLLLRSDFLQ 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
            C +A+  L +        ++VG PR+ QE + NS  +L  G   A   K  LPNY+ F 
Sbjct: 61  DCDAAMQRLAAAAP---LPMLVGHPRRVQEQLYNSAGLLRGGRAEAFYHKHCLPNYAVFD 117

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E R F  G  +       IR G+ ICED+W    + +  + QGAE L  LNASPY+ NK 
Sbjct: 118 EVRYFTPGAQSLVFTCAGIRCGVAICEDVWCGPGVAQAAQAQGAELLLVLNASPYHLNKQ 177

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           + R + V    +  HLPI+YVN VGGQDEL+FDG SF  D    LA +    +E   + +
Sbjct: 178 RVREDEVGALAARCHLPIVYVNLVGGQDELVFDGQSFAADRNGLLALRAARCAEALVLLD 237

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGLSGGI 303
              D    +        A     P+ +E A+ Y+   L + DYV+KN F   ++GLSGG+
Sbjct: 238 VDRDDAGIRLQ------ADRPLQPVPDESAEVYDVLRLGVHDYVEKNGFPGAVLGLSGGV 291

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL  A+AVDALG E V  +++P +YT+  S+ DA A A++LG + D++ I  L + + 
Sbjct: 292 DSALTLAVAVDALGAERVHALIMPSRYTAEMSIADAVAEARSLGVRTDIVSIEGLFHSYL 351

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
             ++       +    EN+Q+RIR  +LMA SN    +LLTT NKSEI+VGY TLYGDM+
Sbjct: 352 ETLAPLFAGRAADTTEENLQARIRAALLMAYSNKFGHLLLTTGNKSEIAVGYATLYGDMA 411

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF  +KD  KT V++LA +RNS      LGP   VIP  +L + PSAEL P Q DQ+SL
Sbjct: 412 GGFAVIKDCPKTLVYRLARYRNS------LGP---VIPERVLTRPPSAELAPDQRDQDSL 462

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           PPY +LD II   VE + S ++     +  ETV  V  L+  +EYKRRQA  G +I+A++
Sbjct: 463 PPYEVLDAIIAAYVEEDHSAVDLIAAGFPAETVMRVLRLIDRAEYKRRQAAPGVRISARA 522

Query: 543 FGRDRLYPISNKF 555
           FG+DR YPI+N +
Sbjct: 523 FGKDRRYPITNGY 535


>gi|289209199|ref|YP_003461265.1| NAD+ synthetase [Thioalkalivibrio sp. K90mix]
 gi|288944830|gb|ADC72529.1| NAD+ synthetase [Thioalkalivibrio sp. K90mix]
          Length = 564

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 226/569 (39%), Positives = 335/569 (58%), Gaps = 30/569 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L +A+AQ+NP+VG +  N      A E+A   G   ++F EL ++GYPPEDL+ + +F++
Sbjct: 7   LPLALAQINPIVGGLDTNRHLIEDAIEQARAAGARAVVFPELALTGYPPEDLLLRPAFLR 66

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           A   ++  +       G  +++G P   ++G++N+ + L  G  IA   K  LPNYS F 
Sbjct: 67  AVEQSLAAITRSV--AGIDVILGAPVPTEKGLVNAALWLRDGREIARYAKQVLPNYSVFD 124

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E+R F++G     +     R+G+ +CEDIW+ +          AE + +LNASPY+  K 
Sbjct: 125 EQRYFVAGDQACVVELAGWRIGLTVCEDIWQAAPAAAAQAAG-AELILNLNASPYHRGKA 183

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           ++R ++V  +++    P++YVNQVGGQDEL+FDG SF  D        +  ++    + +
Sbjct: 184 EERLQVVGARVAETGCPVVYVNQVGGQDELVFDGRSFVHDAAHGARAVLPAWATGYALVQ 243

Query: 245 WHYD------QQLSQWNYMSDDS-ASTMYIPLQE-EEAD----YNACVLSLRDYVQKNNF 292
                     Q   +  ++S      T+  P  E +EAD    Y A ++ +RDYV KN F
Sbjct: 244 GRRGPSGIELQPRPETMHLSACGIRPTLTDPGPEPDEADARDLYQALMIGIRDYVAKNGF 303

Query: 293 HKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDV 352
             V++GLSGGIDS L AA+AVDALG   V  +M+PY+YT+  S+EDA A A+ LG +Y  
Sbjct: 304 PGVLLGLSGGIDSGLTAALAVDALGPAAVTAVMMPYRYTASMSIEDAEAQARLLGIEYHE 363

Query: 353 LPIHDLVNHFFSLMSQFLQEEPS---GIVAENIQSRIRGNILMALSNHSKAMLLTTSNKS 409
           + I  +V  F   +S      P+    +  EN+QSR RG +LMALSN S  +LL T NKS
Sbjct: 364 IAIEPMVQDFLEGLSPAFDAMPAHAGDVTEENLQSRARGVLLMALSNRSGKLLLATGNKS 423

Query: 410 EISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSP 469
           E++VGY TLYGDM+GGF PLKD+ K  V++LA WRN+ G           IP  ++E+ P
Sbjct: 424 EMAVGYSTLYGDMNGGFAPLKDVSKQWVYRLARWRNTRGAA---------IPERVIERPP 474

Query: 470 SAELRPHQTDQESLPPYPILDDIIKRIVENEESF--INNDQEYNDETVRYVEHLLYGSEY 527
           SAEL P Q D +SLPPY +LD +++  VE E S   I  D  ++  TV  +  L++ +EY
Sbjct: 475 SAELAPDQKDADSLPPYEVLDAVLEAFVEQERSVEEIVADG-FDHATVERIARLVFRAEY 533

Query: 528 KRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           KRRQAP G +++ ++FGRDR YPI++ +R
Sbjct: 534 KRRQAPPGVRVSRRAFGRDRRYPITSGYR 562


>gi|296112564|ref|YP_003626502.1| NAD+ synthetase [Moraxella catarrhalis RH4]
 gi|295920258|gb|ADG60609.1| NAD+ synthetase [Moraxella catarrhalis RH4]
 gi|326571668|gb|EGE21683.1| NAD+ synthetase [Moraxella catarrhalis BC7]
          Length = 563

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 229/553 (41%), Positives = 319/553 (57%), Gaps = 19/553 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           ++  AI Q N  VGDIAGN+ K      +A  +G D+++F EL + GYPPEDL+ + +  
Sbjct: 25  QMTFAIIQTNFWVGDIAGNVKKMHALTLDAKARGADIVIFPELALVGYPPEDLLLRPTLG 84

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +    A+  L       G  +++G+P  D  G  NS  IL  G+      K  LPNY  F
Sbjct: 85  ERVREAMAKLAEIE---GIVVILGYPHIDHHGTFNSAAILQDGSQKGFYHKQCLPNYGIF 141

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F  G +     ++ + +G+LICEDIW +  I   LK+ GA+ +  +NASP+   K
Sbjct: 142 DEQRYFQKGLNQVLFDYKGVTIGLLICEDIWHDEPIYM-LKQAGADLVIVINASPFEIGK 200

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
              R  ++T   S  HLPIIYVN VG QD+++FDG S       ++A +   F  Q  M 
Sbjct: 201 QTARKSLLTRHSSTHHLPIIYVNTVGAQDDIVFDGGSLITQSDGRVAHEGVRFLNQLLMA 260

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
              +D Q   +     D+ +   + L EE   Y A V+ LRDYV ++ F  VI+GLSGGI
Sbjct: 261 --RFDTQNKTF-----DTQAKAPLVLSEESEMYQALVVGLRDYVNRSGFKGVIVGLSGGI 313

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IAVDALG + V  +M+PY+YT+  SLEDA A A  L   Y V PIHD V    
Sbjct: 314 DSALTLCIAVDALGCDRVYAVMMPYEYTAQISLEDAEAQAARLNVSYTVCPIHDAVAGLR 373

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++  L      +  EN+Q+R RG ILMALSN    M+++T NKSE +VGY TLYGDM 
Sbjct: 374 SALAPLLANSEPDVTEENLQARARGTILMALSNKFGHMVISTGNKSENAVGYSTLYGDMV 433

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+YKT V++LA++RN             VIP  ++ + PSAELRP+Q DQ+SL
Sbjct: 434 GGFDVLKDVYKTDVYRLANYRNRL-------EDNPVIPERVITRPPSAELRPNQKDQDSL 486

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
             Y  LD I+K  ++++  +       +  +TV  +  ++  +EYKRRQ  +GTKIT KS
Sbjct: 487 GDYETLDSILKMYIDDDLGYKAIVAAGFEPKTVEKILGMVDRAEYKRRQGAIGTKITKKS 546

Query: 543 FGRDRLYPISNKF 555
           FGR+R YP+ N +
Sbjct: 547 FGRERRYPLVNGW 559


>gi|326577687|gb|EGE27563.1| NAD+ synthetase [Moraxella catarrhalis O35E]
          Length = 563

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 229/553 (41%), Positives = 320/553 (57%), Gaps = 19/553 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           ++  AI Q N  VGDIAGN+ K      +A  +G D+++F EL + GYPPEDL+ + +  
Sbjct: 25  QMTFAIIQTNFWVGDIAGNVKKMHALTLDAKARGADIVIFPELALVGYPPEDLLLRPTLG 84

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +    A+  L       G  +++G+P  D  G  NS  IL  G+      K  LPNY  F
Sbjct: 85  ERVREAMAKLAEIE---GIVVILGYPHIDHHGTFNSAAILQDGSQKGFYHKQCLPNYGIF 141

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F  G +     ++ + +G+LICEDIW +  I + LK+ GA+ +  +NASP+   K
Sbjct: 142 DEQRYFQKGLNQVLFDYKGVTIGLLICEDIWHDEPI-QALKQAGADLVIVINASPFEIGK 200

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
              R  ++T   S  HLPIIYVN VG QD+++FDG S       ++A +   F  Q  M 
Sbjct: 201 QTARKSLLTRHSSTHHLPIIYVNTVGAQDDIVFDGGSLITQSDGRVAHEGVRFLNQLLMA 260

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
              +D Q   +     D+ +   + L EE   Y A V+ LRDYV ++ F  VI+GLSGGI
Sbjct: 261 --RFDIQNKTF-----DTQAKAPLVLSEESEMYQALVVGLRDYVNRSGFKGVIVGLSGGI 313

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IAVDALG + V  +M+PY+YT+  SLEDA A A  L   Y V PIHD V    
Sbjct: 314 DSALTLCIAVDALGCDRVYAVMMPYEYTAQISLEDAEAQAARLNVSYTVCPIHDAVAGLR 373

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++  L      +  EN+Q+R RG ILMALSN    M+++T NKSE +VGY TLYGDM 
Sbjct: 374 SALAPLLANSEPDVTEENLQARARGTILMALSNKFGHMVISTGNKSENAVGYSTLYGDMV 433

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+YKT V++LA++RN             VIP  ++ + PSAELRP+Q DQ+SL
Sbjct: 434 GGFDVLKDVYKTDVYRLANYRNRL-------EDNPVIPERVITRPPSAELRPNQKDQDSL 486

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
             Y  LD I+K  ++++  +       +  +TV  +  ++  +EYKRRQ  +GTKIT KS
Sbjct: 487 GDYETLDSILKMYIDDDLGYKAIVAAGFEPKTVEKILGMVDRAEYKRRQGAIGTKITKKS 546

Query: 543 FGRDRLYPISNKF 555
           FGR+R YP+ N +
Sbjct: 547 FGRERRYPLVNGW 559


>gi|332528122|ref|ZP_08404153.1| NH(3)-dependent NAD(+) synthetase [Rubrivivax benzoatilyticus JA2]
 gi|332112693|gb|EGJ12486.1| NH(3)-dependent NAD(+) synthetase [Rubrivivax benzoatilyticus JA2]
          Length = 552

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 236/572 (41%), Positives = 337/572 (58%), Gaps = 41/572 (7%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+A+AQ N VVGD+AGN  +   A   A  QG  L+L  EL ++GYPPEDL+ + +F+Q
Sbjct: 1   MKVALAQFNAVVGDLAGNSRRLEDAARRAYAQGARLVLAPELALTGYPPEDLLLRPAFMQ 60

Query: 65  ACSSAIDTLKSDTHDG-GAGIVVGFPRQ-DQEGVL-----------NSVVILDAGNIIAV 111
           AC+ A+  L     D  G  +VVG P Q  + G L           N+  +L  G + A 
Sbjct: 61  ACADALAALADVLRDCEGLHLVVGHPHQFGERGDLRTKSVTVQQRYNAASLLAGGRVQAT 120

Query: 112 RDKINLPNYSEFHEKRTFISGYSND--PIVF--RDIRLGILICEDIWKNSNICKHLKKQG 167
             K  LPNY  F E+R F SG      P+VF    +R G++ICED W +    +  +  G
Sbjct: 121 YCKRELPNYQVFDERRYFASGRDAGLPPLVFDCEGLRFGVVICEDAWFDEP-ARLARDAG 179

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
           A+ L  LNASP++  K ++R   +  +   V LP+++ + VGGQDE++FDGASF  D   
Sbjct: 180 AQVLCVLNASPFHLGKAEERQARMAERARDVGLPLLFSHLVGGQDEVVFDGASFALDAAG 239

Query: 228 QLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYV 287
           ++  +   F+E+  + ++  D +                 P  + +A ++A V  +RDY+
Sbjct: 240 EVRARAATFAEELLVVDFDADAR---------PVGPVAEAPDLDRQA-WDALVTGVRDYL 289

Query: 288 QKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALG 347
            KN F   IIGLSGGIDSAL  A+AVDALG + V+ +M+P  YT+  S  DA   A  LG
Sbjct: 290 GKNGFPGAIIGLSGGIDSALVLAVAVDALGADKVRAVMMPSPYTADISWIDARDMAARLG 349

Query: 348 CKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSN 407
            +YD + I  + + F + ++            EN+Q+RIRG +LMALSN + A++LTT N
Sbjct: 350 VRYDEIDIAPMFDAFRTALAPQFAGLAEDTTEENLQARIRGTLLMALSNKTGAIVLTTGN 409

Query: 408 KSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEK 467
           KSE++ GY TLYGDM+GGF  +KD+ KT V++LA+WRN+ G         EVIP  I+ +
Sbjct: 410 KSEMATGYCTLYGDMAGGFAVIKDVAKTLVYRLANWRNAQG--------AEVIPQRIITR 461

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKRIVENEES---FINNDQEYNDETVRYVEHLLYG 524
            PSAELRP QTDQ+SLPPY +LD I+ R +E+++S    +    E  D  V  V  L+  
Sbjct: 462 PPSAELRPDQTDQDSLPPYEVLDAILARYMEDDQSVEQIVAAGFERAD--VERVTRLIKI 519

Query: 525 SEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           +EYKRRQAPVG +IT ++FGRD  YPI+++FR
Sbjct: 520 NEYKRRQAPVGIRITHRAFGRDWRYPITSRFR 551


>gi|326569726|gb|EGE19776.1| NAD+ synthetase [Moraxella catarrhalis BC8]
          Length = 563

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 229/553 (41%), Positives = 320/553 (57%), Gaps = 19/553 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           ++  AI Q N  VGDIAGN+ K      +A  +G D+++F EL + GYPPEDL+ + +  
Sbjct: 25  QMTFAIIQTNFWVGDIAGNVKKMHALTLDAKARGADIVIFPELALVGYPPEDLLLRPTLG 84

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +    A+  L       G  +++G+P  D  G  NS  IL  G+      K  LPNY  F
Sbjct: 85  ERVREAMAKLAEIE---GIVVILGYPHIDHHGTFNSAAILQDGSQKGFYHKQCLPNYGIF 141

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F  G +     ++ + +G+LICEDIW +  I + LK+ GA+ +  +NASP+   K
Sbjct: 142 DEQRYFQKGLNQVLFDYKGVTIGLLICEDIWHDEPI-QALKQAGADLVIVINASPFEIGK 200

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
              R  ++T   S  HLPIIYVN VG QD+++FDG S       ++A +   F  Q  M 
Sbjct: 201 QTARKSLLTRHSSTHHLPIIYVNTVGAQDDIVFDGGSLITQSDGRVAHEGVRFLNQLLMA 260

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
              +D Q   +     D+ +   + L EE   Y A V+ LRDYV ++ F  VI+GLSGGI
Sbjct: 261 --RFDIQNKTF-----DTQAKAPLVLSEESEMYQALVVGLRDYVNRSGFKGVIVGLSGGI 313

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IAVDALG + V  +M+PY+YT+  SLEDA A A  L   Y V PIHD V    
Sbjct: 314 DSALTLCIAVDALGCDRVYAVMMPYEYTAQISLEDAEAQAARLNVSYTVCPIHDAVAGLR 373

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++  L      +  EN+Q+R RG ILMALSN    M+++T NKSE +VGY TLYGDM 
Sbjct: 374 SALAPLLANSEPDVTEENLQARARGTILMALSNKFGHMVISTGNKSENAVGYSTLYGDMV 433

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+YKT V++LA++RN             VIP  ++ + PSAELRP+Q DQ+SL
Sbjct: 434 GGFDVLKDVYKTDVYRLANYRNRL-------EDNPVIPERVITRPPSAELRPNQKDQDSL 486

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
             Y  LD I+K  ++++  +       +  +TV  +  ++  +EYKRRQ  +GTKIT KS
Sbjct: 487 GDYDTLDSILKMYIDDDLGYKAIVAAGFEPKTVEKILGMVDRAEYKRRQGAIGTKITKKS 546

Query: 543 FGRDRLYPISNKF 555
           FGR+R YP+ N +
Sbjct: 547 FGRERRYPLVNGW 559


>gi|149377768|ref|ZP_01895501.1| NAD synthase [Marinobacter algicola DG893]
 gi|149357940|gb|EDM46429.1| NAD synthase [Marinobacter algicola DG893]
          Length = 550

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 231/561 (41%), Positives = 337/561 (60%), Gaps = 33/561 (5%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSF 62
           KL++ +AQL+ +VGDI GN  K   A   A ++   DL++F EL ++GYPPEDL+ + S 
Sbjct: 12  KLRVVMAQLDFLVGDIPGNTQKVIEATRRAEQEHQADLVVFPELCLTGYPPEDLLLRPSM 71

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
               + A++TL+ + H G A I+VG P ++   + N+ V ++ GNI     K   PNY  
Sbjct: 72  DVRVADALETLRGE-HLGPA-IIVGAPIREGALLYNAAVAIEQGNITGRYFKRFPPNYQV 129

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F +G     +  + + +GI ICEDIW    + +     GA  + +LNASPY  +
Sbjct: 130 FDEKRYFANGVDTLVMDIKGVPVGITICEDIWSEGPV-EDAAAAGARLVVNLNASPYDID 188

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K  +R  +V  +     + I+YVN +GGQDEL+FDG S  +D    LA +   FSE  + 
Sbjct: 189 KQVRRKALVERKAFENRVSIVYVNLIGGQDELVFDGGSVVYDHSGVLAAEAPQFSEGLYP 248

Query: 243 TEW---HYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
            ++   H+ Q + Q           +  P  EE   Y A VL +RDYV KN F  V++GL
Sbjct: 249 VDFVCEHHCQPIPQ---------PAIAEPSLEENV-YKALVLGVRDYVNKNGFKSVVLGL 298

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSA+  AIA DALG + V+ +M+P++YTS  S+EDA A A ALG +YDV  I  + 
Sbjct: 299 SGGIDSAVTLAIAADALGADRVRAVMMPFRYTSGMSIEDAEAEAVALGVQYDVFSIEPMY 358

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           + F   ++   +        EN+Q+R+RG +LM+LSN   +++LTT NKSE++VGY TLY
Sbjct: 359 DAFMETLAAPFEGTKPDTTEENLQARLRGVLLMSLSNKFGSLVLTTGNKSEMAVGYSTLY 418

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGF+ LKD+ KT VF+LA +RNS         +++VIP  ++ + PSAEL P Q D
Sbjct: 419 GDMAGGFDVLKDVPKTLVFRLAWYRNS---------VSQVIPERVITRPPSAELAPDQKD 469

Query: 480 QESLPPYPILDDIIKRIVENEESFINND----QEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           ++SLP Y +LD I+   VE +   ++ D    Q ++   V  V  L+  +EYKRRQAP+G
Sbjct: 470 EDSLPGYDVLDQILNLYVERD---LSADAIVAQGFDRADVDRVVRLVDINEYKRRQAPIG 526

Query: 536 TKITAKSFGRDRLYPISNKFR 556
            +IT + FG+DR YPI+N ++
Sbjct: 527 VRITERGFGKDRRYPITNGWK 547


>gi|254441088|ref|ZP_05054581.1| NAD synthase family [Octadecabacter antarcticus 307]
 gi|198251166|gb|EDY75481.1| NAD synthase family [Octadecabacter antarcticus 307]
          Length = 556

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 229/562 (40%), Positives = 338/562 (60%), Gaps = 13/562 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGDI GN  KAR A E+    G D+++  E+F+ GY P+DL+ K 
Sbjct: 1   MSDRFRLTMAQLNPTVGDITGNAEKARFAWEQGRAAGADMVMLPEMFLVGYQPQDLIMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F +  ++ ++ L +D  DG   + +G P ++ + + N+  +L  G +I+   K  LPN+
Sbjct: 61  AFEREVAAELERLAADCADGPM-LGIGGPFREGDKLHNAYFVLKNGRVISTTRKYFLPNF 119

Query: 121 SEFHEKRTFISGYSNDPIVFRD----IRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           + F E R F       P    +    +R+G  ICED W   ++C+ + + GAE L   N 
Sbjct: 120 NVFDEVRLFSRADMQGPFNTGEDAGPLRIGTPICEDAWY-PDVCEAMVESGAELLLVPNG 178

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY+ +K   R   +  ++    +P++Y+N VGGQD+ +FDG SF  +    LA QM  F
Sbjct: 179 SPYFRDKFSVRLNNMVARVIENDVPLVYLNMVGGQDDQVFDGGSFVLNRHGALAVQMPWF 238

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            +       H D   +   ++++D     ++     E DY A VL LRDY+ K  F KV+
Sbjct: 239 EDAIA----HVDFVRTDAGWVAEDGDK--HLEPSAFETDYAAMVLGLRDYMDKTGFKKVL 292

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGG+DSA+ AAIA DALG +NV+ +M+P +YTS  SL+DA A A ALG +YD++PI 
Sbjct: 293 LGLSGGVDSAIVAAIAADALGPDNVRCVMMPSEYTSDASLDDAKAAAAALGVRYDIVPIG 352

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            +       ++    +   G+  ENIQSRIRG +LMA SN    MLLTT NKSE++VGY 
Sbjct: 353 AVRAAVTETLAPLFADLDEGLTEENIQSRIRGLLLMAQSNKFGEMLLTTGNKSEVAVGYA 412

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           T+YGDMSGG+NP+KDLYKT+VF +  WRN +          E+IP +I++K PSAELR  
Sbjct: 413 TIYGDMSGGYNPIKDLYKTRVFDICRWRNVNHRPWMKASAGEMIPVAIIDKPPSAELRDD 472

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q D +SLP Y +LD I+  +V+++ S  +     Y    V+ +EHLL+ SEYKR Q+  G
Sbjct: 473 QKDSDSLPEYDVLDGILTMLVDDDASVADCVAVGYGRTVVKKIEHLLFISEYKRFQSAPG 532

Query: 536 TKITAKSFGRDRLYPISNKFRD 557
            +++ K+F  DR YPI N++RD
Sbjct: 533 PRLSMKAFWLDRRYPIVNRWRD 554


>gi|254284409|ref|ZP_04959377.1| NAD+ synthetase [gamma proteobacterium NOR51-B]
 gi|219680612|gb|EED36961.1| NAD+ synthetase [gamma proteobacterium NOR51-B]
          Length = 537

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 229/558 (41%), Positives = 329/558 (58%), Gaps = 27/558 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMD---LILFTELFISGYPPEDLVFKKS 61
           +K+ +AQ+N +VGD  GN  +      EA    +D   +++F EL + GYPPEDL+ + S
Sbjct: 1   MKLCMAQINTMVGDYRGNTEQVLATCAEA--VAIDPEAIVVFPELTLCGYPPEDLLLRPS 58

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
                +  ++ L  +       +++GFPR  +  + N+  +++ G IIA  DK  LPNY+
Sbjct: 59  VEDHVNECLERLCRELP-ASLWVILGFPRHREGRLFNTAAVINRGAIIAEYDKQRLPNYA 117

Query: 122 EFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
            F E R F +G  NDP V     + +G+ ICEDIW         ++ GA  L +LN+SPY
Sbjct: 118 VFDEVRYFSAG--NDPCVVEVAGMPVGLSICEDIWSPVP-AASARQAGARLLVNLNSSPY 174

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           +  K  +R  ++  +    H PI+YVNQVGGQDEL+FDG SF  D   ++      F   
Sbjct: 175 HRGKRDQRWSLLADRARENHFPIVYVNQVGGQDELVFDGGSFAVDAAGEVVCAAPDFDAG 234

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
            +  E  Y         ++ D+ +T   PLQE EA + A VL LRDYV KN F  V++GL
Sbjct: 235 LWWLELGYQDATVA---ITPDTVAT---PLQEIEAVWRALVLGLRDYVDKNGFPGVVLGL 288

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSA+  A+AVDALG + V  +M+P++YT+  S+EDA A A  LG  Y  + I  + 
Sbjct: 289 SGGIDSAVTLALAVDALGADRVHAVMMPFRYTASISIEDAEAEALTLGVDYRSISIEPIY 348

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F + +S+        I  EN+Q+R RG +LM++SN    ++LTT NKSE++VGY TLY
Sbjct: 349 EAFMASLSEEFAGLLPNITEENLQARCRGVLLMSISNKKNLLVLTTGNKSELAVGYSTLY 408

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGF+ LKD  K  V+ LA +RNS      +GP   VIP  ++ + PSAEL P Q D
Sbjct: 409 GDMAGGFDVLKDCPKMLVYALARFRNS------VGP---VIPERVITRPPSAELAPDQKD 459

Query: 480 QESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           ++SLP Y +LD II+  VE + + I    + + +  VR V  L+  +EYKRRQAPVG +I
Sbjct: 460 EDSLPAYEVLDQIIELYVEQDLTAIEIISRGFEEPDVRRVIRLVDLNEYKRRQAPVGVRI 519

Query: 539 TAKSFGRDRLYPISNKFR 556
           + ++FGRDR YPI+  +R
Sbjct: 520 SQRAFGRDRRYPITWAWR 537


>gi|307728981|ref|YP_003906205.1| NAD+ synthetase [Burkholderia sp. CCGE1003]
 gi|307583516|gb|ADN56914.1| NAD+ synthetase [Burkholderia sp. CCGE1003]
          Length = 579

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 230/584 (39%), Positives = 335/584 (57%), Gaps = 35/584 (5%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           K +IA+AQ+N  VGD AGN+AK   A  +A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQINVTVGDFAGNVAKIVAAARDAHNAGAKLLVAPELALSGYPPEDLLLRPAFY 61

Query: 64  QACSSAIDTLKSDTHD-GGAGIVVGFPRQD----------------QEGV-----LNSVV 101
            A ++A+  L +      G  ++VG P +D                + GV      N+  
Sbjct: 62  TASAAALRDLAAQLEPFAGLHVIVGHPLRDSANGANQGHGNANAPIERGVPPVDTFNAAS 121

Query: 102 ILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNI 159
           +L  G I+    K +LPN   F EKR F S     P VF    ++ G++ICED W +++ 
Sbjct: 122 LLVDGRIVGTYRKQDLPNTEVFDEKRYFAS--DPQPFVFELDGVKYGVVICEDAW-HASA 178

Query: 160 CKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGA 219
            +  K  GA+ L   N SP++ NK   R +I+  +I    LP++YVN VG QDEL+FDG 
Sbjct: 179 AQMAKAAGAQVLLIPNGSPFHLNKEAVRFDILRARIRETGLPMVYVNMVGAQDELVFDGG 238

Query: 220 SFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQE---EEADY 276
           SF  D   +L  +M  F E     E+     +      ++ S+   +    E   E   Y
Sbjct: 239 SFVLDAHGELVAKMPQFEETTAFVEFENGAPVRNQTSTANGSSGADHAIAPELTLEAQVY 298

Query: 277 NACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSL 336
            A V+ +RDYV KN F   +IGLSGG+DSAL  A+A DALG + V+ +M+P +YT+  S 
Sbjct: 299 AALVMGVRDYVNKNGFPGALIGLSGGVDSALVLAVACDALGADRVRAVMMPSRYTADIST 358

Query: 337 EDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSN 396
            DAA  A+ +G +YD + I  + + F + ++Q     P     ENIQ+RIRG +LMALSN
Sbjct: 359 TDAADMARRVGVRYDEIAIAPMFDAFRNSLAQEFAGRPEDATEENIQARIRGTLLMALSN 418

Query: 397 HSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPL 456
              +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN           
Sbjct: 419 KFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCHYRNQASTFE----R 474

Query: 457 TEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETV 515
             VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E + S        Y  E V
Sbjct: 475 QNVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRSLAEIIAAGYAAEDV 534

Query: 516 RYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           + V  L+  +EYKRRQAP+G ++T ++FGRD  YPI++++ + +
Sbjct: 535 KRVTRLIKINEYKRRQAPIGIRVTHRAFGRDWRYPITSRYTEPV 578


>gi|83749198|ref|ZP_00946200.1| Glutamine-dependent NAD(+) synthetase [Ralstonia solanacearum
           UW551]
 gi|207742674|ref|YP_002259066.1| nh3-dependent nad+ synthetase protein [Ralstonia solanacearum
           IPO1609]
 gi|83724139|gb|EAP71315.1| Glutamine-dependent NAD(+) synthetase [Ralstonia solanacearum
           UW551]
 gi|206594068|emb|CAQ60995.1| nh3-dependent nad+ synthetase protein [Ralstonia solanacearum
           IPO1609]
          Length = 546

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 226/564 (40%), Positives = 330/564 (58%), Gaps = 35/564 (6%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           +A+AQ+N  VGD+AGN A+   A  EA++ G  +++  EL ++GYPPEDL+ + +F+ A 
Sbjct: 5   VALAQINCTVGDLAGNAARILAAAREAHQAGARILVTPELSLTGYPPEDLLLRPAFLGAT 64

Query: 67  SSAIDTLKSDTHD-GGAGIVVGFPRQDQEGV---------LNSVVILDAGNIIAVRDKIN 116
           S A+D L ++     G  +++G P+   E            N+  +   G  +    K+ 
Sbjct: 65  SRALDALVAELAAFPGLHVLIGHPQLSFEAPAPGSALPKPTNTATVAVDGRTLGQYHKLE 124

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSL 174
           LPN   F EKR F +G   +P VF     R G++ICED W         K  GAE +   
Sbjct: 125 LPNNEVFDEKRYFQAGC--EPFVFEVEGTRFGVIICEDAWY-PQATAWAKTAGAEVVLIP 181

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           NASPY+ +K   R +I+  +     LP +YVN VGGQDEL+FDG SF  D   +   +M 
Sbjct: 182 NASPYHLDKEDLREQIIGARAKESGLPHVYVNLVGGQDELVFDGGSFALDAHGKPVARMA 241

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHK 294
            F+E   +    +D    Q   ++ ++     +        Y A  L +RDY+ KN F  
Sbjct: 242 QFAEG--VGYVRFDGARPQPGEIAQEATLEAQV--------YEALKLGVRDYIGKNGFPG 291

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
            IIGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA   A  LG +YD +P
Sbjct: 292 AIIGLSGGVDSALVLAIAVDALGADRVRAVMMPSRYTADISWVDARDMAVRLGVRYDEIP 351

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I  + + F   ++   +  P     ENIQ+RIRG +LMALSN S  ++LTT NKSE++VG
Sbjct: 352 IMPMFDAFRGALADEFRNLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSEMAVG 411

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
           Y TLYGDM+GGF  +KD++KT V++L  +RN+         L+EVIP  IL ++PSAELR
Sbjct: 412 YCTLYGDMAGGFAVIKDIFKTLVYRLCRYRNA---------LSEVIPERILTRAPSAELR 462

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAP 533
            +QTDQ+SLP Y  LD I++R +E  +  ++     + +  V+ +  LL  +EYKRRQAP
Sbjct: 463 ENQTDQDSLPEYAALDAIVQRYMEQNQPVVDIIAAGFAEADVQKIVRLLKINEYKRRQAP 522

Query: 534 VGTKITAKSFGRDRLYPISNKFRD 557
           VG ++T ++FGRD  YPI+++F++
Sbjct: 523 VGIRVTQRAFGRDWRYPITSRFKE 546


>gi|207723618|ref|YP_002254016.1| nh3-dependent nad+ synthetase protein [Ralstonia solanacearum
           MolK2]
 gi|206588821|emb|CAQ35783.1| nh3-dependent nad+ synthetase protein [Ralstonia solanacearum
           MolK2]
          Length = 546

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 226/564 (40%), Positives = 330/564 (58%), Gaps = 35/564 (6%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           +A+AQ+N  VGD+AGN A+   A  EA++ G  +++  EL ++GYPPEDL+ + +F+ A 
Sbjct: 5   VALAQINCTVGDLAGNAARILAAAREAHQAGARILVTPELSLTGYPPEDLLLRPAFLGAT 64

Query: 67  SSAIDTLKSDTHD-GGAGIVVGFPRQDQEGV---------LNSVVILDAGNIIAVRDKIN 116
           S A+D L ++     G  +++G P+   E            N+  +   G  +    K+ 
Sbjct: 65  SRALDALVAELAAFPGLHVLIGHPQLSFEAPAPGSALPKPTNTATVAVDGRTLGQYHKLE 124

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSL 174
           LPN   F EKR F +G   +P VF     R G++ICED W         K  GAE +   
Sbjct: 125 LPNNEVFDEKRYFQAGC--EPFVFEVEGTRFGVIICEDAWY-PQATAWAKTAGAEVVLIP 181

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           NASPY+ +K   R +I+  ++    LP +YVN VGGQDEL+FDG SF  D   +   +M 
Sbjct: 182 NASPYHLDKEDLREQIIGARVKESGLPHVYVNLVGGQDELVFDGGSFVLDAHGKPVARMA 241

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHK 294
            F+E   +    +D    Q   ++ ++     +        Y A  L +RDY+ KN F  
Sbjct: 242 QFAEG--VGYVRFDGARPQPGEIAQEATLEAQV--------YEALKLGVRDYIGKNGFPG 291

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
            IIGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA   A  LG +YD +P
Sbjct: 292 AIIGLSGGVDSALVLAIAVDALGADRVRAVMMPSRYTADISWVDARDMAVRLGVRYDEIP 351

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I  + + F   ++   +  P     ENIQ+RIRG +LMALSN S  ++LTT NKSE++VG
Sbjct: 352 IMPMFDAFRGALADEFRNLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSEMAVG 411

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
           Y TLYGDM+GGF  +KD++KT V++L  +RN+         L+EVIP  IL ++PSAELR
Sbjct: 412 YCTLYGDMAGGFAVIKDIFKTLVYRLCRYRNA---------LSEVIPERILTRAPSAELR 462

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAP 533
            +QTDQ+SLP Y  LD I++R +E  +   +     + +  V+ +  LL  +EYKRRQAP
Sbjct: 463 ENQTDQDSLPEYAALDAIVQRYMEQNQPVADIIAAGFAEADVQKIVRLLKINEYKRRQAP 522

Query: 534 VGTKITAKSFGRDRLYPISNKFRD 557
           VG ++T ++FGRD  YPI+++F++
Sbjct: 523 VGIRVTQRAFGRDWRYPITSRFKE 546


>gi|330825694|ref|YP_004388997.1| NAD+ synthetase [Alicycliphilus denitrificans K601]
 gi|329311066|gb|AEB85481.1| NAD+ synthetase [Alicycliphilus denitrificans K601]
          Length = 552

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 239/564 (42%), Positives = 331/564 (58%), Gaps = 27/564 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L I+IAQLN VVGD+ GN  K   A  ++   G  L+L  EL I GY  EDL  + +F+ 
Sbjct: 3   LAISIAQLNFVVGDLQGNAQKIIDAARQSYAAGARLLLTPELAICGYAAEDLFLRPAFLA 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFPRQDQ------EGVLNSVVILDAGNIIAVRDKINL 117
           AC  A+  +   T D  G  IV+G PR            LN+  +L AG +     K  L
Sbjct: 63  ACDEAVQAVARGTADLAGLAIVLGHPRAAAPGAPAFSSCLNAASVLRAGRVEQTYAKREL 122

Query: 118 PNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLN 175
           PNY  F E+R F++G  + P VF    +R+G+LICED W  S   +     GA+ L  +N
Sbjct: 123 PNYQVFDERRYFVAG--DAPCVFEVEGVRVGLLICEDAW-FSAPARDAAAAGAQLLAVIN 179

Query: 176 ASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKH 235
           ASP++  K  +R + +  +++   LP++Y + VGGQDE++F+G SF  +    +A +   
Sbjct: 180 ASPFHLGKGAEREQTMRERVAETGLPLVYAHLVGGQDEVVFEGRSFALNADGTVAMRAPA 239

Query: 236 FSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHK 294
           F E+    + H  Q   +   M  D A     P +  EAD ++A VL +RDYV KN F  
Sbjct: 240 FEEKLVFAQVHQAQAGIE---MEADVA-----PERSLEADLWDALVLGVRDYVGKNGFPG 291

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
            ++GLSGGIDSAL  AIAVDALG + V+T+M+P  YT+  S  DA   A  LG +YD + 
Sbjct: 292 ALLGLSGGIDSALVLAIAVDALGADKVRTVMMPSPYTADISWIDARDMAARLGVRYDEIA 351

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I      F + ++   +        EN+Q+RIRG +LMALSN   A++LTT NKSE++ G
Sbjct: 352 IAPQFEAFKAALAPLFEGRAEDTTEENLQARIRGTLLMALSNKFGAVVLTTGNKSEMATG 411

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG-ITSGLGPLTEVIPPSILEKSPSAEL 473
           Y TLYGDM+GGF  +KD+ KT+VF LA WRN++    +G  P    IP  I+ + PSAEL
Sbjct: 412 YCTLYGDMAGGFAVIKDVVKTRVFDLARWRNANDPYGTGANP----IPERIIIRPPSAEL 467

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQA 532
           RP Q DQ+SLPPY +LD I+ R +EN+E   +  +  Y+   V  V  L+  +EYKRRQA
Sbjct: 468 RPDQKDQDSLPPYEVLDAILARYMENDEPVEDIVRAGYDRADVERVTRLIKINEYKRRQA 527

Query: 533 PVGTKITAKSFGRDRLYPISNKFR 556
           PVG ++T +SFG+D  YPI+NKFR
Sbjct: 528 PVGVRVTRRSFGKDWRYPITNKFR 551


>gi|237748647|ref|ZP_04579127.1| NAD+ synthase [Oxalobacter formigenes OXCC13]
 gi|229380009|gb|EEO30100.1| NAD+ synthase [Oxalobacter formigenes OXCC13]
          Length = 537

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 232/558 (41%), Positives = 327/558 (58%), Gaps = 30/558 (5%)

Query: 6   KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQA 65
           K+AIAQ+N  VGD++GN  +      +A   G D++L  EL ++GYPPEDL+ + SF  +
Sbjct: 4   KVAIAQINSTVGDLSGNRERIAEFVRKAAALGADIVLTPELSLTGYPPEDLLLQHSFHSS 63

Query: 66  CSSAIDTLKSDTHD-GGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
               +D LK++  D     ++VG          N+  IL  G II    K  LPNY+ F 
Sbjct: 64  TQLELDRLKNELADLDNVFVLVGHHLIKGGLCYNACSILVNGTIIGTYFKQELPNYTVFD 123

Query: 125 EKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           EKR F  G  N+P+VF+   +  GI ICED+W      K  +  GA+ +  +N+SPY+  
Sbjct: 124 EKRYFAPG--NEPLVFKVKGVCFGIGICEDVWFPLPPQKA-RAAGADVMLVMNSSPYHMG 180

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K+ +R  IV   +    +  IY N VGGQDEL+FDG SF  +   ++  Q+K   E    
Sbjct: 181 KMHQRPVIVRQNVIGQGMSAIYANLVGGQDELVFDGCSFAMNTDGKVCVQLKQCEE---- 236

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
                D ++  ++     +      P  E E  Y A VL +RDYV KN F  VIIGLSGG
Sbjct: 237 -----DLEIVSFDNKQPVNGRMEEHPTVESEV-YRALVLGVRDYVTKNGFPGVIIGLSGG 290

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           +DSAL  AIAVDALG E V+ +M+P  YTS  S  DA+  A  L   YD +PI D  + F
Sbjct: 291 VDSALVLAIAVDALGPEKVRAVMMPSPYTSDISQIDASDMAGRLKVAYDEIPISDCFSSF 350

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            S ++    + P     EN+Q+RIRG +LMALSN   +++LTT NKSE++VGY TLYGDM
Sbjct: 351 LSTLAPQFNKLPEDSTEENLQARIRGTLLMALSNKFGSIVLTTGNKSEMAVGYCTLYGDM 410

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF  +KD+YKT V++L  +RNS         +++VIP  +L ++P+AEL+P+Q DQ++
Sbjct: 411 AGGFAVIKDIYKTLVYRLCHYRNS---------ISDVIPERMLTRAPTAELKPNQFDQDT 461

Query: 483 LPPYPILDDIIKRIVENEES---FINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           LPPY +LD I++  +E   S    + N   YN   V  +  L+  +EYKRRQAP+G +IT
Sbjct: 462 LPPYEVLDTIVRMFMEENRSVGEIVKNG--YNTTVVERIVRLMRINEYKRRQAPIGIRIT 519

Query: 540 AKSFGRDRLYPISNKFRD 557
            + FGRD   PI++K+RD
Sbjct: 520 PRGFGRDWRCPITSKYRD 537


>gi|300703412|ref|YP_003745014.1| nh3-dependent nad+ synthetase (nade) [Ralstonia solanacearum
           CFBP2957]
 gi|299071075|emb|CBJ42384.1| putative nh3-dependent nad+ synthetase (nadE) [Ralstonia
           solanacearum CFBP2957]
          Length = 546

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 225/564 (39%), Positives = 330/564 (58%), Gaps = 35/564 (6%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           +A+AQ+N  VGD+AGN+ +   A  EA++ G  +++  EL ++GYPPEDL+ + +F+ A 
Sbjct: 5   VALAQINCTVGDLAGNVVRIVAAAREAHQAGARILVTPELSLTGYPPEDLLLRPAFLNAT 64

Query: 67  SSAIDTLKSDTHD-GGAGIVVGFPRQDQEGV---------LNSVVILDAGNIIAVRDKIN 116
           S A+D L  +     G  +++G P+   E            N+  +   G ++    K+ 
Sbjct: 65  SRALDALVVELAAFPGLHVLIGHPQLSFEAPAPGSALPKPTNTATVAVDGRMLGQYHKLE 124

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFSL 174
           LPN   F EKR F +G   +P VF     R G++ICED W         K  GAE +   
Sbjct: 125 LPNNEVFDEKRYFQAGC--EPFVFEVEGTRFGVIICEDAWY-PQATAWAKTAGAEVVLIP 181

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           NASPY+ +K   R +I+  ++    LP +YVN VGGQDEL+FDG SF  D   +   +M 
Sbjct: 182 NASPYHLDKEDLREQIIGARVKESGLPHVYVNLVGGQDELVFDGGSFVLDAHGKPVARMA 241

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHK 294
            F+E   +    +D    Q   ++ ++     +        Y A  L +RDY+ KN F  
Sbjct: 242 QFAEG--VGYVRFDGARPQPGEIAQEATLEAQV--------YEALKLGVRDYIGKNGFPG 291

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
            IIGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA   A  LG +YD +P
Sbjct: 292 AIIGLSGGVDSALVLAIAVDALGADRVRAVMMPSRYTADISWVDARDMAVRLGVRYDEIP 351

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I  + + F   ++   +  P     ENIQ+RIRG +LMALSN S  ++LTT NKSE++VG
Sbjct: 352 IMPMFDAFRGALADEFRNLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSEMAVG 411

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
           Y TLYGDM+GGF  +KD++KT V++L  +RN+         L+EVIP  IL ++PSAELR
Sbjct: 412 YCTLYGDMAGGFAVIKDIFKTLVYRLCRYRNA---------LSEVIPERILTRAPSAELR 462

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAP 533
            +QTDQ+SLP Y  LD I++R +E  +   +     + +  V+ +  LL  +EYKRRQAP
Sbjct: 463 ENQTDQDSLPEYAALDAIVQRYMEQNQPVADIIAAGFAEADVQKIVRLLKINEYKRRQAP 522

Query: 534 VGTKITAKSFGRDRLYPISNKFRD 557
           VG ++T ++FGRD  YPI+++F++
Sbjct: 523 VGIRVTQRAFGRDWRYPITSRFKE 546


>gi|89900489|ref|YP_522960.1| NAD+ synthetase [Rhodoferax ferrireducens T118]
 gi|89345226|gb|ABD69429.1| NAD+ synthetase [Rhodoferax ferrireducens T118]
          Length = 561

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 238/573 (41%), Positives = 334/573 (58%), Gaps = 36/573 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           LK+ +AQL+ VVGD+AGN  K   +   A   G+ L+L  EL I GY  EDL  + +FI 
Sbjct: 3   LKLCVAQLDFVVGDMAGNAKKIIESARSAYADGVRLLLTPELSICGYAAEDLFLRAAFIA 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFP-----RQDQEGVL---NSVVILDAGNIIAVRDKI 115
           AC  A+ T+  +        +VVG P     R     V    N+  +L  G +IA   K 
Sbjct: 63  ACDDAVKTVARELAGLKDMSVVVGHPTGGDSRTRSVAVSRRHNAASVLREGAVIATYAKR 122

Query: 116 NLPNYSEFHEKRTFISGYSNDPIVF---------RDIRLGILICEDIWKNSNICKHLKKQ 166
            LPNY  F E+R F  G+  D  VF         + I++G+LICED W  +   +  +  
Sbjct: 123 ELPNYQVFDERRYFTPGH--DVCVFEAGEADKMGQKIKVGLLICEDAWFEAP-ARQTQAA 179

Query: 167 GAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQ 226
           GAE L  +NASP++  K  +R +++  ++    LP++Y + VGGQDE++F+G SF  +  
Sbjct: 180 GAELLVVINASPFHVGKGDEREQMMRERVRACGLPLVYAHLVGGQDEVVFEGRSFALNAN 239

Query: 227 QQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRD 285
            ++A +   F +   + +     +  +  Y++ D A     P +  +AD ++A VL +RD
Sbjct: 240 GEVAARAPSFIQNELVIQV---SRAYEAIYLAADIA-----PERSLDADLWDALVLGVRD 291

Query: 286 YVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKA 345
           Y+ KN F  V++GLSGGIDSAL  A+AVDALGK+ V+TIM+P  YT+  S  DA   A  
Sbjct: 292 YIGKNGFPSVLLGLSGGIDSALVLAVAVDALGKDRVRTIMMPSPYTADISWIDARDMAAR 351

Query: 346 LGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTT 405
           LG +YD + I      F   ++   Q        ENIQ+RIRG +LMALSN   +++LTT
Sbjct: 352 LGVRYDEISIVPEFEAFKKSLAGEFQGLAEDTTEENIQARIRGTLLMALSNKFGSIVLTT 411

Query: 406 SNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG-ITSGLGPLTEVIPPSI 464
            NKSE++ GY TLYGDM+GGF  +KDL KT VF+LA WRN H    +G  P    IP  I
Sbjct: 412 GNKSEMATGYCTLYGDMAGGFAVIKDLAKTTVFRLARWRNEHDPYGTGQAP----IPERI 467

Query: 465 LEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLY 523
           + + PSAELRP+QTDQ+SLP Y +LD I++R +EN++S        +    V  V  L+ 
Sbjct: 468 ITRPPSAELRPNQTDQDSLPAYEVLDAILERYMENDQSIEEIIAAGFARLDVEKVTRLIK 527

Query: 524 GSEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
            +EYKRRQAPVG ++T +SFG+D  YPISNKFR
Sbjct: 528 INEYKRRQAPVGIRVTHRSFGKDWRYPISNKFR 560


>gi|254450479|ref|ZP_05063916.1| glutamine-dependent NAD(+) synthetase [Octadecabacter antarcticus
           238]
 gi|198264885|gb|EDY89155.1| glutamine-dependent NAD(+) synthetase [Octadecabacter antarcticus
           238]
          Length = 561

 Score =  402 bits (1032), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 231/562 (41%), Positives = 337/562 (59%), Gaps = 13/562 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGDIAGN  KAR A E+    G D+++  E+F+ GY  +DL+ K 
Sbjct: 6   MSDRFRLTMAQLNPTVGDIAGNAEKARVAWEQGRAAGADMVMLPEMFLVGYQTQDLIMKP 65

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F +  ++ +  L +   DG   + +G P ++ + + N+  +L AG II+   K  LPN+
Sbjct: 66  AFERDAAAQLAQLAAACADGPM-LGIGGPLREGDKLRNAYFVLKAGKIISTTRKFFLPNF 124

Query: 121 SEFHEKRTFISGYSNDPIVFR----DIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           + F E R F       P         +R+G  ICED W   ++C+ + + GAE L   N 
Sbjct: 125 NVFDEVRLFSRADMQGPFSTGGDAGSLRIGTPICEDAWY-PDVCEAMVESGAEMLLVPNG 183

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY+ +K   R   +  +++   +P++Y+N VGGQD+ +FDG SF  +    LA QM  F
Sbjct: 184 SPYFRDKFSVRLNQMVARVTECDVPLVYLNMVGGQDDQVFDGGSFVLNRHGALAVQMPWF 243

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E       H D   +   ++++D      +     E DY A V++LRDY+ K  F KV+
Sbjct: 244 EEAVA----HVDFVRTDAGWVAEDGDKN--LEPDTMETDYAAMVMALRDYMAKTGFKKVL 297

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGG+DSA+ AAIA DALG +NV+ +M+P +YTS  SL+DA A A ALG +YDV+ I 
Sbjct: 298 LGLSGGVDSAIVAAIAADALGPDNVRCVMMPSEYTSDASLDDAKAAAAALGVRYDVVAIG 357

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
                    ++        G+  ENIQSRIRG +LMA SN    MLLTT NKSE++VGY 
Sbjct: 358 ATRAAVTQTLAPLFAGLDDGLTEENIQSRIRGLLLMAQSNKFGEMLLTTGNKSEVAVGYA 417

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           T+YGDM+GG+NP+KDLYKT+VF +  WRN++       P  E+IP +I++K PSAELR  
Sbjct: 418 TIYGDMAGGYNPIKDLYKTRVFDICRWRNANHRPWMNAPAGEMIPVAIIDKPPSAELRDD 477

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q D +SLP Y +LD I+  +V+++ S  +     Y+   V+ +EHLLY SEYKR Q+  G
Sbjct: 478 QKDSDSLPEYDVLDGILTLLVDDDASVADCVAAGYDRAVVKKIEHLLYISEYKRFQSAPG 537

Query: 536 TKITAKSFGRDRLYPISNKFRD 557
            +++ K+F  DR YPI N++RD
Sbjct: 538 PRLSMKAFWLDRRYPIVNRWRD 559


>gi|330966002|gb|EGH66262.1| glutamine-dependent NAD+ synthase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 535

 Score =  402 bits (1032), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 232/554 (41%), Positives = 330/554 (59%), Gaps = 28/554 (5%)

Query: 9   IAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSFIQACS 67
           +AQLN  VGD+ GN+ K  +A + A    G  +I+F EL + GYPPEDL+ + S      
Sbjct: 1   MAQLNIRVGDVHGNVEKIIKAAQTARDDLGAHVIVFPELTLCGYPPEDLLLRSSMQSRIE 60

Query: 68  SAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKR 127
            A+  ++      G  IV+GFP  +     NS  ++  G  +A   K  LPNY  F EKR
Sbjct: 61  KALARVREAAR--GIVIVIGFPWVEDGARYNSCAVISEGEEVARYYKQRLPNYRVFDEKR 118

Query: 128 TFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKR 187
            F SG     +    I++GI ICEDIW +  + K     GA+ + +LNASP++  K  +R
Sbjct: 119 YFESGSGPCVVNLFGIQVGITICEDIWFSEPL-KQACDAGAQIMLTLNASPFHRGKQAER 177

Query: 188 HEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHY 247
             ++  +     +P++YVNQVGGQDEL+FDG SF  DG  ++  +   F E  ++T++  
Sbjct: 178 EALLAQRADECSIPMMYVNQVGGQDELVFDGNSFVVDGNGKVTQRAPAFEEGLYVTDFD- 236

Query: 248 DQQLSQWNYMSDDS----ASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
                     +D+S      T+   L  E + Y A V  ++DYV +N F  V++GLSGGI
Sbjct: 237 ---------CTDNSLVPVPGTVTELLSLEASVYQALVSGVKDYVHRNGFKGVVLGLSGGI 287

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL  A+A DALG ENV+ +M+PY YT+  S +DA   A  LG KY VLPI  +V  F 
Sbjct: 288 DSALVLAVAADALGAENVEAVMMPYHYTAQMSQDDAREEADILGVKYSVLPIASMVEAFL 347

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++   +        EN+Q+R RG +LMA+SN  + ++LTT NKSE++VGY TLYGDM+
Sbjct: 348 STLAPMFEGLGKDTTEENLQARCRGTMLMAISNKKRYLVLTTGNKSEMAVGYATLYGDMA 407

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+ KT VF+L  +RN+         L  VIP  ++++ PSAEL P Q D++SL
Sbjct: 408 GGFDVLKDVPKTLVFKLCEYRNT---------LDYVIPQRVIDRPPSAELAPDQKDEDSL 458

Query: 484 PPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           PPYP+LD+I++  VE + S     +E ++ E VR V  L+  +EYKRRQA VG +IT + 
Sbjct: 459 PPYPVLDEILRLYVEQDLSADAIIEEGFDTEVVRKVIRLVDLNEYKRRQAAVGPRITERG 518

Query: 543 FGRDRLYPISNKFR 556
           FGRDR YPI++ +R
Sbjct: 519 FGRDRRYPITSGWR 532


>gi|260221021|emb|CBA29170.1| Probable glutamine-dependent NAD(+) synthetase [Curvibacter
           putative symbiont of Hydra magnipapillata]
          Length = 562

 Score =  402 bits (1032), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 233/569 (40%), Positives = 322/569 (56%), Gaps = 31/569 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           LK+ +AQLN +VGD+ GN+ K   A   A  QG+ L+L  EL I GY  EDL  + +FIQ
Sbjct: 7   LKLCVAQLNFIVGDLNGNVKKIVDAATHAYDQGVRLVLTPELSICGYAAEDLFLRPAFIQ 66

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFPRQDQ--------EGVLNSVVILDAGNIIAVRDKI 115
           AC  A+ ++        G  +VVG P            +   N+  +L  G ++A   K 
Sbjct: 67  ACDDAVKSVARQLAGLKGLSVVVGHPTGGDSRTRSVAIQSRFNAASVLREGQVVAHYAKR 126

Query: 116 NLPNYSEFHEKRTFISGYSNDPIVFRD------IRLGILICEDIWKNSNICKHLKKQGAE 169
            LPNY  F E+R F  G      VF        +++G+LICED W      +  K+ GAE
Sbjct: 127 ELPNYQVFDERRYFSPG--QGVCVFEAGEGASAVKVGLLICEDAWFEEP-ARLAKEAGAE 183

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            L  +NASP++  K  +R   +  +     LP++Y + VGGQDE++F+G SF  D Q  +
Sbjct: 184 LLAVINASPFHVGKGYEREARMGERCRATGLPLVYAHLVGGQDEVVFEGHSFTLDAQGAV 243

Query: 230 AFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQ 288
             +   F E  F+ +    Q+  +   + +        P +  EAD ++A VL +RDYV 
Sbjct: 244 TGRAPSFKENLFVAQVARAQEAIKLVAVVE--------PERSAEADLWDALVLGVRDYVG 295

Query: 289 KNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGC 348
           KN F   ++GLSGGIDSAL   +AVDALG + V+ IM+P  YT+  S  DA   A  +G 
Sbjct: 296 KNGFPGALLGLSGGIDSALVLTVAVDALGADKVRAIMMPSPYTADISWIDARDMAARMGV 355

Query: 349 KYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNK 408
           +YD + I      F + ++            ENIQ+RIRG +LMALSN   +++LTT NK
Sbjct: 356 RYDEISIVPEFEAFKASLAGEFAGRAEDTTEENIQARIRGTLLMALSNKFGSIVLTTGNK 415

Query: 409 SEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKS 468
           SE++ GY TLYGDM+GGF  +KDL KT VF+LA WRN+H      G     IP  I+ + 
Sbjct: 416 SEMATGYCTLYGDMAGGFAVIKDLAKTTVFKLAWWRNAH---DPYGTCASPIPERIITRP 472

Query: 469 PSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEY 527
           PSAELRP Q DQ+SLPPY +LD I++R +EN+ES        Y  E V  V  L+  +EY
Sbjct: 473 PSAELRPDQKDQDSLPPYEVLDGILERYMENDESMETIIAAGYRTEDVERVTRLIKINEY 532

Query: 528 KRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           KRRQAPVG ++T +SFG+D  YPI+N+FR
Sbjct: 533 KRRQAPVGIRVTHRSFGKDWRYPITNRFR 561


>gi|110833335|ref|YP_692194.1| NAD+ synthase [Alcanivorax borkumensis SK2]
 gi|110646446|emb|CAL15922.1| NAD+ synthase (glutamine-hydrolysing) [Alcanivorax borkumensis SK2]
          Length = 541

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 236/563 (41%), Positives = 321/563 (57%), Gaps = 36/563 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSFI 63
           ++I +AQ N +VGDI GN  +   A +EA R  G DL+LF EL ++GYPPEDL+ + S  
Sbjct: 1   MRIIMAQQNALVGDIEGNAQRVIAASDEARRLLGADLVLFPELMLTGYPPEDLLLRPSL- 59

Query: 64  QACSSAIDTLKSDTHDGGAGI----VVGFPRQDQEGVLNSVVILDAGNIIAVRD--KINL 117
              +S +D   +D    GA I    V+G+P        N+  ++  G      +  K +L
Sbjct: 60  ---NSRVDAALADI---GAAISVPVVLGYPAVRNGHRRNAAGVMFPGETGPRHEYFKQHL 113

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           PNY  F EKR F  G            LGI ICEDIW ++     L+K G + + +LNAS
Sbjct: 114 PNYRVFDEKRYFQPGKDACTFDIDGWTLGITICEDIW-HAGPAAQLQKAGTDLILNLNAS 172

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY  NK  +R + V  +     LP++Y N VGGQDEL+FDGASF  D Q     Q   F+
Sbjct: 173 PYRINKADERFDQVQARCRETGLPVLYCNLVGGQDELVFDGASFVCDSQGNRCVQAASFT 232

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVI 296
           E     +        Q  +          +PL   +A  Y A VL+ RDYV KN F   +
Sbjct: 233 EALVPVDVQ-----CQGGHCEPRGE---VLPLPGPQAGMYQALVLATRDYVNKNGFKGAL 284

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL  A+AVDALG E V+ +M+P++YTS  SLEDA   A+ L   Y VLPI 
Sbjct: 285 LGLSGGIDSALTLAVAVDALGPERVEAVMMPFQYTSAMSLEDAEKQARTLRVHYRVLPIE 344

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
              N F  ++ +           EN+Q+R RG +LMALSN + +++LTT NKSE++VGY 
Sbjct: 345 AAFNGFMDILREPFAGTSRDTTEENLQARCRGVLLMALSNKNGSVVLTTGNKSEMAVGYA 404

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGF+ LKD++KT VF L  WRN            E+IP  ++ + PSAEL P 
Sbjct: 405 TLYGDMAGGFSVLKDVFKTSVFNLCRWRNQQAG-------AEIIPDRVITRPPSAELAPD 457

Query: 477 QTDQESLPPYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAP 533
           Q D +SLP Y  LD I++R VE +   E+ I +   ++ ETV  V  L   +EYKRRQA 
Sbjct: 458 QVDSDSLPDYDELDAILERYVEQDMSAEAVIRDG--FDRETVYRVVKLTDRNEYKRRQAA 515

Query: 534 VGTKITAKSFGRDRLYPISNKFR 556
           VG +++ ++FG+DR YPI+N +R
Sbjct: 516 VGPRVSRRAFGKDRRYPITNGWR 538


>gi|262375848|ref|ZP_06069080.1| glutamine-dependent NAD+ synthetase [Acinetobacter lwoffii SH145]
 gi|262309451|gb|EEY90582.1| glutamine-dependent NAD+ synthetase [Acinetobacter lwoffii SH145]
          Length = 541

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 228/560 (40%), Positives = 331/560 (59%), Gaps = 27/560 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  KIAIAQ +P VG++  N  K      +A +   DLI+F EL   GYP EDL+ + S
Sbjct: 1   MKSFKIAIAQFSPHVGNLDANTQKMIDLANQAKKDKADLIIFPELSTLGYPAEDLLIRPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
            ++   +A + L   T      +V GF  Q ++G   NS  ++  G ++ V +K  LPNY
Sbjct: 61  LVKRTKAAFEKL---TEVKDIVMVFGFVNQTEDGQRYNSAAVMKDGEVLGVYNKQVLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICED+W  + + + L K   +    LNASPY 
Sbjct: 118 GVFDEKRYFGEGHQHLVFEYLGHKFGVLICEDVWSLATV-QQLAKLNIDTALVLNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R E +   +  +++ ++Y NQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRIETMAALVKQLNINLVYCNQVGGQDDLIFDGTSFVLNKSGEVALQAPTFQENL 236

Query: 241 FMTEWHYDQ-QLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
            + E++ +Q Q S+           +   L      Y + V++ RDYVQ++ F  VI+GL
Sbjct: 237 TIAEFNAEQLQFSK---------GAIAPALDTMAEIYQSLVMATRDYVQRSGFPGVILGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDALG + VQ +M+PY YT+  S+EDAAA AK +G  + +  I+ +V
Sbjct: 288 SGGIDSALTLAIAVDALGADKVQAVMMPYTYTAQISVEDAAAQAKNMGVTFGIAEINPVV 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           + F  ++  F    P     EN+Q+R RG +LMALSN    ++L T NKSE++VGY TLY
Sbjct: 348 SGFMQVLFPFFGNAPVDATEENLQARSRGTLLMALSNKFGNLVLATGNKSELAVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GG+  LKD+YKT VF+LA +RNS  I+      T VIP  ++ + PSAELRP Q D
Sbjct: 408 GDMVGGYAVLKDVYKTIVFELAKYRNS--ISE-----TPVIPERVITRPPSAELRPDQVD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           Q+SLP Y ILD I+   +E + S   +D   + ++ E V+ V  L+  +EYKRRQ  +G 
Sbjct: 461 QDSLPAYDILDAILYSYIEEDMS--QDDIITKGFDAEVVKKVIRLVDINEYKRRQGAIGP 518

Query: 537 KITAKSFGRDRLYPISNKFR 556
           +I+++S+GR+R YPI N ++
Sbjct: 519 RISSRSYGRERRYPIVNGWK 538


>gi|254429711|ref|ZP_05043418.1| NAD synthase family [Alcanivorax sp. DG881]
 gi|196195880|gb|EDX90839.1| NAD synthase family [Alcanivorax sp. DG881]
          Length = 537

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 236/558 (42%), Positives = 318/558 (56%), Gaps = 34/558 (6%)

Query: 9   IAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSFIQACS 67
           +AQ N +VGDI GN  +   A +EA R  G DL+LF EL ++GYPPEDL+ + S     +
Sbjct: 1   MAQQNALVGDIEGNAQRVIAAADEARRLLGADLVLFPELMLTGYPPEDLLLRPSL----N 56

Query: 68  SAIDTLKSDTHDGGAGI----VVGFPRQDQEGVLNSVVILDAGNIIAVRD--KINLPNYS 121
           S +D   +D    GA I    V+G+P        N+  ++  G      +  K +LPNY 
Sbjct: 57  SRVDAALADI---GAAISVPVVLGYPAVRNGHRRNAAGVVFPGESGPRHEYFKQHLPNYR 113

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F EKR F  G            LGI ICEDIW +      L++ GA+ + +LNASPY  
Sbjct: 114 VFDEKRYFQPGTDICTFDIEGWTLGITICEDIWHDGP-AAQLQQAGADLVLNLNASPYRA 172

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
           NK  +R   V  +     LP++Y N VGGQDEL+FDGASF  D Q     Q   F+E   
Sbjct: 173 NKADERFAQVQARSRETGLPVLYCNLVGGQDELVFDGASFVCDSQGNRCVQAASFTEALV 232

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
             +      L       +     + +P   EE  Y A VL+ RDYV KN F   ++GLSG
Sbjct: 233 PVD------LQCQGGHCEPRGEELPLP-GPEEGMYQALVLATRDYVNKNGFKGALLGLSG 285

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSAL  A+AVDALG E V+ +M+P++YTS  SLEDA   A+ L   Y VLPI    N 
Sbjct: 286 GIDSALTLAVAVDALGPERVEAVMMPFQYTSAMSLEDAEKQARTLRVHYRVLPIEAAFNG 345

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F  ++S+           EN+Q+R RG +LMALSN + +++LTT NKSE++VGY TLYGD
Sbjct: 346 FMDILSESFSGTARDTTEENLQARCRGVLLMALSNKNGSVVLTTGNKSEMAVGYATLYGD 405

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGF+ LKD++KT VF L  WRN            E+IP  ++ + PSAEL P Q D +
Sbjct: 406 MAGGFSVLKDVFKTSVFNLCRWRNQQAG-------AEIIPDRVITRPPSAELAPDQVDSD 458

Query: 482 SLPPYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           SLP Y  LD I++R VE +   E+ I +   ++ ETV  V  L   +EYKRRQA VG ++
Sbjct: 459 SLPDYDELDAILERYVEQDMSAEAVIRDG--FDRETVYRVVKLTDRNEYKRRQAAVGPRV 516

Query: 539 TAKSFGRDRLYPISNKFR 556
           + ++FG+DR YPI+N +R
Sbjct: 517 SRRAFGKDRRYPITNGWR 534


>gi|119505580|ref|ZP_01627651.1| NAD synthase [marine gamma proteobacterium HTCC2080]
 gi|119458523|gb|EAW39627.1| NAD synthase [marine gamma proteobacterium HTCC2080]
          Length = 536

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 222/552 (40%), Positives = 323/552 (58%), Gaps = 18/552 (3%)

Query: 9   IAQLNPVVGDIAGNIAKARRAREEANRQGMD-LILFTELFISGYPPEDLVFKKSFIQACS 67
           + Q+N  VGD  GN  +   A   A+ + +D +++F EL ++GYPPEDL+ + S  Q   
Sbjct: 1   MGQINTFVGDWQGNCERVLAACRSAHAKFIDAVVVFPELTLTGYPPEDLLLRPSLEQETD 60

Query: 68  SAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKR 127
           + +  L ++       ++VG+PR+  +G+ NS  ++  G I+A  DK +LPNY  F EKR
Sbjct: 61  AVLAQLCAELPPT-LWVIVGYPRRRTDGLYNSAGVIHDGKIVAEYDKQSLPNYQVFDEKR 119

Query: 128 TFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKR 187
            F  G     +    +++GI ICEDIW+   I    +  GA+ L +LNASP++  K  +R
Sbjct: 120 YFQEGTGACVVDISGVKVGITICEDIWEPEPIAGA-RAAGAQLLINLNASPFHRGKPLQR 178

Query: 188 HEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHY 247
             +V  +     LP++YVNQVGGQDEL+FDG SF  +    +A     F E      W  
Sbjct: 179 QAMVAERARANDLPVVYVNQVGGQDELVFDGGSFAVNRDGAVAVSAVDFDEA---LSWLK 235

Query: 248 DQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSAL 307
            +  S  +    + A        +  A + A VL ++DYV KN F  V++GLSGGIDSA+
Sbjct: 236 VEASSLGDVKIGEGAKAE--ARDDVAAVWQALVLGVKDYVNKNGFPGVVLGLSGGIDSAV 293

Query: 308 CAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMS 367
             A+AVDALG E V  +M+P++YT+  S+EDA A A A+G  Y  + I  L   F   ++
Sbjct: 294 TLAVAVDALGAERVNAVMMPFRYTASISIEDAQAQAAAMGVAYRSISIEPLYESFNGALA 353

Query: 368 QFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFN 427
           +  +     I  EN+Q+R RG +LM++SN    ++LTT NKSE++VGY TLYGDM+GGF+
Sbjct: 354 EEFEGLAPNITEENMQARCRGVLLMSISNKKNLLVLTTGNKSELAVGYSTLYGDMAGGFD 413

Query: 428 PLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYP 487
            LKD  K  V+ LA +RN+         L+  IP  ++ + PSAEL P Q D++SLPPY 
Sbjct: 414 ALKDCPKMLVYALARYRNT---------LSSCIPERVITRPPSAELAPDQKDEDSLPPYE 464

Query: 488 ILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRD 546
           +LD II+  VE + S  +   Q + ++ VR V  L+  +EYKRRQAPVG +IT + FGRD
Sbjct: 465 VLDAIIEHYVEQDLSASDIIAQGFAEDDVRRVLRLIDLNEYKRRQAPVGVRITQRGFGRD 524

Query: 547 RLYPISNKFRDH 558
           R YPI+  +R  
Sbjct: 525 RRYPITWAWRSR 536


>gi|154249452|ref|YP_001410277.1| NAD+ synthetase [Fervidobacterium nodosum Rt17-B1]
 gi|154153388|gb|ABS60620.1| NAD+ synthetase [Fervidobacterium nodosum Rt17-B1]
          Length = 583

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 233/594 (39%), Positives = 343/594 (57%), Gaps = 44/594 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + K+++A+AQ+N  VGDI GN  K      +A    +D+++F EL I+GYPPEDL+FK  
Sbjct: 1   MNKVRLALAQINATVGDIEGNKNKIIEYINKALENDVDIVIFPELSITGYPPEDLLFKSH 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
           F++    AI+ +          +VVGF   D+EG + N+  +++ G + A   K  LPNY
Sbjct: 61  FVRKNKEAIEEIARHVPKSLV-VVVGF--VDEEGDIFNAAAVINDGKVQAKYRKNYLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG-AEFLFSLNASPY 179
             F E R F  G     ++  D+R+GI ICEDIW      +     G A+ + +L+ASPY
Sbjct: 118 GVFDEMRYFQKGTKALVVLLEDVRVGITICEDIWYPGGPARLESLLGDAQLIVNLSASPY 177

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           Y  K+  R  +++ + +     + YVN VGGQDELIFDGAS   + + ++  + K F E 
Sbjct: 178 YVEKIAWRERMLSVRANDNIATVAYVNCVGGQDELIFDGASLVVNEKGEIIGRAKQFEED 237

Query: 240 NFMTEWHY---------DQQLSQWNYMSDDSASTMYI---PLQEEEAD------------ 275
             + +            D +  Q   + D+    + I   P + +               
Sbjct: 238 LLIVDVDLIDIDKTCVKDPRRRQDKQIMDEERKNLEIVKLPFESKPKRTKITNRVEKTLP 297

Query: 276 -----YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKY 330
                YNA VL+ RDY++KN   K +IGLSGG+DS L A IAVDALG ENV  + +P  +
Sbjct: 298 KVAEVYNALVLATRDYIRKNGMKKAVIGLSGGMDSTLVACIAVDALGAENVVGVSMPGPF 357

Query: 331 TSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNI 390
           +S  S EDA   A+ LG K+  +PI +  N F ++     ++ P  I  EN+Q+RIRG I
Sbjct: 358 SSEHSKEDAKILAENLGIKFLTIPIMEAYNSFLNMFKPVFEDRPFDITEENLQARIRGVI 417

Query: 391 LMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRN-SHGI 449
           LMALSN    ++LTT NKSEIS GY TLYGD +GG+  +KD+YKT V++LA + N  +G 
Sbjct: 418 LMALSNKFGWIVLTTGNKSEISTGYSTLYGDTAGGYAVIKDVYKTFVYELAEYVNQKYG- 476

Query: 450 TSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQ 508
                   E+IP  + EK+PSAELR +QTDQ+ LPPY ILD+I+K  VE + S  +  ++
Sbjct: 477 -------REIIPRRVFEKAPSAELRENQTDQDKLPPYEILDEILKLYVEEDYSVSDIVER 529

Query: 509 EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHISEE 562
            +++ETV+ V  ++  +EYKRRQ P G KIT ++FG+DR  PI+N F++ + ++
Sbjct: 530 GFDEETVKKVAWMVDINEYKRRQMPPGPKITHRAFGKDRRLPITNAFKEWLEKK 583


>gi|206890265|ref|YP_002248293.1| NAD+ synthetase [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206742203|gb|ACI21260.1| NAD+ synthetase [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 571

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 221/585 (37%), Positives = 339/585 (57%), Gaps = 47/585 (8%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +KK+++A+ Q+NP+VGDI GN +K    +E+A ++  D+I+F EL ++GY PEDL+F  S
Sbjct: 1   MKKIRLALCQINPIVGDIEGNFSKILSFKEKAVKEKADIIVFPELILTGYTPEDLLFYPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+  + A++ L  +  D    +++G P + +E + NS VIL    +I    KI LPNYS
Sbjct: 61  FIKKANEALNKLIENVKD--FVMILGLPVK-EEDLYNSAVILAEQKVIDTYHKIYLPNYS 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F SG       +  +  G+ ICEDI+  +         GAE + +++ASP+Y 
Sbjct: 118 VFDEMRYFKSGKRASVYEYSGVLFGVNICEDIFHPTLPSPIQASSGAELIINISASPFYA 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K +K+  +++ +   + + I Y+N VGGQDE++FDG S       ++    K F E   
Sbjct: 178 GKFEKKLRMLSTRAYDMGVFIAYLNTVGGQDEIVFDGRSMVISPSGEIITMGKAFEEDFI 237

Query: 242 MTE-----------------WHYDQQLSQWNYMSDDSASTMYIP-----------LQEEE 273
           + +                 W  + + ++   +S +   ++ +            L EEE
Sbjct: 238 VVDLDLEEVTRVRMREPKIRWESEFERAEIIKISGEQKKSLAVQSLQPSAFSLKILSEEE 297

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             + A    LRDYV+KN F +V +GLSGGIDS+  A +A DALG + V  + +P +YTS 
Sbjct: 298 EIFKALKTGLRDYVEKNGFSRVCLGLSGGIDSSFVALVATDALGSDRVTGVFMPSRYTSR 357

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMA 393
           +S ED     K LG +   + I ++   +   ++   +  P     ENIQSRIRGNILMA
Sbjct: 358 ESKEDVYELVKNLGIELIEISIDEIFEEYLRRLADTFKGLPEDTTEENIQSRIRGNILMA 417

Query: 394 LSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGL 453
           +SN    +++TT NKSE++VGY TLYGDM+GGF  +KD+YKTQV+++A W +        
Sbjct: 418 ISNKFGWLVITTGNKSEMAVGYATLYGDMAGGFAVIKDVYKTQVYRVAKWASR------- 470

Query: 454 GPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVE---NEESFINNDQEY 510
               + IP  I +K PSAELRP QTDQ++LPPY ILD+I+KR +E   +EE  +  +Q +
Sbjct: 471 ----DRIPERIFKKPPSAELRPGQTDQDTLPPYEILDEILKRHIEKCMSEEEIV--EQGF 524

Query: 511 NDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           + +TVR V  ++  +E+KRRQ+P G KI+  S G+D  +PI+N+F
Sbjct: 525 DRDTVRKVLRMVKKAEFKRRQSPPGIKISPVSLGKDWRFPITNRF 569


>gi|312795378|ref|YP_004028300.1| glutamine-dependent NAD(+) synthetase [Burkholderia rhizoxinica HKI
           454]
 gi|312167153|emb|CBW74156.1| Glutamine-dependent NAD(+) synthetase (EC 6.3.5.1) [Burkholderia
           rhizoxinica HKI 454]
          Length = 559

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 231/575 (40%), Positives = 332/575 (57%), Gaps = 40/575 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQ+N  VGD AGNIAK   A + A+  G  L++  EL +SGYPPEDL+ + +F  
Sbjct: 1   MKIALAQINVTVGDFAGNIAKIVAAAQTAHDAGASLMIAPELALSGYPPEDLLLRPAFYT 60

Query: 65  ACSSAIDTLKSD-THDGGAGIVVGFP------------RQDQEGV-----LNSVVILDAG 106
           A  +A+  L +  +   G  ++VG P            R  + GV      N+  +L  G
Sbjct: 61  ASHAALSELAAQLSRFAGLRVLVGHPYRSAPTGDVNPNRPLERGVPPVDTFNAASLLAEG 120

Query: 107 NIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLK 164
            I+    K  LPN   F EKR F S  +  P VF    ++ G++ICED W  S       
Sbjct: 121 RIVGTYRKQELPNTEVFDEKRYFAS--NPQPFVFELEGVKFGVIICEDAWHPSAALLAKA 178

Query: 165 KQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFD 224
              A+ L   N SPY+ NK   R +I+  +I    +P +Y+N VG QDEL+FDG SF  D
Sbjct: 179 AG-AQVLLVPNGSPYHVNKEDVRVDILRERIRETGMPAVYLNLVGAQDELVFDGGSFVLD 237

Query: 225 GQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSL 283
              +L  ++  F EQ  + E  +D   +Q   ++         P +  EA  Y A VL +
Sbjct: 238 AHGELMARLPQFVEQTAIVE--FDGAQAQRGEIA---------PRECVEAQVYAALVLGV 286

Query: 284 RDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACA 343
           RDY+ KN F   IIGLSGG+DSAL  A+A DALG E V+ +M+P +YT+  S+ DAA  A
Sbjct: 287 RDYLNKNGFPGAIIGLSGGVDSALVLAVACDALGAERVRAVMMPSRYTADMSMSDAAEMA 346

Query: 344 KALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLL 403
           + +G +YD + I  + + F + ++      P     ENIQ+RIRG +LMALSN   +++L
Sbjct: 347 RRVGVRYDEIAIGPMFDAFRASLAAQFAGLPEDATEENIQARIRGTLLMALSNKFGSIVL 406

Query: 404 TTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPS 463
           TT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+    +      ++IP  
Sbjct: 407 TTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAATTFA----TRDIIPER 462

Query: 464 ILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLL 522
           IL ++PSAELR +QTDQ+SLPPY +LD I++  +E + S        Y  + V+ V  L+
Sbjct: 463 ILTRAPSAELRENQTDQDSLPPYEVLDAIMRMYMEEDRSLEGIVAAGYARDDVQRVTRLI 522

Query: 523 YGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
             +EYKRRQAP+G ++T ++FGRD  YPI++ F +
Sbjct: 523 KINEYKRRQAPIGIRVTHRAFGRDWRYPITSHFSE 557


>gi|225850164|ref|YP_002730398.1| glutamine-dependent NAD+ synthetase [Persephonella marina EX-H1]
 gi|225645778|gb|ACO03964.1| glutamine-dependent NAD+ synthetase [Persephonella marina EX-H1]
          Length = 574

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 235/587 (40%), Positives = 335/587 (57%), Gaps = 45/587 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +KKL++A+ QLN  VGDI GN  K   A +EA     D+I F EL I+GYPPEDL+ K S
Sbjct: 1   MKKLRLALGQLNMTVGDIEGNTEKIISAIKEAKLHECDIIAFPELAITGYPPEDLLLKPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI     A++ +   + +     +VGF  +  E + N+  +L  G I+AV  K  LPNY 
Sbjct: 61  FINRNLQALNRIAQASEN--IITIVGFVDK-VEDIYNAAAVLLNGKIVAVYHKNFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F  G     +     ++G+ ICEDIW   N       +GAE + ++NASPY+ 
Sbjct: 118 VFDEVRYFQRGNEITLLNIEGYKIGLSICEDIWYPENPINIQAIEGAELIININASPYHI 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K K R +++  +     + I YVN VGGQDEL+FDG S        +  + + F E+  
Sbjct: 178 GKGKFREDMLKVRARDNLVSIAYVNLVGGQDELVFDGNSIIVGPDGSVLTKGRSFEEEIV 237

Query: 242 MTEWHYD----QQLS-------QWNYMSDDSASTMYIPLQ-----------------EEE 273
           + + + D    QQL        +  Y  ++    +++  +                 E E
Sbjct: 238 LCDINLDAIFRQQLKDNRLRNLRAMYKREEKVKEIHLDFKIKDKLETIPQKTILDRPEIE 297

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             Y A V  +RDY+ KN F KV+IGLSGGIDS+L A IA DALGK+NV+ +++P ++TS 
Sbjct: 298 EIYKALVTGVRDYIHKNGFEKVVIGLSGGIDSSLTATIATDALGKDNVKGVLMPSQFTSK 357

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMA 393
           +S+EDA   A+ LG +   LPI D+   +   +             EN+Q+RIRGN+LMA
Sbjct: 358 ESVEDALELAENLGIETFTLPITDIFEKYKDELKDIFAGLKPDATEENLQARIRGNLLMA 417

Query: 394 LSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGL 453
           LSN    ++L T NKSE+SVGY TLYGDM GGF  LKD+ KT+V++LA +RNS       
Sbjct: 418 LSNKFGWIVLATGNKSEMSVGYATLYGDMVGGFAVLKDVLKTKVYELAQYRNS------- 470

Query: 454 GPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENE---ESFINNDQEY 510
             ++ VIP  +LEK PSAEL+P Q D++ L PYPILD+II   VE +   +  I     +
Sbjct: 471 --ISPVIPQRVLEKPPSAELKPDQRDEDELLPYPILDEIIMLYVEEDMPVQDIIR--MGF 526

Query: 511 NDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           +  +V  V  ++  +EYKRRQAP+G +IT ++FG+DR  P++NKFR+
Sbjct: 527 DRHSVEKVVKMIDRNEYKRRQAPIGIRITHRAFGKDRRMPVTNKFRE 573


>gi|85711028|ref|ZP_01042088.1| NAD(+) synthase [Idiomarina baltica OS145]
 gi|85694941|gb|EAQ32879.1| NAD(+) synthase [Idiomarina baltica OS145]
          Length = 538

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 224/555 (40%), Positives = 321/555 (57%), Gaps = 31/555 (5%)

Query: 9   IAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSS 68
           +AQL+  VG +  N +   +   E +R   D+I+F EL I+GYPPEDL+ +    +A  +
Sbjct: 1   MAQLDFTVGALHNNTSLILKTVAEQSRD-HDIIVFPELAITGYPPEDLLLRTDHQEAVDN 59

Query: 69  AIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRT 128
           A++ + +   D    ++VG P +  E + N + +L  G  +    K  LPN   F E+R 
Sbjct: 60  AVEQISAAASD--CVVIVGHPSKVGEQLFNVISVLHRGECLLRYKKQRLPNTGVFDEQRY 117

Query: 129 FISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRH 188
           F+ G       ++  R+G++ICED+W    + + L     + + S+NASPY  +K  +R 
Sbjct: 118 FVPGDEGQVFEWQGYRIGLMICEDLWHPEPLAR-LADDQLDLVLSVNASPYEIDKHDQRL 176

Query: 189 EIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYD 248
            ++  +++    PI Y+N  GGQDELIFDG S   D Q +L  ++ H        +   +
Sbjct: 177 SVLKQRVAEHGFPIAYLNNCGGQDELIFDGHSLVLDKQGELVAELPHCQTTLATLKLTTE 236

Query: 249 QQLSQWNYMSDDSASTMYIPLQEEEAD------YNACVLSLRDYVQKNNFHKVIIGLSGG 302
               +            + P   E++D      Y+A VLS+RDYV KN F  V++GLSGG
Sbjct: 237 SLTCE-----------AFPPYAGEDSDLRLAHVYDALVLSVRDYVNKNGFKNVLLGLSGG 285

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL  AIA DALG E VQ +M+P+KYTS  SLEDA   A+ L  KYDV+PI  + + F
Sbjct: 286 IDSALTLAIASDALGSERVQAVMMPFKYTSNMSLEDAEQQAETLNVKYDVVPIEPMFDAF 345

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
              +  F     +    EN+QSR RG +LMALSN S A++LTT NKSE++VGY TLYGDM
Sbjct: 346 MKQLDPFFAGTSTDTTEENLQSRCRGVLLMALSNKSGALVLTTGNKSEVAVGYATLYGDM 405

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
            GGF P+KD+ KT V+QLA++RN+          +  IP  ++E+ PSAEL P Q D +S
Sbjct: 406 CGGFAPIKDVPKTLVYQLAAYRNTR---------SACIPERVIERPPSAELAPDQVDSDS 456

Query: 483 LPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LP Y  LD I+   VE + S ++     +N+  VR    L+  +EYKRRQA VG KITA+
Sbjct: 457 LPDYGDLDRILSLYVEQDWSVVDIIAAGFNEADVRRALKLVDINEYKRRQAAVGPKITAR 516

Query: 542 SFGRDRLYPISNKFR 556
           +FGRDR YPI++ +R
Sbjct: 517 NFGRDRRYPITSHYR 531


>gi|50085923|ref|YP_047433.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Acinetobacter sp. ADP1]
 gi|49531899|emb|CAG69611.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Acinetobacter sp. ADP1]
          Length = 541

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 234/560 (41%), Positives = 336/560 (60%), Gaps = 27/560 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  KIA+AQ +P +G+I  N  +      EA +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKIALAQFSPHIGNIDSNAQRMVEQANEAKKQNADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   LK +  D    +V GF  Q +EG   NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFQQLK-EVKD--IVMVFGFVHQTEEGHRYNSAAVMKDGVVLGVYNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F EKR F  G+ +    +   + G+LICEDIW + N  K L K   E +  LNASPY 
Sbjct: 118 SVFDEKRYFSPGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSKLNVETVLVLNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + +T     +++ ++Y+NQVGGQD+LIFDG+SF  +   ++AFQ   F E+ 
Sbjct: 177 VGKPQHRVQTLTELSKQLNVHLVYLNQVGGQDDLIFDGSSFIINHDGEVAFQAPSFKEEL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
           + +E+  +Q+     Y   D A     P  +  A+ Y + V++ RDYVQ++ F  VI+GL
Sbjct: 237 YYSEFDIEQK----RYKKIDPA-----PALDTIAEIYQSLVMATRDYVQRSGFSGVILGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIA DA+G + VQ +M+PY YTS  S+EDA   A+ +G  + +  IH +V
Sbjct: 288 SGGIDSALTLAIAADAIGADKVQAVMMPYTYTSQISVEDATEQARRMGVTFGIAEIHPIV 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSE++VGY TLY
Sbjct: 348 NSFMQTLYPFFGNAPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSELAVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GGF  LKD+YKT VF+LA +RN+   T        VIP  ++ + PSAELRP Q D
Sbjct: 408 GDMVGGFAVLKDVYKTIVFELAKYRNTLSETP-------VIPERVITRPPSAELRPDQKD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           Q+SLP Y ILD I+   +E ++S   +D   + ++ E V  V  L+  +EYKRRQ  +G 
Sbjct: 461 QDSLPAYDILDAILYAYIEEDQS--QSDIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGP 518

Query: 537 KITAKSFGRDRLYPISNKFR 556
           +I++++F R+R YPI N +R
Sbjct: 519 RISSRAFSRERRYPIVNGWR 538


>gi|289432851|ref|YP_003462724.1| NAD+ synthetase [Dehalococcoides sp. GT]
 gi|288946571|gb|ADC74268.1| NAD+ synthetase [Dehalococcoides sp. GT]
          Length = 566

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 230/575 (40%), Positives = 332/575 (57%), Gaps = 34/575 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + KL++A+AQ++ VVGD+AGN A      ++A   G D+I F EL I GYPPEDL+ K  
Sbjct: 1   MGKLRLAMAQIDSVVGDLAGNTACIVSHVQKARSLGADVIAFPELAICGYPPEDLLHKPR 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++    A+D +   +   G  ++VG+     +G+ N+  I+  G++I    KI LPNY 
Sbjct: 61  FVEENLQALDAVIKASQ--GITVIVGY-VDSHDGLRNAAAIIHNGSLIDSYHKIFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F+ G          +++G+ ICEDIW  S        +GAE + +++ASPY+ 
Sbjct: 118 VFDENRYFLPGNRCPVYTICGLQVGVNICEDIWFTSGPSTAQANKGAELIINISASPYHF 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K  +R ++++ +     + I Y N VGGQDEL+FDGAS  FD    L  + K F E   
Sbjct: 178 GKRNQREKMLSDRARENRVYIAYTNMVGGQDELVFDGASDVFDYNGNLLIRGKQFQEDLV 237

Query: 242 MTEWHYDQQLSQWN---------YMSDDSASTM--------YIPLQEEEADYNACVLSLR 284
           + +        Q +         ++S     T+        + PL+ +   Y A +L  R
Sbjct: 238 VLDLDIPVLPRQADTNANVPDSIFVSSAGFETLKPPIENIAFTPLEADAEVYQALLLGTR 297

Query: 285 DYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAK 344
           DY+ KN F KV+IGLSGGIDS+L A IA DALG ENV  +++P +Y+S  S+ D+   A 
Sbjct: 298 DYINKNGFKKVVIGLSGGIDSSLVATIAADALGPENVVGVIMPSRYSSAGSISDSLHLAG 357

Query: 345 ALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLT 404
            LG K   +PI  L   F + +S       +    ENIQ+RIRGN+LMALSN    ++L 
Sbjct: 358 NLGIKTLQIPIDPLFQSFLNTLSDVFAGTEANTTEENIQARIRGNLLMALSNKFHWLVLN 417

Query: 405 TSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSI 464
           TSNKSE ++GY TLYGDM+GGF  +KD+ K  V++LA  RN     +G     ++IP ++
Sbjct: 418 TSNKSETAIGYSTLYGDMAGGFAIIKDVPKVLVYRLAHNRNK---LAGF----DLIPDNV 470

Query: 465 LEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ----EYNDETVRYVEH 520
           L K PSAEL+P+Q D +SLPPY +LD I++  VE ++S    DQ     +  + V+ V  
Sbjct: 471 LTKPPSAELKPNQLDTDSLPPYEVLDPILEAYVEQDKSI---DQIVALGFAADIVKRVVK 527

Query: 521 LLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           ++  SEYKRRQAP G KIT K+FGRDR  PI+N++
Sbjct: 528 MVDRSEYKRRQAPPGIKITPKAFGRDRRLPITNRY 562


>gi|238028323|ref|YP_002912554.1| NAD synthetase [Burkholderia glumae BGR1]
 gi|237877517|gb|ACR29850.1| NAD+ synthetase [Burkholderia glumae BGR1]
          Length = 561

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 232/577 (40%), Positives = 328/577 (56%), Gaps = 39/577 (6%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF- 62
           K +IA+AQLN  VGD AGN+A+   A   A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVARIVEAARAAHDDGAQLLVAPELALSGYPPEDLLLRPAFY 61

Query: 63  ---------IQACSSAID--------TLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDA 105
                    +  C    +         L++ + DG A   +G      +   N+  +L  
Sbjct: 62  TEAAEALARLAECLKPFEGLAVLVGHPLRTPSADGNANRPIGRGATPVD-TYNAASLLVG 120

Query: 106 GNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHL 163
           G I A   K +LPN   F EKR F +     P VF     R G++ICED W +++  +  
Sbjct: 121 GAIAATYRKQDLPNTEVFDEKRYFAT--DPQPCVFELNGTRFGVIICEDAW-HASAAQLA 177

Query: 164 KKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCF 223
           K  GAE L   N SPY+ +K   R  IV  +I    LP++YVN VGGQDEL+FDG SF  
Sbjct: 178 KAAGAEVLLVPNGSPYHMDKDAVRVGIVRARIRETGLPVVYVNLVGGQDELVFDGGSFVL 237

Query: 224 DGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSL 283
           DG  +L  +M  F   + + E+   + L             +  PL  E   Y A VL +
Sbjct: 238 DGAGELVARMPQFEAGHAIVEFDGARPLP----------GEIAAPLPVEAQVYRALVLGV 287

Query: 284 RDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACA 343
           RDY+ KN F   +IGLSGG+DSAL  A+A DALG E V+ +M+P +YT+  S  DAA  A
Sbjct: 288 RDYIGKNGFPGALIGLSGGVDSALVLAVACDALGPERVRAVMMPSRYTADISTTDAAEMA 347

Query: 344 KALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLL 403
           + +G +YD + I  + + F   ++            ENIQ+RIRG +LMALSN   +++L
Sbjct: 348 RRVGVRYDEIAIAPMFDAFCGALADEFAGRDEDATEENIQARIRGTLLMALSNKFGSIVL 407

Query: 404 TTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPS 463
           TT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+          TEVIP  
Sbjct: 408 TTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCHYRNAAAEFGS----TEVIPAR 463

Query: 464 ILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLL 522
           IL ++PSAELR +QTDQ+SLPPY +LD I++  +E ++         Y++  V  V  L+
Sbjct: 464 ILSRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDQPLAAIVAAGYDEADVTRVTRLI 523

Query: 523 YGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
             +EYKRRQAP+G ++T ++FGRD  YPI+++F + I
Sbjct: 524 KINEYKRRQAPIGIRVTHRAFGRDWRYPITSRFTERI 560


>gi|147669591|ref|YP_001214409.1| NH(3)-dependent NAD(+) synthetase [Dehalococcoides sp. BAV1]
 gi|146270539|gb|ABQ17531.1| NH(3)-dependent NAD(+) synthetase [Dehalococcoides sp. BAV1]
          Length = 566

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 230/575 (40%), Positives = 332/575 (57%), Gaps = 34/575 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + KL++A+AQ++ VVGD+AGN A      ++A   G D+I F EL I GYPPEDL+ K  
Sbjct: 1   MGKLRLAMAQIDSVVGDLAGNTACIVSHVQKARSLGADVIAFPELAICGYPPEDLLHKPR 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++    A+D +   +   G  ++VG+     +G+ N+  I+  G++I    KI LPNY 
Sbjct: 61  FVEENLQALDAVIKASQ--GITVIVGY-VDSHDGLRNAAAIIHNGSLIDSYHKIFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F+ G          +++G+ ICEDIW  S        +GAE + +++ASPY+ 
Sbjct: 118 VFDENRYFLPGNRCPVYTICGLQVGVNICEDIWFTSGPSTAQANKGAELIINISASPYHF 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K  +R ++++ +     + I Y N VGGQDEL+FDGAS  FD    L  + K F E   
Sbjct: 178 GKRNQREKMLSDRARENRVYIAYTNMVGGQDELVFDGASDVFDYNGNLLIRGKQFQEDLV 237

Query: 242 MTEWHYDQQLSQWN---------YMSDDSASTM--------YIPLQEEEADYNACVLSLR 284
           + +        Q +         ++S     T+        + PL+ +   Y A +L  R
Sbjct: 238 VLDLDIPVLPRQADTNANVPDSIFVSSAGFETLKPPIENIAFTPLEADAEVYQALLLGTR 297

Query: 285 DYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAK 344
           DY+ KN F KV+IGLSGGIDS+L A IA DALG ENV  +++P +Y+S  S+ D+   A 
Sbjct: 298 DYINKNGFKKVVIGLSGGIDSSLVATIAADALGPENVVGVIMPSRYSSAGSISDSLHLAG 357

Query: 345 ALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLT 404
            LG K   +PI  L   F + +S       +    ENIQ+RIRGN+LMALSN    ++L 
Sbjct: 358 NLGIKTLQIPIDPLFQSFLNTLSDVFAGTEANTTEENIQARIRGNLLMALSNKFHWLVLN 417

Query: 405 TSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSI 464
           TSNKSE ++GY TLYGDM+GGF  +KD+ K  V++LA  RN     +G     ++IP ++
Sbjct: 418 TSNKSETAIGYSTLYGDMAGGFAIIKDVPKVLVYRLAHNRNR---LAGF----DLIPDNV 470

Query: 465 LEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ----EYNDETVRYVEH 520
           L K PSAEL+P+Q D +SLPPY +LD I++  VE ++S    DQ     +  + V+ V  
Sbjct: 471 LTKPPSAELKPNQLDTDSLPPYEVLDPILEAYVEQDKSI---DQIVALGFAADIVKRVVK 527

Query: 521 LLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           ++  SEYKRRQAP G KIT K+FGRDR  PI+N++
Sbjct: 528 MVDRSEYKRRQAPPGIKITPKAFGRDRRLPITNRY 562


>gi|163857180|ref|YP_001631478.1| NAD synthetase [Bordetella petrii DSM 12804]
 gi|163260908|emb|CAP43210.1| putative NAD synthetase [Bordetella petrii]
          Length = 544

 Score =  399 bits (1024), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 230/562 (40%), Positives = 330/562 (58%), Gaps = 22/562 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +   ++AIAQ+N  VGDI GN A+  ++   A++QG D+++  EL ++GYPPEDL+ +  
Sbjct: 1   MSAARVAIAQINACVGDIKGNAARVLQSAHSAHQQGADVLVTPELVLTGYPPEDLLLRPH 60

Query: 62  FIQACSSAIDTLKSDTHD-GGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           F++   +A+D L+ DT    G  ++VG        + N+  +L  G ++ V  K  LPNY
Sbjct: 61  FVETQEAALDQLRRDTAGLAGLHLLVGHVLARGGKLYNAATVLCEGRVVGVYCKRELPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           S F E+R F    ++ P+VF  + +R G+ ICED+W         +      L   NASP
Sbjct: 121 SVFDEQRYFAE--ADQPLVFEVKGVRFGVNICEDMWFERAPRAAAQAGAQVLLVP-NASP 177

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K  +R  +           ++Y N VGGQDEL+FDGASF  D Q Q A ++  ++E
Sbjct: 178 YNTGKQDERLRVARRCAQDTGCAVVYANLVGGQDELVFDGASFALDAQGQPAARLPDYTE 237

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
              + E      +   +  +D +      P   EE  +NA VLS+RDY+ KN F   IIG
Sbjct: 238 GVDVVEVDAAGAVRPLSRHADVA------PYCLEEQVWNALVLSVRDYLGKNGFPGAIIG 291

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSA+  A+AVDALG  NV+T+M+P +YT+  S  DA   A+ LG ++D + I   
Sbjct: 292 LSGGIDSAVVLAVAVDALGAANVRTVMMPSRYTADISQTDAGDMAQRLGVRHDDIAIGPA 351

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V+ F ++++      P     ENIQ+R+RG +LMALSN +  ++LTT NKSE++ GY TL
Sbjct: 352 VDAFEAMLAPQFAGLPVDATEENIQARVRGTLLMALSNKTGHLVLTTGNKSELTTGYCTL 411

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGF  +KD+ KT V++LA WRN            EVIP  I+ + PSAELRP QT
Sbjct: 412 YGDMAGGFAVIKDVPKTLVYRLAEWRNRE---------HEVIPRRIITRPPSAELRPDQT 462

Query: 479 DQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLPPY ILD I++R +E  +S        +    V  V  L+  +EYKRRQAP G +
Sbjct: 463 DQDSLPPYDILDGIMERYMERNQSAAEIVAAGFPRPAVEQVVRLIRINEYKRRQAPPGPR 522

Query: 538 ITAKSFGRDRLYPISNKFRDHI 559
           IT ++FGRD  YP++N FR+ +
Sbjct: 523 ITPRAFGRDWRYPVTNGFRETV 544


>gi|311693416|gb|ADP96289.1| NAD+ synthetase [marine bacterium HP15]
          Length = 538

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 234/565 (41%), Positives = 336/565 (59%), Gaps = 45/565 (7%)

Query: 7   IAIAQLNPVVGDIAGN----IAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           + +AQL+ +VGDI GN    +  ARRA  E      D+++F EL ++GYPPEDL+ + S 
Sbjct: 1   MVMAQLDFLVGDIPGNTELVLDAARRASSE---HQADVVVFPELCLTGYPPEDLLLRPSM 57

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
               + A++ L+++  D    IV+G P +    + N+ V++DAG I     K   PNY  
Sbjct: 58  EVRVNEALERLQAERLD--PVIVIGAPLRHGALLYNAAVVIDAGEITGRYFKRFPPNYQV 115

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F  G     +  R + +GI +CED+WK   + +     GA  + +LNASPY  +
Sbjct: 116 FDEKRYFAEGRDVLTLDIRGVPVGITVCEDLWKEGPV-EDCAAAGARLILNLNASPYDID 174

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ--- 239
           K  +R  ++  +     + I+YVN VGGQDEL+FDG S  FD    L  +   F E    
Sbjct: 175 KQARRKALLERKSRENLVSIVYVNLVGGQDELVFDGGSMVFDHSGVLTAEAPQFGEGLYP 234

Query: 240 -NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE---EAD-YNACVLSLRDYVQKNNFHK 294
            +F+ E H+ Q +SQ               L EE   EA+ Y A V  +RDYV KN F  
Sbjct: 235 VDFLCE-HHCQPVSQA--------------LPEEPTLEANVYRALVTGVRDYVNKNGFKS 279

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
           V++GLSGGIDSA+  A+AVDALGK+ V+ +M+P++YTS  SLEDA A A ALG +YDV  
Sbjct: 280 VVLGLSGGIDSAVTLAVAVDALGKDRVRAVMMPFRYTSSMSLEDAEAEAVALGVQYDVFS 339

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I  + + F   ++   +        EN+Q+R+RG +LM+LSN   +++LTT NKSE++VG
Sbjct: 340 IEPMYDAFMETLAGPFEGTTPDTTEENLQARLRGVLLMSLSNKFGSLVLTTGNKSEMAVG 399

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
           Y TLYGDM+GGF+ LKD+ KT VF+LA +RN+  ++ G     EVIP  ++ + PSAEL 
Sbjct: 400 YSTLYGDMAGGFDVLKDVPKTLVFRLAKYRNT--LSEG-----EVIPERVITRPPSAELA 452

Query: 475 PHQTDQESLPPYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRRQ 531
           P Q D++SLP Y +LD I+   VE +   ++ +    E  D  V  V  L+  +EYKRRQ
Sbjct: 453 PDQKDEDSLPGYDVLDQILNLYVERDFSADAIVAEGFERVD--VERVIRLVDINEYKRRQ 510

Query: 532 APVGTKITAKSFGRDRLYPISNKFR 556
           AP+G +IT + FG+DR YPI+N ++
Sbjct: 511 APIGVRITERGFGKDRRYPITNGWK 535


>gi|120553808|ref|YP_958159.1| NAD+ synthetase [Marinobacter aquaeolei VT8]
 gi|120323657|gb|ABM17972.1| DNA-directed RNA polymerase, subunit H [Marinobacter aquaeolei VT8]
          Length = 554

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 233/568 (41%), Positives = 341/568 (60%), Gaps = 43/568 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEA-NRQGMDLILFTELFISGYPPEDLVFKK 60
           ++KL++ +AQL+ +VGDI GN      A + A      D+++F EL ++GYPPEDL+ + 
Sbjct: 14  VRKLRVVMAQLDFLVGDIPGNTDLILEATQRAWAEHQADIVVFPELCLTGYPPEDLLLRP 73

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S       A++ L+S        +V+G P +    + N+ ++++AG I     K   PNY
Sbjct: 74  SLDLRVREALEKLQSAALP--PAMVIGAPIRSGGLLYNAALVIEAGQIRGRYFKRFPPNY 131

Query: 121 SEFHEKRTFISGYSNDPIVFRDIR---LGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
             F EKR F  G  +D +V  DI+   +GI +CED+WK+  + +     GA  + +LNAS
Sbjct: 132 QVFDEKRYFAEG--SDTLVL-DIKGQPVGITVCEDLWKDGPL-EDAAAAGARLILNLNAS 187

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY  +K  +R  ++  +     + I+YVN VGGQDEL+FDG S  +D    L+ ++  F 
Sbjct: 188 PYDIDKQARRKALLERKSRENRVSIVYVNLVGGQDELVFDGGSMAYDHSGGLSAEVPQFE 247

Query: 238 EQ----NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEE---EAD-YNACVLSLRDYVQK 289
           E     +F+ E H+ Q +S+              PL  E   EA+ YNA V  +RDYV K
Sbjct: 248 EGLYPVDFLCE-HHCQPISR--------------PLPPEPQLEANVYNALVTGVRDYVNK 292

Query: 290 NNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCK 349
           N F  V++GLSGGIDSA+  A+AVDALGKE V+ +M+P++YTS  SLEDA A A ALG +
Sbjct: 293 NGFRSVVLGLSGGIDSAVTLAVAVDALGKERVRAVMMPFRYTSSISLEDAEAEATALGVQ 352

Query: 350 YDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKS 409
           YDV  I  + + F + +++           EN+Q+R+RG +LM+LSN   +++LTT NKS
Sbjct: 353 YDVFSIEPMYDAFMAALAEPFAGTKPDTTEENLQARLRGVLLMSLSNKFGSLVLTTGNKS 412

Query: 410 EISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSP 469
           E++VGY TLYGDM+GGF+ LKD+ KT VF+LA +RN+         L+ VIP  ++ + P
Sbjct: 413 EMAVGYSTLYGDMAGGFDVLKDVPKTLVFRLARYRNT---------LSPVIPERVITRPP 463

Query: 470 SAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYK 528
           SAEL P Q D++SLP Y +LD I+   VE + S      E +  E V  V  L+  +EYK
Sbjct: 464 SAELAPDQKDEDSLPGYDVLDQILNLYVERDYSADAIVAEGFEREDVDRVVRLVDINEYK 523

Query: 529 RRQAPVGTKITAKSFGRDRLYPISNKFR 556
           RRQAP+G +IT + FG+DR YPI+N ++
Sbjct: 524 RRQAPIGVRITERGFGKDRRYPITNGWK 551


>gi|270308329|ref|YP_003330387.1| glutamine-dependent NAD(+) synthetase [Dehalococcoides sp. VS]
 gi|270154221|gb|ACZ62059.1| glutamine-dependent NAD(+) synthetase [Dehalococcoides sp. VS]
          Length = 566

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 231/575 (40%), Positives = 335/575 (58%), Gaps = 34/575 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + KL++A+AQ++ VVGD+AGN A      ++A   G D+I F EL I GYPPEDL+ K  
Sbjct: 1   MGKLRLAMAQIDSVVGDLAGNTACIVGNIQKARSLGADVIAFPELAICGYPPEDLLHKPR 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++    A+DT+   +   G  ++VG+     +G+ NS  ++  G +I    KI LPNY 
Sbjct: 61  FVEENLHALDTVIKASQ--GITVIVGY-VNSSDGLHNSAAVIHNGCLIDSYHKIFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F+ G          +++G+ ICEDIW  S        +GAE + +++ASPY+ 
Sbjct: 118 VFDENRYFMPGNRCPVYTICGLQVGVNICEDIWFTSGPSTAQASKGAELIINISASPYHL 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K  +R ++++ +     + I Y N VGGQDEL+FDGAS  FD    L  + K F E   
Sbjct: 178 GKRNQREKMLSNRARENRVYIAYTNMVGGQDELVFDGASNIFDYNGNLVLRGKQFQEDLL 237

Query: 242 MTEWHYDQQLSQWNYMSD------DSASTM-----------YIPLQEEEADYNACVLSLR 284
           + +        Q +  ++       SAS +            +PL  +   Y A +L  +
Sbjct: 238 VLDLDIPISPVQRDMNTEIPDSIFVSASGLSEPKLPVENSDSVPLDADAEVYQALLLGTK 297

Query: 285 DYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAK 344
           DY+ KN F KV+IGLSGGIDS+L AAIA DALG +NV  +++P +Y+S  S+ D+   A+
Sbjct: 298 DYINKNGFKKVVIGLSGGIDSSLVAAIATDALGSDNVVGVIMPSRYSSAGSISDSLRLAE 357

Query: 345 ALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLT 404
            L  K   +PI  +   F S +S+      +    ENIQ+RIRGN+LMALSN    ++L 
Sbjct: 358 NLRIKTLQIPIDPIFKSFLSTLSEVFAGTETDTTEENIQARIRGNLLMALSNKFHWLVLN 417

Query: 405 TSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSI 464
           TSNKSE ++GY TLYGDM+GGF  +KD+ K  V++LA  RN    ++G     E+IP ++
Sbjct: 418 TSNKSETAIGYSTLYGDMAGGFAIIKDVPKVLVYRLAHNRNK---SAGF----ELIPHNV 470

Query: 465 LEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ----EYNDETVRYVEH 520
           L K PSAEL+P+Q D +SLPPY +LD I++  VE ++S    DQ     + +  V+ V  
Sbjct: 471 LTKPPSAELKPNQFDTDSLPPYEVLDPILEAYVEQDKSI---DQIVALGFEESIVKRVVK 527

Query: 521 LLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           ++  SEYKRRQAP G KIT K+FGRDR  PI+N++
Sbjct: 528 MVDRSEYKRRQAPPGIKITPKAFGRDRRLPITNRY 562


>gi|294786968|ref|ZP_06752222.1| glutamine-dependent NAD(+) synthetase [Parascardovia denticolens
           F0305]
 gi|315226607|ref|ZP_07868395.1| NAD synthetase [Parascardovia denticolens DSM 10105]
 gi|294485801|gb|EFG33435.1| glutamine-dependent NAD(+) synthetase [Parascardovia denticolens
           F0305]
 gi|315120739|gb|EFT83871.1| NAD synthetase [Parascardovia denticolens DSM 10105]
          Length = 560

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 226/565 (40%), Positives = 320/565 (56%), Gaps = 32/565 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           + IA+AQ++  VGD+ GN AK       A  QG D++LF E+ ++GYP EDL F+ +F Q
Sbjct: 16  VTIALAQIDTCVGDLDGNAAKVLSYSRRAAGQGADVVLFPEMTLTGYPIEDLAFRATFRQ 75

Query: 65  ACSSAIDTLKSDTHDGGAG---IVVGFPRQDQEGV-LNSVVILDAGNIIAVRDKINLPNY 120
           A      TL  D    G G   +VVG    D  G+  N +++L  G + A  DK  LPNY
Sbjct: 76  AAWDKASTLAEDLGKEGLGDLYVVVGTVAADAHGLPRNRLIVLHQGVVEASYDKHFLPNY 135

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F  G     +  +  ++G  ICEDIW+       L ++G + L ++N SPY 
Sbjct: 136 GVFDEFRIFSPGDLPLVMTIKGRKIGFAICEDIWQEGGPVAQLAQKGIDLLATINGSPYE 195

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R ++   +   V  P+IY+NQVGGQD+L+FDGASF  +    +  +   F E  
Sbjct: 196 EGKGHIRTDLCARRAREVTAPVIYLNQVGGQDDLVFDGASFVVNPDGGVEERSPQFVE-- 253

Query: 241 FMTEWHYDQQLSQWNYM------SDDSASTMYIPLQE-EEADYNACVLSLRDYVQKNNFH 293
                     LS W         SD +  +  IPL + +E  Y ACVL L+DY+ KN F 
Sbjct: 254 ---------DLSFWTLPAVAGTDSDQAGRSTLIPLMDSDEEVYRACVLGLKDYMAKNGFK 304

Query: 294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVL 353
            V++GLSGGIDSAL A +A DA+G  NV  + +P  Y+S  S +DAA  A  +G  Y++ 
Sbjct: 305 GVVLGLSGGIDSALVATMAADAIGGSNVWGLSMPSMYSSSGSKDDAADLAANMGAHYEIQ 364

Query: 354 PIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISV 413
           PI  L   F        Q +  GI AEN+Q+R+RG ++MA SN    + L T NKSE++ 
Sbjct: 365 PIEPLFQAFQK------QLDLQGIAAENLQARMRGVLVMAYSNSHGLLALATGNKSELAC 418

Query: 414 GYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAEL 473
           GY T+YGD  GG+ P+KD+ KT+V+QLA WRNS+ +  G  P    IP + + K PSAEL
Sbjct: 419 GYSTIYGDAVGGYAPIKDVLKTKVWQLAKWRNSYALGKGQVP---PIPVNSILKPPSAEL 475

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQA 532
           RP Q D +SLP Y +LD ++   +E      +  ++ ++ ETV  V  L+  +E+KRRQ 
Sbjct: 476 RPGQKDSDSLPEYELLDQVLASYIEKAHGRADLLKDGFDPETVDTVMRLVDKAEWKRRQY 535

Query: 533 PVGTKITAKSFGRDRLYPISNKFRD 557
           P+G K+TA +FGRDR  P+++ FR+
Sbjct: 536 PLGPKVTALAFGRDRRLPVTSAFRE 560


>gi|304316376|ref|YP_003851521.1| NAD+ synthetase [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
 gi|302777878|gb|ADL68437.1| NAD+ synthetase [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
          Length = 545

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 234/571 (40%), Positives = 331/571 (57%), Gaps = 46/571 (8%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQLNP VGDI  N  K     +EA +  MDLI+F EL I GYPP+DL++   F++
Sbjct: 1   MKIALAQLNPTVGDIKNNCEKIIMYIKEAKKANMDLIVFPELSIIGYPPKDLLYNPDFLE 60

Query: 65  ACSSAIDTL-KSDTHDGGAGIVVGFPRQDQEG---VLNSVVILDAGNIIAVRDKINLPNY 120
           +  SA++ L   +T+D   G++VG   +D+E    + NS ++L  G II   DK  LPNY
Sbjct: 61  SSYSALNELILPETND--IGVIVGIATKDKEKDYMLHNSALLLYNGKIIGQADKTLLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLK----------KQGAEF 170
             F E+R F    S     F+ +RL + ICEDIW + +  +  +          K   + 
Sbjct: 119 DVFDEQRYFEPAKSRTCFDFKGMRLAVNICEDIWNDKDFWERPRYDIDVLEEQYKLNPDI 178

Query: 171 LFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLA 230
             +++ASPY   K + R ++V        LP+IYVNQVGG DELIFDG SF  +      
Sbjct: 179 FINISASPYNLGKQELRTKMVKQISKKYKLPLIYVNQVGGNDELIFDGNSFAINSNGDRV 238

Query: 231 FQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD----YNACVLSLRDY 286
             ++ FSE     +     +L                PLQE + D    ++A +L LRDY
Sbjct: 239 VNLRSFSEDIAFVDTENLDELK---------------PLQEIKEDISWVHDALILGLRDY 283

Query: 287 VQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKAL 346
            +K  F K ++GLSGGIDSA+  A+AV ALG+ENV  + +P +Y+S  S +DA   A+ L
Sbjct: 284 FRKTGFKKAVVGLSGGIDSAVTCALAVKALGRENVLGVSMPSRYSSEGSKDDARDLAQNL 343

Query: 347 GCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTS 406
           G +Y V+PI D+   + S+ ++        +  EN+Q+RIRGN LM +SN    M+LTT 
Sbjct: 344 GIQYRVIPIEDVFKSYISIFNKD-GNVLGDLAEENLQARIRGNYLMFISNREGYMVLTTG 402

Query: 407 NKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILE 466
           NKSEI+VGY TLYGDMSGG   + D+ KT V++LA + N   I         +IP S +E
Sbjct: 403 NKSEIAVGYCTLYGDMSGGLAVISDVPKTMVYELAKYINRDKI---------IIPLSTIE 453

Query: 467 KSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGS 525
           K+PSAELRP+Q D +SLPPY ILDDI+K  +E+++S      + Y+ + VR V   +  +
Sbjct: 454 KAPSAELRPNQKDTDSLPPYEILDDILKSYIEDDKSISEIIADGYDKDLVRDVIRKVNNA 513

Query: 526 EYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           EYKR+QA  G K+T K+FG  R  PI+ +FR
Sbjct: 514 EYKRKQAAPGLKVTTKAFGVGRRMPIAQRFR 544


>gi|300690788|ref|YP_003751783.1| nh3-dependent nad+ synthetase (nadE) [Ralstonia solanacearum PSI07]
 gi|299077848|emb|CBJ50486.1| putative nh3-dependent nad+ synthetase (nadE) [Ralstonia
           solanacearum PSI07]
          Length = 546

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 230/568 (40%), Positives = 330/568 (58%), Gaps = 43/568 (7%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           +A+AQ+N  VGD+AGN A+   A  EA++ G  +++  EL ++GYPPEDL+ + +F+ A 
Sbjct: 5   VALAQINCTVGDLAGNAARIVAAAREAHQAGARILVTPELSLTGYPPEDLLLRPAFLDAT 64

Query: 67  SSAIDTLKSDTHD-GGAGIVVGFPRQDQEGV---------LNSVVILDAGNIIAVRDKIN 116
           S A+D L ++     G  +++G P+   E            N+  +   G +     K+ 
Sbjct: 65  SRALDVLVAELAAFPGLHVLIGHPQLSFEAPAPGSALPKPTNTATVAVDGRVRGQYHKLE 124

Query: 117 LPNYSEFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSL 174
           LPN   F EKR F  G+  +P VF     R G++ICED W         K  GAE +   
Sbjct: 125 LPNNEVFDEKRYFQVGF--EPFVFDVEGTRFGVIICEDAWY-PQATAWAKAAGAEVVLVP 181

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           NASPY+ +K   R +I+  ++    LP +YVN VGGQDEL+FDG SF  D   +   +M 
Sbjct: 182 NASPYHLDKEDLREQIIGARVKESGLPHVYVNLVGGQDELVFDGGSFVLDSGGKPVARMA 241

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTM---YIPLQEEEAD-YNACVLSLRDYVQKN 290
            F E                 Y+  D A  +     P    EA  Y A  L +RDY+ KN
Sbjct: 242 QFVEG--------------VGYVRFDGARPLPGEIAPEATLEAQVYEALKLGVRDYIGKN 287

Query: 291 NFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKY 350
            F   IIGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA   A  LG +Y
Sbjct: 288 GFPGAIIGLSGGVDSALVLAIAVDALGTDRVRAVMMPSRYTADISWLDARDMAARLGVRY 347

Query: 351 DVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSE 410
           D +PI  + + F  ++++  +  P     ENIQ+RIRG +LMALSN S  ++LTT NKSE
Sbjct: 348 DEIPIMPMFDAFGGVLAEEFRNLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSE 407

Query: 411 ISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPS 470
           ++VGY TLYGDM+GGF  +KD++KT V++L  +RN+         L+EVIP  IL ++PS
Sbjct: 408 MAVGYCTLYGDMAGGFAVIKDIFKTLVYRLCRYRNA---------LSEVIPERILTRAPS 458

Query: 471 AELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKR 529
           AELR +QTDQ+SLP Y  LD I++R +E  +   +     + +  VR +  L+  +EYKR
Sbjct: 459 AELRENQTDQDSLPEYAALDAIVQRYMEQNQPVTDIIAAGFAEADVRKIVRLIKINEYKR 518

Query: 530 RQAPVGTKITAKSFGRDRLYPISNKFRD 557
           RQAPVG ++T ++FGRD  YPI+++F++
Sbjct: 519 RQAPVGIRVTQRAFGRDWRYPITSRFKE 546


>gi|222100295|ref|YP_002534863.1| glutamine-dependent NAD(+) synthetase [Thermotoga neapolitana DSM
           4359]
 gi|221572685|gb|ACM23497.1| glutamine-dependent NAD(+) synthetase [Thermotoga neapolitana DSM
           4359]
          Length = 555

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 223/566 (39%), Positives = 323/566 (57%), Gaps = 40/566 (7%)

Query: 23  IAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGA 82
           + KA  A + A  +G DL++F ELF+ GYPPEDL+ + SF++     +  L S T     
Sbjct: 1   MKKAIEALKTAEERGSDLLIFPELFLPGYPPEDLMLRLSFLRENRRYLLELASHTKSCEV 60

Query: 83  GIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRD 142
            ++VGF   D++   N+  +L  G ++ V  K+ LPNY  F E+R F  G     +   D
Sbjct: 61  TVLVGFIDSDEDA-YNAAAVLKRGEVLGVYRKMFLPNYGVFDERRYFKPGEELLVLKMGD 119

Query: 143 IRLGILICEDIWKNSNICKHLK-KQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLP 201
           +++G+ ICEDIW        L   +G   + +L+ASPY+  K + R E ++ +    H  
Sbjct: 120 VKIGVTICEDIWNPVEPSASLSLGEGVHLVANLSASPYHVGKPRLRKEYLSMKAYDYHTA 179

Query: 202 IIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLS------QWN 255
           I Y N VGGQDEL+FDG S   D   ++    K F E+    +   D+ L       +  
Sbjct: 180 IAYCNMVGGQDELVFDGGSIVVDASGEVISYGKLFEEEIITVDLDLDENLRVSLLDPRRR 239

Query: 256 YMSDDS-------------ASTMYIPL-----QEEEADYNACVLSLRDYVQKNNFHKVII 297
           YM   +              S+ + PL     + EE  + A V  +RDYV+KN F KV+I
Sbjct: 240 YMRSQNYPVKIVDVGGLRRKSSHFDPLIHPIPKREEEMFRALVTGVRDYVRKNGFEKVVI 299

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGG+DS+L A IA +ALGKENV+ +++P  YTS  SLEDA   A+ LG +  ++PI D
Sbjct: 300 GLSGGMDSSLVAVIATEALGKENVKGVLMPSMYTSKSSLEDAQKLAENLGIETFIIPITD 359

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           +   +   + +    +   I  ENIQ+RIRGN LMALSN    ++LTT NKSE++ GY T
Sbjct: 360 VFRSYLDALKEVFAGKEPDITEENIQARIRGNYLMALSNKFGWLVLTTGNKSEMATGYAT 419

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGF  +KD+YKT V+++  W N      G     E+IP ++  K PSAELRP Q
Sbjct: 420 LYGDMAGGFAVIKDVYKTDVYRIGRWYNEW---KG----REIIPENVFVKPPSAELRPGQ 472

Query: 478 TDQESLPPYPILDDIIKRIVEN----EESFINNDQEYNDETVRYVEHLLYGSEYKRRQAP 533
           TDQE LPPY ILD+I+K  +E     EE  +     ++ + V  V  ++  +EYKR+QA 
Sbjct: 473 TDQEKLPPYEILDEILKLYIEEGLDPEEIALKG---FDKKMVVEVTEMVRKNEYKRKQAA 529

Query: 534 VGTKITAKSFGRDRLYPISNKFRDHI 559
           +GTKI+ ++FG+D   PI+N+FR+ +
Sbjct: 530 IGTKISTRAFGKDWRMPITNRFREPL 555


>gi|302036712|ref|YP_003797034.1| NAD(+) synthase (glutamine-hydrolyzing) [Candidatus Nitrospira
           defluvii]
 gi|300604776|emb|CBK41108.1| NAD(+) synthase (glutamine-hydrolyzing) [Candidatus Nitrospira
           defluvii]
          Length = 589

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 226/596 (37%), Positives = 327/596 (54%), Gaps = 48/596 (8%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           ++ L+IA+AQ+NP VGDIAGN    +   +EA R   DL+ F EL ++GYPPEDL+FK  
Sbjct: 1   MRPLRIAMAQINPTVGDIAGNTRLIQTWIKEARRAKADLVAFPELAVTGYPPEDLLFKPR 60

Query: 62  FIQACSSAIDTLKSDTHDG--------------GAGIVVGFPRQDQEGVLNSVVILDAGN 107
           FI+    A+  + ++                   A     FP   +  + N   +L    
Sbjct: 61  FIEDTQRALKAVAAEARGLVVVVGYVGQGATAVSASEAPSFPLAGRHELYNEAAVLSDRR 120

Query: 108 IIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG 167
           I+A   K +LPNY  F E R F  G     +V     +G+ ICEDIW +    +     G
Sbjct: 121 ILATYRKRHLPNYGVFDESRYFHPGSRLPLLVLNGATIGVNICEDIWFSDGPTRLQASAG 180

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
           AE + ++NASP++  K + R +++  +     + + Y N VGGQDEL+FDG S   D   
Sbjct: 181 AEVIVNINASPFHVGKGRMREQVLATRARENRVIVTYTNTVGGQDELVFDGCSMIVDQAG 240

Query: 228 QLAFQMKHFSEQNFMTEWHYDQ----QLSQWNY-----------------MSDDSASTMY 266
           ++  + K F +   + +         +L+Q                    +    + ++ 
Sbjct: 241 EIVGRGKAFEQDLIVADLDVAAVGRVRLAQGRRKPLPPRVAALIDRVDVRLPARKSQSVV 300

Query: 267 IP-----LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENV 321
           +P     L   +  Y A VL ++DYV+KN F +V+IGLSGG+DSA+ A IAVDALG ENV
Sbjct: 301 VPDLEPPLGRLDEAYRALVLGVQDYVRKNGFKRVVIGLSGGVDSAITAVIAVDALGAENV 360

Query: 322 QTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAEN 381
             + +P  YTS  S ED A  A+ L  + D L I      +   + +  +        EN
Sbjct: 361 LGVFMPSPYTSRASREDVADMARRLHIQVDTLSITATFKSYLRALGRSFKGRRPDTTEEN 420

Query: 382 IQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLA 441
           +Q+RIRGN+LMA SN    ++LTT NKSE+SVGY TLYGDM+GGF  +KD+ KT V++L+
Sbjct: 421 LQARIRGNLLMAYSNKFGHLVLTTGNKSEMSVGYATLYGDMAGGFAVIKDVPKTMVYELS 480

Query: 442 SWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEE 501
             RN       +GP+  VIP  +LE++P+AELRP Q D++SLPPY ILD I+K  VE + 
Sbjct: 481 HMRNL------VGPV-PVIPKRVLERAPTAELRPDQKDEDSLPPYAILDPILKAYVEEDR 533

Query: 502 SFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           +  +     ++ ETV  V  L+  SEYKRRQAP+G KIT ++FG+DR  PI+N +R
Sbjct: 534 ALEDITAMGFDRETVARVIALVDRSEYKRRQAPLGIKITHRAFGKDRRMPITNGYR 589


>gi|157364390|ref|YP_001471157.1| NAD+ synthetase [Thermotoga lettingae TMO]
 gi|157314994|gb|ABV34093.1| NAD+ synthetase [Thermotoga lettingae TMO]
          Length = 582

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 236/588 (40%), Positives = 334/588 (56%), Gaps = 42/588 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  L++ +AQ+N  VGDI GN+ K     E A +  +D++ F EL I+GYPPEDL+FK+ 
Sbjct: 1   MNTLRVGLAQINSTVGDIEGNVEKILEKLELAQQFSVDVVAFPELVITGYPPEDLLFKRH 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI     A++ +           VVGF  ++ + + N+  +L+ G+I+AV  K  LPNY 
Sbjct: 61  FIDQNKKALEKIAKYVPKSMIA-VVGFVDENSD-IFNAAAVLNNGSIVAVYRKNYLPNYG 118

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG-AEFLFSLNASPYY 180
            F E R F  G     I F + R+G+ ICEDIW      +     G A  L ++++SPY+
Sbjct: 119 VFDEFRYFQHGDKALVISFCNARIGVTICEDIWYPGGPARIEALLGDAHLLLNISSSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  +  ++  + +     I YVN VGGQDELIFDGAS   + Q ++  + K F E++
Sbjct: 179 SGKLSWKERMLAVRANDNLAAIAYVNLVGGQDELIFDGASLIVNEQGEIISRAKQF-EED 237

Query: 241 FM-----------TEWH----------YDQQLSQWNYMS---------DDSASTMYIPLQ 270
           F+           +  H          + Q++++ N ++          D  S +  PL 
Sbjct: 238 FLIGDIDLVGIERSRLHDPRRRQDKRVWSQEIAKLNIVNIPFEPIENKPDIKSRIENPLP 297

Query: 271 EEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKY 330
                Y+A VL  RDY++KN    V+IGLSGGIDSAL   IAVDALG ++V  + +P  Y
Sbjct: 298 RVAEVYHALVLGTRDYLKKNGIKNVVIGLSGGIDSALTCCIAVDALGPDHVTGVSMPGPY 357

Query: 331 TSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNI 390
           +S  SLEDA   AK L  +Y V+PI+++   F   +     + P  +  ENIQ+RIRG I
Sbjct: 358 SSTHSLEDAELLAKNLNIRYLVIPINEIYETFLKSLKPVFGDLPFDVAEENIQARIRGVI 417

Query: 391 LMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGIT 450
           LMALSN    ++LTT NKSE S GY TLYGD +GGF  LKD+YKT V++L+ + N     
Sbjct: 418 LMALSNKFGWLVLTTGNKSESSTGYCTLYGDTAGGFAVLKDVYKTLVYELSEYVNQKA-- 475

Query: 451 SGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQE 509
                  E+IP  + EK PSAELR  Q DQ+ LPPYP+LD I+K  VE++ S        
Sbjct: 476 -----QKEIIPQRVFEKPPSAELRFGQVDQDKLPPYPLLDSILKAYVEDDRSVSEIVPAG 530

Query: 510 YNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           Y++ TVR V  ++  SEYKRRQ   G KIT ++FG+DR  PI+N+FR+
Sbjct: 531 YDETTVRKVAWMVDSSEYKRRQLAPGPKITYRAFGKDRRLPITNQFRE 578


>gi|255019805|ref|ZP_05291881.1| NAD synthetase / Glutamine amidotransferase chain of NAD synthetase
           [Acidithiobacillus caldus ATCC 51756]
 gi|254970734|gb|EET28220.1| NAD synthetase / Glutamine amidotransferase chain of NAD synthetase
           [Acidithiobacillus caldus ATCC 51756]
          Length = 548

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 227/553 (41%), Positives = 319/553 (57%), Gaps = 18/553 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IAIAQ N  VGD+AGN+ +  R    A   G +L++  EL + GYPPEDL+ +  F+ 
Sbjct: 1   MRIAIAQCNLWVGDVAGNVRRLLREAGAAREAGAELLITPELALCGYPPEDLLLRDDFLD 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
            C++ ++ L   T      ++VG P++    + N+  ++  G I+A   K  LPNY  F 
Sbjct: 61  CCATGLEDLARRTP---LPLLVGHPQRHGGALFNAASLVQEGRIVASYHKHCLPNYRVFD 117

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E R F +G     +    + +G+LICEDIW + +     +  GAE +  LNASPY+  K 
Sbjct: 118 ELRYFRAGQQAVVLPLGGVLVGVLICEDIWCDEDALTACQALGAEVVVVLNASPYHRGKQ 177

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           ++R E++  +  H  LP++Y N VGGQDEL+FDG SF  D + ++  +   FSE   + +
Sbjct: 178 REREELLVRRARHARLPLVYANAVGGQDELVFDGGSFAVDAEGRICGRAPQFSEDLLLLD 237

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
                  S        +A     PL++    Y A +L LRDYV+KN F  V++GLSGG+D
Sbjct: 238 LERSSTGSVVVRGGVTAA-----PLEDLAEVYGALMLGLRDYVEKNGFPGVVLGLSGGVD 292

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL  AIA DALG E V  +++P  YT+  S+EDA A A  LG +  +LPIH L   + +
Sbjct: 293 SALTLAIAADALGPERVDALIMPSPYTADMSIEDARAEAATLGVRSHLLPIHGLFAEYQN 352

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            + +      +    EN+Q+RIR  +LMA SN    +LLTT NKSE +VGY TLYGDM+G
Sbjct: 353 SLRETFAGRAADTTEENLQARIRAALLMAFSNKFGPLLLTTGNKSETAVGYSTLYGDMAG 412

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF  +KD  KT ++ LA +RN      G GP    IP  +L ++P+AEL P QTDQ+SLP
Sbjct: 413 GFALIKDCPKTLIYALARYRN------GRGP---AIPERVLTRAPTAELAPGQTDQDSLP 463

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP LD II   VE + S        +   TV  V  L+  +EYKRRQ   G +I+  SF
Sbjct: 464 PYPELDAIITAYVEEDRSLAEIVAAGHAPATVERVLRLVQMAEYKRRQGAPGVRISRLSF 523

Query: 544 GRDRLYPISNKFR 556
           G+DR YPI+N FR
Sbjct: 524 GKDRRYPITNGFR 536


>gi|134094248|ref|YP_001099323.1| NAD synthetase [Herminiimonas arsenicoxydans]
 gi|133738151|emb|CAL61196.1| glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Herminiimonas
           arsenicoxydans]
          Length = 537

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 232/557 (41%), Positives = 323/557 (57%), Gaps = 26/557 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF-I 63
           +K+AIAQ+N  VGD+AGN AK       A  QG D++L  EL + GYPPEDL+ ++SF  
Sbjct: 3   VKVAIAQINSTVGDLAGNRAKIAEFSRRAAEQGADIVLTPELSLVGYPPEDLLLRQSFYA 62

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           ++  +               +VVG P +      N+  +L  G I A   K +LPN + F
Sbjct: 63  KSAQALDALAADLAELKNLHVVVGHPFEKDGQRFNAASVLLNGKISATYCKHDLPNATVF 122

Query: 124 HEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            EKR F S   +  +VF  + +R GI ICED W            GA+ L   N SPY+ 
Sbjct: 123 DEKRYFSS--CDQAVVFDVKGVRFGINICEDTW-FPQAPARAAAAGAQVLLVPNGSPYHM 179

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
           NK   R +++   ++   + ++Y N VG QDELIFDG SF  D   +   Q++H  E   
Sbjct: 180 NKQHVRIDVMHANVTTHGMSLVYANLVGAQDELIFDGNSFVLDQAGETRAQLQHCVEDLQ 239

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           + E+   Q L            T+      E   Y A VL +RDY+ KN F   +IG+SG
Sbjct: 240 IVEFRGGQPLD----------GTIVEEPSVEAQVYKALVLGVRDYIGKNGFPGALIGMSG 289

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           G+DSAL  A+AVDALG + V+TIM+P  YT+  SL D+    + +G +YD + I+D    
Sbjct: 290 GVDSALTLAVAVDALGADKVRTIMMPSPYTAEISLLDSRDMVQRVGVRYDEIGINDCFEA 349

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F   ++   +  P     ENIQ+RIRG ILMALSN   A++LTT NKSE++VGY TLYGD
Sbjct: 350 FNRTLANEFKGLPEDATEENIQARIRGTILMALSNKHGAIVLTTGNKSEMAVGYCTLYGD 409

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGF  LKD+ KT V++L ++RNS         +++VIP  IL ++PSAELRP QTDQ+
Sbjct: 410 MAGGFAVLKDIAKTLVYRLCAYRNS---------VSDVIPERILTRAPSAELRPGQTDQD 460

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPY ILD I++  +E  +S  +     Y  E V  + HL+  +EYKRRQ+PVG ++T 
Sbjct: 461 SLPPYDILDAIMQMYMEENQSGADIIAAGYRAEDVARITHLIKINEYKRRQSPVGIRVTH 520

Query: 541 KSFGRDRLYPISNKFRD 557
           ++FGRD  YPI++KFR+
Sbjct: 521 RAFGRDWRYPITSKFRE 537


>gi|187929635|ref|YP_001900122.1| NAD synthetase [Ralstonia pickettii 12J]
 gi|309781599|ref|ZP_07676333.1| phenylalanyl-tRNA synthetase, beta subunit [Ralstonia sp.
           5_7_47FAA]
 gi|187726525|gb|ACD27690.1| NAD+ synthetase [Ralstonia pickettii 12J]
 gi|308919574|gb|EFP65237.1| phenylalanyl-tRNA synthetase, beta subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 545

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 230/566 (40%), Positives = 328/566 (57%), Gaps = 36/566 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           + +A+AQ+N  VGD AGN A+   A  EA++ G  ++L  EL ++GYPPEDL+ + +FI 
Sbjct: 3   VSVALAQINCTVGDFAGNAARIVAAAREAHQAGARILLTPELSLTGYPPEDLLLRPAFID 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFPRQDQE----GVL----NSVVILDAGNIIAVRDKI 115
           A + A+D L ++     G  +++G P+   E    GVL    NS  +   G ++   DK+
Sbjct: 63  ASARALDALIAELAAFPGLHVLIGHPQLSLEAPAPGVLPKPTNSATVALDGRVVGRYDKL 122

Query: 116 NLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFS 173
            LPN   F EKR F  G   +P VF     R G++ICED W  +             L  
Sbjct: 123 ELPNNEVFDEKRYFQPG--TEPFVFEVDGTRFGVIICEDAWYATATAYAKAAGAQVVLIP 180

Query: 174 LNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQM 233
            NASPY+ +K   R  I+  ++    LP +Y N VGGQDEL+FDG SF  D +  +  +M
Sbjct: 181 -NASPYHLDKEDLRERIIGARVKESGLPHVYANLVGGQDELVFDGGSFVLDAEGNVVLRM 239

Query: 234 KHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNF 292
             F E     ++   + L               +P    EA  Y A  L +RDY+ KN F
Sbjct: 240 GQFVEGVGYVQFDGGRALP-----------GTIVPEPPLEAQVYEALKLGVRDYLGKNGF 288

Query: 293 HKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDV 352
              IIGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA   A  LG +YD 
Sbjct: 289 PGAIIGLSGGVDSALVLAIAVDALGADRVRAVMMPSRYTADISWVDARDMAARLGVQYDE 348

Query: 353 LPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEIS 412
           + I  + + F   +++  +  P     ENIQ+RIRG +LMALSN S  ++LTT NKSEI+
Sbjct: 349 IAISPMFDAFKGALAEEFRGLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSEIA 408

Query: 413 VGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAE 472
           VGY TLYGDM+GGF  +KD++KT V++L  +RNS         L+EVIP  IL ++PSAE
Sbjct: 409 VGYCTLYGDMAGGFAVIKDIFKTLVYRLCRYRNS---------LSEVIPERILTRAPSAE 459

Query: 473 LRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQ 531
           LR +QTDQ+SLP Y  LD I++R +E  +   +     + +  V+ +  L+  +EYKRRQ
Sbjct: 460 LRENQTDQDSLPEYDALDAIVQRYMEQNQPVADIIAAGFAEADVQKIVRLIKINEYKRRQ 519

Query: 532 APVGTKITAKSFGRDRLYPISNKFRD 557
           APVG ++T ++FGRD  YPI+++F++
Sbjct: 520 APVGIRVTPRAFGRDWRYPITSRFKE 545


>gi|73748831|ref|YP_308070.1| glutamine-dependent NAD(+) synthetase [Dehalococcoides sp. CBDB1]
 gi|73660547|emb|CAI83154.1| glutamine-dependent NAD(+) synthetase [Dehalococcoides sp. CBDB1]
          Length = 566

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 229/575 (39%), Positives = 331/575 (57%), Gaps = 34/575 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + KL++A+AQ++ VVGD+AGN A      ++A   G D+I F EL I GYPPEDL+ K  
Sbjct: 1   MGKLRLAMAQIDSVVGDLAGNTACIVSHVQKARSLGADVIAFPELAICGYPPEDLLHKPR 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++    A+D +   +   G  ++VG+     +G+ N+  I+  G++I    KI LPNY 
Sbjct: 61  FVEENLQALDAVIKASQ--GITVIVGY-VDSHDGLRNAAAIIHNGSLIDSYHKIFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F+ G          +++G+ ICEDIW  S        +GAE + +++ASPY+ 
Sbjct: 118 VFDENRYFLPGNRCPVYTICGLQVGVNICEDIWFTSGPSTAQANKGAELIINISASPYHF 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K  +R ++++ +     + I Y N VGGQDEL+FDGAS  FD    L  + K F E   
Sbjct: 178 GKRNQREKMLSDRARENRVYIAYTNMVGGQDELVFDGASDVFDYNGNLLIRGKQFQEDLV 237

Query: 242 MTEWHYDQQLSQWN---------YMSDDSASTM--------YIPLQEEEADYNACVLSLR 284
           + +        Q +         ++S     T+        + PL+ +   Y A +L  R
Sbjct: 238 VLDLDIPVLPRQADTNANVPDSIFVSSAGFETLKPPIENIAFTPLEADAEVYQALLLGTR 297

Query: 285 DYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAK 344
           DY+ KN F KV+IGLSGGIDS+L A IA DALG ENV  +++P +Y+S  S+ D+   A 
Sbjct: 298 DYINKNGFKKVVIGLSGGIDSSLVATIAADALGPENVVGVIMPSRYSSEGSISDSLHLAG 357

Query: 345 ALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLT 404
            LG K   +PI  L   F + +S       +    ENIQ+RIRGN+LMALSN    ++L 
Sbjct: 358 NLGIKTLQIPIDPLFQSFLNTLSDVFAGTEANTTEENIQARIRGNLLMALSNKFHWLVLN 417

Query: 405 TSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSI 464
           TSNKSE ++GY TLYGDM+GGF  +KD+ K  V++L   RN     +G     ++IP ++
Sbjct: 418 TSNKSETAIGYSTLYGDMAGGFAIIKDVPKVLVYRLVHNRNK---LAGF----DLIPNNV 470

Query: 465 LEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ----EYNDETVRYVEH 520
           L K PSAEL+P+Q D +SLPPY +LD I++  VE ++S    DQ     +  + V+ V  
Sbjct: 471 LAKPPSAELKPNQLDTDSLPPYEVLDPILEAYVEQDKSI---DQIVALGFAADIVKRVVK 527

Query: 521 LLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           ++  SEYKRRQAP G KIT K+FGRDR  PI+N++
Sbjct: 528 MVDRSEYKRRQAPPGIKITPKAFGRDRRLPITNRY 562


>gi|241764805|ref|ZP_04762812.1| NAD+ synthetase [Acidovorax delafieldii 2AN]
 gi|241365682|gb|EER60394.1| NAD+ synthetase [Acidovorax delafieldii 2AN]
          Length = 552

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 234/566 (41%), Positives = 329/566 (58%), Gaps = 31/566 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
             I  AQLN VVGD+ GN  K   A  +A+ QG  L+L  EL + GY  EDL  + +F+ 
Sbjct: 3   FSICTAQLNFVVGDMPGNAQKIIAAARQAHAQGARLLLTPELAVCGYAAEDLFLRPAFMA 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFPRQDQ------EGVLNSVVILDAGNIIAVRDKINL 117
           AC  A+ T+  +T    G  IV+G P++           LN+  +L  G +     K  L
Sbjct: 63  ACDDAVKTVARETAGLNGLVIVLGHPQKRTPADPAFSACLNAASVLRHGKVEQTYAKHEL 122

Query: 118 PNYSEFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLN 175
           PNY  F E+R F++G S  P VF    +++G+LICED W  S   +   + GA+ L  +N
Sbjct: 123 PNYQVFDERRYFVAGQS--PCVFDVEGVKVGLLICEDAW-FSEPARAAAQAGAQLLAVIN 179

Query: 176 ASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKH 235
           ASP++  K  +R + +  +++   LP++Y + VGGQDE++F+G SF  +    +A +   
Sbjct: 180 ASPFHLGKSAEREQTMRERVAETGLPLVYAHLVGGQDEVVFEGRSFALNADGSVAARAPG 239

Query: 236 FSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHK 294
           F E+    +    Q   +     +        P +  EAD ++A VL +RDYV KN F  
Sbjct: 240 FQEKLVFAQIGRAQDAIKIEAEIE--------PERSLEADLWDALVLGVRDYVGKNGFPG 291

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
            ++GLSGGIDSAL  AIAVDALG + V+T+M+P  YT+  S  DA   A  +G +YD + 
Sbjct: 292 ALLGLSGGIDSALVLAIAVDALGADKVRTVMMPSPYTADISWIDARDMAARMGVRYDEIS 351

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I      F + ++      P     EN+Q+RIRG +LMALSN   A++LTT NKSE++ G
Sbjct: 352 IAPQFEAFKAALASEFAGLPEDTTEENLQARIRGTLLMALSNKFGAIVLTTGNKSEMATG 411

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG-ITSGLGPLTEVIPPSILEKSPSAEL 473
           Y TLYGDM+GGF P+KD+ KT+VF LA WRN++    +G  P    IP  I+ + PSAEL
Sbjct: 412 YCTLYGDMAGGFAPIKDVAKTRVFALARWRNANDPYGTGASP----IPERIITRPPSAEL 467

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRR 530
           RP Q DQ+SLP Y +LD I+ R +EN+   ES I    E  D  V  V  L+  +EYKRR
Sbjct: 468 RPDQKDQDSLPAYEVLDAIVARYMENDEPIESIIAAGYERAD--VERVTRLIKLNEYKRR 525

Query: 531 QAPVGTKITAKSFGRDRLYPISNKFR 556
           QAPVG ++T +SFG+D  YPI++KFR
Sbjct: 526 QAPVGVRVTRRSFGKDWRYPITSKFR 551


>gi|152979996|ref|YP_001352840.1| NAD synthetase [Janthinobacterium sp. Marseille]
 gi|151280073|gb|ABR88483.1| NAD+ synthase (glutamine-hydrolysing) [Janthinobacterium sp.
           Marseille]
          Length = 537

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 227/557 (40%), Positives = 326/557 (58%), Gaps = 26/557 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF-I 63
           +K+AIAQ+N  VGD+AGN A+       A  QG D++L  EL + GYPPEDL+ ++SF  
Sbjct: 3   VKVAIAQINSTVGDLAGNRARIAEFSRRAAEQGADIVLTPELSLVGYPPEDLLLRQSFYA 62

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +   + +          G  +VVG P +      N+  +L  G +     K +LPN + F
Sbjct: 63  KTTETLLALAADLAPLHGLHVVVGHPFEQDGQRYNAASVLLNGKVAGTYCKHDLPNATVF 122

Query: 124 HEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            EKR F S   ++P+VF  + +R GI ICED W   +      + GA+ L   N SP++ 
Sbjct: 123 DEKRYFTS--VDEPLVFEVKGVRFGINICEDTW-FPHAPARAAEAGAQVLLVPNGSPFHM 179

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
           NK   R +++   ++   + ++Y N VGGQDELIFDG SF  D   ++  Q++H  E   
Sbjct: 180 NKQHLRVDVMHANVTVHGMSLVYANLVGGQDELIFDGNSFVLDQAGEIRAQLQHCVEDLQ 239

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           + E+   Q +            T+   L  E   Y A VL +RDY+ KN F   +IG+SG
Sbjct: 240 IIEFQGGQPVD----------GTIVEELSVEAQVYKALVLGVRDYIGKNGFPGALIGMSG 289

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           G+DSAL  A+AVDALG + V+ IM+P  YT+  S  D+    K +G +YD + I+D    
Sbjct: 290 GVDSALTLAVAVDALGADKVRAIMMPSPYTAEISWVDSRDMVKRVGVRYDEIGINDCFEA 349

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F   ++   +        ENIQ+RIRG ILMALSN   A++LTT NKSE++VGY TLYGD
Sbjct: 350 FNRTLANEFKGLKQDTTEENIQARIRGTILMALSNKHGAIVLTTGNKSEMAVGYCTLYGD 409

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGF  LKD+ KT V++L ++RN          +++VIP  IL ++PSAELRP QTDQ+
Sbjct: 410 MAGGFAVLKDIAKTLVYRLCAYRNI---------VSDVIPERILTRAPSAELRPDQTDQD 460

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPY +LD I++  +E  +S +      Y  E V  + HL+  +EYKRRQ+PVG ++T 
Sbjct: 461 SLPPYEVLDAIMQMYMEENQSGVEIIAAGYRPEDVARITHLIKINEYKRRQSPVGIRVTH 520

Query: 541 KSFGRDRLYPISNKFRD 557
           ++FGRD  YPI++KFR+
Sbjct: 521 RAFGRDWRYPITSKFRE 537


>gi|317121464|ref|YP_004101467.1| NH(3)-dependent NAD(+) synthetase [Thermaerobacter marianensis DSM
           12885]
 gi|315591444|gb|ADU50740.1| NH(3)-dependent NAD(+) synthetase [Thermaerobacter marianensis DSM
           12885]
          Length = 617

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 230/615 (37%), Positives = 335/615 (54%), Gaps = 68/615 (11%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IAIAQ+N  VGD+ GN  K      EA R G DL++F EL ++GYPPEDL+F+ +F+ 
Sbjct: 9   LRIAIAQVNSTVGDLEGNARKLAAFAAEAARAGADLVVFPELALTGYPPEDLIFRPAFLA 68

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
                +  L      G   +V GF  +D++ + N+  +L  G + AV  K  LPNY  F 
Sbjct: 69  ESGRWLQWLAGQLAAGPVALV-GFVHRDRD-LYNAAAVLQGGRVRAVACKRFLPNYGVFD 126

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLK-KQGAEFLFSLNASPYYHNK 183
           E+R F  G+    +    + LG+ ICED+W      +      GAE L +L+ASPY+  K
Sbjct: 127 EERYFAPGHRALVLRLAGVTLGVSICEDLWYPEGPTREQALAGGAEILVNLSASPYHAGK 186

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
            ++R  ++  + + + + I+Y N VGGQDEL+FDG S       ++A + + F+E   + 
Sbjct: 187 PRERESLMVTRATDLGVAIVYANLVGGQDELVFDGNSLVVTAAGEVAARGRPFAEDLIL- 245

Query: 244 EWHYDQQLS--------QWNYM---SDDSASTMYIPLQ---------------------- 270
            W YD + +        +W +M     ++A    + L                       
Sbjct: 246 -WDYDPEAAAVARWHEPRWRHMPATEQEAARVERVDLDGAAAGGAAPGPATGGATAQAVE 304

Query: 271 ---------------------EEEAD-YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALC 308
                                E EA+ Y A VL++RDY  KN   +  +GLSGGIDSAL 
Sbjct: 305 PAGGGPRPPKPPLPPRQVEVLEGEAEIYAALVLAVRDYFGKNRIGRAWLGLSGGIDSALV 364

Query: 309 AAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQ 368
           A +A DALG E V  + +P  +TS +SL+DA A A+ LG   + +PI  + + F   ++ 
Sbjct: 365 ACLAADALGPERVTGVRMPSPFTSEESLQDAEAVARNLGIGLETIPIAGVFDAFRQALAP 424

Query: 369 FLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNP 428
                   +  EN+Q+RIRG +LMAL+N    ++L T NKSE++ GY TLYGDM+GGF P
Sbjct: 425 LFGGRSFDVAEENLQARIRGTLLMALANKFGGIVLATGNKSELATGYATLYGDMAGGFAP 484

Query: 429 LKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPI 488
           LKD+ KT V++LA++RN         P   VIP S+L K+P+AELRP Q D++SLPPY +
Sbjct: 485 LKDVPKTLVYRLAAYRNGW-------PGGPVIPESVLRKAPTAELRPGQKDEDSLPPYAV 537

Query: 489 LDDIIKRIVENE-ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDR 547
           LD I++  VE +  +     + +    V    HL+  SEYKRRQA  G KIT ++FGRDR
Sbjct: 538 LDPILEAYVEKDVPAATLVARGHPAGAVARAVHLVRASEYKRRQAAPGPKITTRAFGRDR 597

Query: 548 LYPISNKFRDHISEE 562
            YPI+N FR+ + +E
Sbjct: 598 RYPITNGFREPVPQE 612


>gi|299066056|emb|CBJ37237.1| putative nh3-dependent nad+ synthetase (nadE) [Ralstonia
           solanacearum CMR15]
          Length = 565

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 227/568 (39%), Positives = 325/568 (57%), Gaps = 43/568 (7%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           +A+AQ+N  VGD+AGN A+   A  EA++ G  +++  EL ++GYPPEDL+ + +F+ A 
Sbjct: 24  VALAQINCTVGDLAGNAARIVAAAREAHQAGARILVTPELSLTGYPPEDLLLRPAFLDAA 83

Query: 67  SSAIDTLKSDTHD-GGAGIVVGFPRQDQEGV---------LNSVVILDAGNIIAVRDKIN 116
           S A+D L ++     G  +++G P+   E            N+  +   G ++    K+ 
Sbjct: 84  SRALDALVAELAAFAGLHVLIGHPQLLFEAPAPGSALPKPTNTATVAVDGRVLGQYHKLE 143

Query: 117 LPNYSEFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSL 174
           LPN   F EKR F  G   +P VF     R G+++CED W                L   
Sbjct: 144 LPNNEVFDEKRYFQVG--GEPFVFDVEGTRFGVIVCEDAWYPQATAWAKAAGAQVVLIP- 200

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           NASPY+ +K   R +I+  ++    LP +YVN VGGQDEL+FDG SF  D   + A +M 
Sbjct: 201 NASPYHLDKEDLREQIIGARVQESGLPHVYVNLVGGQDELVFDGGSFVLDAHGKPAVRMA 260

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTM---YIPLQEEEAD-YNACVLSLRDYVQKN 290
            F E                 Y+  D A  +     P    EA  Y A  L +RDY+ KN
Sbjct: 261 QFVEG--------------VGYVRFDGARPLPGEIAPEATLEAQVYEALKLGVRDYIGKN 306

Query: 291 NFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKY 350
            F   IIGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA      LG +Y
Sbjct: 307 GFPGAIIGLSGGVDSALVLAIAVDALGADRVRAVMMPSRYTADISWLDARDMVARLGVRY 366

Query: 351 DVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSE 410
           D LPI  + + F   +S+  ++ P     ENIQ+RIRG +LMALSN S  ++LTT NKSE
Sbjct: 367 DELPIMPMFDAFRGALSEEFRDLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSE 426

Query: 411 ISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPS 470
           ++VGY TLYGDM+GGF  +KD++KT V++L  +RN+         L+EVIP  IL ++PS
Sbjct: 427 MAVGYCTLYGDMAGGFAVIKDIFKTLVYRLCRYRNA---------LSEVIPERILTRAPS 477

Query: 471 AELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKR 529
           AELR +QTDQ+SLP Y  LD I++R +E  +         + +  V+ +  L+  +EYKR
Sbjct: 478 AELRENQTDQDSLPEYDALDAIVQRYMEQNQPVAEIIAAGFAEADVQKIVRLIKINEYKR 537

Query: 530 RQAPVGTKITAKSFGRDRLYPISNKFRD 557
           RQAPVG ++T ++FGRD  YPI+++F++
Sbjct: 538 RQAPVGIRVTQRAFGRDWRYPITSRFKE 565


>gi|149176976|ref|ZP_01855585.1| NAD+ synthetase [Planctomyces maris DSM 8797]
 gi|148844231|gb|EDL58585.1| NAD+ synthetase [Planctomyces maris DSM 8797]
          Length = 558

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 232/572 (40%), Positives = 340/572 (59%), Gaps = 38/572 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQLNP VGD++GN  K       A + G+DL+LF EL + GYPP+D++ ++ FI+
Sbjct: 1   MKIALAQLNPTVGDLSGNCQKILETVNRAEQSGVDLVLFPELVLCGYPPKDILLREGFIE 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFP--RQDQEG-VLNSVVILDAGNIIAVRDKINLPNYS 121
           AC  A+D L +  +    G+V+G P  R   +G + N+  +L  G I +   K+ LPNY 
Sbjct: 61  ACDHAVDRLAAQLNPD-IGVVIGHPTGRDLPQGRIANAASLLFQGKIDSQIHKLLLPNYD 119

Query: 122 EFHEKRTFISGYSND--PIVFRDIRLGILICEDIWKNS-------------NICKHLKKQ 166
            F E+R F         P+ FR+++LG+ ICED W                +  K L + 
Sbjct: 120 VFDEQRYFRHADLKQIKPVSFRELKLGLHICEDAWWGQADTFYHNQPFELPDPVKILAEA 179

Query: 167 GAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQ 226
           G++ L +++ASP+  +K K+R EIV        +P ++VNQVGG D+L+FDG SF  D  
Sbjct: 180 GSDLLVNISASPFEIDKRKRRGEIVGAHRDRYSIPYLFVNQVGGNDDLVFDGHSFVMDAA 239

Query: 227 QQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDY 286
             L  QM  F E   +  +   Q + +    SDD        L  EE  + A VL LRDY
Sbjct: 240 GDLVLQMPGFRED--LQFYETGQSVDRGPGESDD--------LSREEQLFEALVLGLRDY 289

Query: 287 VQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKAL 346
           +QK  F   ++GLSGGIDSAL  AIA +A+G E V  ++LP +Y+S  S+ D+   A+ L
Sbjct: 290 IQKCGFTDCVLGLSGGIDSALACAIAAEAIGPERVHALLLPSRYSSDHSVADSLELAENL 349

Query: 347 GCKYDVLPIHDLVNHFFSL--MSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLT 404
           G  Y+ +PI  +   F +L  +   L+ EP+G+  +N+Q+RIRG  +M  SN    M L 
Sbjct: 350 GLDYETIPIDSVHLAFENLPVIGDDLKLEPAGLADQNLQARIRGANVMVRSNQHGWMALA 409

Query: 405 TSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSI 464
           T NKSE+++GY TLYGDM+GGF  L D++K  V+++A + N        G +  VIP +I
Sbjct: 410 TGNKSELAMGYCTLYGDMAGGFAVLSDVFKCDVYRVARYVNQRA-----GRI--VIPENI 462

Query: 465 LEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYG 524
           LEK+PSAEL P+Q DQ+SLPPY +LD I+K ++E+E S  +  +EY  ETVR+V   L  
Sbjct: 463 LEKAPSAELAPNQVDQDSLPPYDLLDGILKGLIEDERSVKSLSKEYPPETVRWVAGRLDR 522

Query: 525 SEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           +E+KRRQ P G K++A++FG  R  P++ +F+
Sbjct: 523 NEFKRRQMPPGIKLSARAFGSGRRMPMAARFQ 554


>gi|17547066|ref|NP_520468.1| NAD synthetase [Ralstonia solanacearum GMI1000]
 gi|17429367|emb|CAD16054.1| probable nh3-dependent nad+ synthetase signal peptide protein
           [Ralstonia solanacearum GMI1000]
          Length = 546

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 227/568 (39%), Positives = 326/568 (57%), Gaps = 43/568 (7%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           +A+AQ+N  VGD+AGN A+   A  EA++ G  +++  EL ++GYPPEDL+ + +F+ A 
Sbjct: 5   VALAQINCTVGDLAGNAARIVAAAREAHQAGARILVTPELSLTGYPPEDLLLRPAFLDAA 64

Query: 67  SSAIDTLKSDTHD-GGAGIVVGFPRQDQEGV---------LNSVVILDAGNIIAVRDKIN 116
           S A+D L ++     G  +++G P+   E            N+  +   G ++    K+ 
Sbjct: 65  SRALDALVAELAAFAGLHVLIGHPQLLFEAPAPGSALPKPTNTATVAVDGRVLGQYHKLE 124

Query: 117 LPNYSEFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSL 174
           LPN   F EKR F  G   +P VF     R G+++CED W                L   
Sbjct: 125 LPNNEVFDEKRYFQVG--GEPFVFDVEGTRFGVILCEDAWYPKATAWAKAAGAQVVLIP- 181

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           NASPY+ +K   R +I+  ++    LP +YVN VGGQDEL+FDG SF  D   + A +M 
Sbjct: 182 NASPYHLDKEDLREQIIGARVQESGLPHVYVNLVGGQDELVFDGGSFVLDAHGKPAARMA 241

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTM---YIPLQEEEAD-YNACVLSLRDYVQKN 290
            F E                 Y+  D A  +     P    EA  Y A  L +RDY+ KN
Sbjct: 242 QFVEG--------------VGYVRFDGARPLPGEIAPEATLEAQVYAALKLGVRDYIGKN 287

Query: 291 NFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKY 350
            F   IIGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA   A  LG +Y
Sbjct: 288 GFPGAIIGLSGGVDSALVLAIAVDALGADRVRAVMMPSRYTADISWLDARDMAARLGVRY 347

Query: 351 DVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSE 410
           D LPI  + + F   +++  ++ P     ENIQ+RIRG +LMALSN S  ++LTT NKSE
Sbjct: 348 DELPIMPMFDAFRGALAEEFRDLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSE 407

Query: 411 ISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPS 470
           ++VGY TLYGDM+GGF  +KD++KT V++L  +RN+         L+EVIP  IL ++PS
Sbjct: 408 MAVGYCTLYGDMAGGFAVIKDIFKTLVYRLCRYRNA---------LSEVIPERILTRAPS 458

Query: 471 AELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKR 529
           AELR +QTDQ+SLP Y  LD I++R +E  +         + +  V+ +  L+  +EYKR
Sbjct: 459 AELRENQTDQDSLPEYDALDAIVQRYMEQNQPVAEIIAAGFAEADVQKIVRLIKINEYKR 518

Query: 530 RQAPVGTKITAKSFGRDRLYPISNKFRD 557
           RQAPVG ++T ++FGRD  YPI+++F++
Sbjct: 519 RQAPVGIRVTQRAFGRDWRYPITSRFKE 546


>gi|326316969|ref|YP_004234641.1| NAD+ synthetase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323373805|gb|ADX46074.1| NAD+ synthetase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 550

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 234/562 (41%), Positives = 327/562 (58%), Gaps = 29/562 (5%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           I+IAQ N +VGD+ GN  K   A  EA+ QG  L+L  EL + GY  EDL  + +F+ AC
Sbjct: 5   ISIAQFNFIVGDVEGNARKIISAAHEAHAQGAALLLTPELALCGYAAEDLFLRPAFLDAC 64

Query: 67  SSAI-DTLKSDTHDGGAGIVVGFPRQDQEG----VLNSVVILDAGNIIAVRDKINLPNYS 121
             A+ D  ++ +  G   +VVG P +   G      N+  +L  G I     K  LPNY+
Sbjct: 65  DRALQDIAQATSACGDLAVVVGHPWRSVAGGAERCHNAASVLRGGRIEQTYAKQELPNYA 124

Query: 122 EFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
            F E+R F  G    P VF  + +R+G+LICED W      +  +   A+ L +LNASP+
Sbjct: 125 VFDEQRYFDPG--TQPCVFDVQGVRVGLLICEDAWFPGPAARAAQAG-AQLLATLNASPF 181

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           +  K  +R +I+  +++   LP++Y + VGGQDE++F+G SF  D    +  +   F+E 
Sbjct: 182 HLGKSAEREQIMRERVAETGLPLVYAHLVGGQDEVVFEGRSFALDANGFVGVRAPGFTEA 241

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIG 298
                 H    + ++     D A     P+   EAD ++A VL +RDYV KN F  V++G
Sbjct: 242 LVRVVAHAGDGVLRFE---PDVA-----PIPAPEADLWSALVLGVRDYVGKNGFPGVLLG 293

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL  AIAVDALG + V+ +M+P  YT+  S  DA   A+ LG +YD + I   
Sbjct: 294 LSGGIDSALVLAIAVDALGADKVRAVMMPSPYTADISWIDARDMAERLGVRYDEIAIAPQ 353

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
              F + ++            EN+Q+RIRG +LMALSN   +++LTT NKSE++ GY TL
Sbjct: 354 FEAFKAALASEFAGRAEDATEENLQARIRGTLLMALSNKFGSVVLTTGNKSEMATGYCTL 413

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHG-ITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           YGDM+GGF  +KD+ KT V+ LA WRN+H    +G  P    IP  I+ + PSAELRP Q
Sbjct: 414 YGDMAGGFAVIKDVAKTAVYGLARWRNAHDPFGTGASP----IPERIITRPPSAELRPDQ 469

Query: 478 TDQESLPPYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPV 534
            DQ+SLPPY +LD I+ R +EN+   ES I     Y    V  V  L+  +EYKRRQAPV
Sbjct: 470 KDQDSLPPYDVLDAIVGRYMENDEPIESIIAAG--YARADVERVTRLIQVNEYKRRQAPV 527

Query: 535 GTKITAKSFGRDRLYPISNKFR 556
           G ++T +SFG+D  YPI+N+FR
Sbjct: 528 GIRVTRRSFGKDWRYPITNRFR 549


>gi|206602425|gb|EDZ38906.1| NAD+ synthase [Leptospirillum sp. Group II '5-way CG']
          Length = 592

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 233/602 (38%), Positives = 335/602 (55%), Gaps = 57/602 (9%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           ++KLK+A+AQ NP+VGDI+GN+A  +    +A  + +D+++F EL ++GYPPEDL+ K S
Sbjct: 1   MRKLKLALAQTNPIVGDISGNLAHIKDMIVQARSEHVDVVVFPELALTGYPPEDLLLKPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI     A+D L     +    ++VGF  + Q+ + N+  +L  G +  +  K  LPNY 
Sbjct: 61  FIDKNLRALDELLGFAPE--LLVLVGFVDR-QDDIYNAAAVLHGGKLHGIYRKQYLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG-AEFLFSLNASPYY 180
            F E R F  G  +  + +R  RLGI ICEDIW            G AE + +L+ASP++
Sbjct: 118 VFDENRYFQEGVESPVLEYRSARLGINICEDIWYPKGPLYTQTLMGDAECILNLSASPFH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R  ++  +       I YVN VGGQDEL+FDG S       ++  + K F E  
Sbjct: 178 AGKREVRENMLCTRAVDSACYIAYVNMVGGQDELVFDGQSLVISPDGEIESRGKAFQEDL 237

Query: 241 FMTE-----------------------------WHYDQQLSQWNY----MSDDSASTM-- 265
            +TE                             W+ D  L +W          S  T+  
Sbjct: 238 LITEIDLDHVFRVRLHDPRRRKDRLSQSLDRPQWNQDDVLVRWKIEEPGRRQASGGTLPE 297

Query: 266 ---------YIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDAL 316
                      PL      Y A V  +RDYV+KN+F +V++GLSGGIDSAL AAIA DAL
Sbjct: 298 KKVLVKSPYTQPLDRLAEIYEALVTGVRDYVRKNSFREVLVGLSGGIDSALVAAIATDAL 357

Query: 317 GKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSG 376
           G E+V  + +P  +TS +S ED    +  L  + + +PI      F  ++S   Q+ P  
Sbjct: 358 GPEHVHGLFMPSMFTSQESYEDVLKLSGTLKVQVETIPIAAAFEQFLQILSPHFQDRPRD 417

Query: 377 IVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQ 436
              EN+QSRIRG +LMALSN    ++LTT NKSE+SVGY TLYGDM+GGF+ LKD+ KT 
Sbjct: 418 TAEENLQSRIRGLLLMALSNKFHWLVLTTGNKSEMSVGYQTLYGDMAGGFSVLKDVPKTL 477

Query: 437 VFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRI 496
           V+ LA + N+           ++IP  I+EK+P+AELRP+Q D +SLPPY ILD I++  
Sbjct: 478 VYDLADFLNTRR--------ADIIPHRIIEKAPTAELRPNQKDLDSLPPYEILDPIMEAY 529

Query: 497 VENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           VE+++ F     + ++  TV  V  L+  SEYKRRQ+P G K+T ++FG+D   PI+N+F
Sbjct: 530 VEDDQGFEEIIGKGFDPATVARVLSLIDKSEYKRRQSPPGIKLTLRAFGKDWRVPITNRF 589

Query: 556 RD 557
           ++
Sbjct: 590 KE 591


>gi|254497097|ref|ZP_05109918.1| glutamine dependent NAD+ synthetase [Legionella drancourtii LLAP12]
 gi|254353677|gb|EET12391.1| glutamine dependent NAD+ synthetase [Legionella drancourtii LLAP12]
          Length = 525

 Score =  395 bits (1015), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 233/552 (42%), Positives = 322/552 (58%), Gaps = 31/552 (5%)

Query: 9   IAQLNPVVGDIAGNIAKARR--AREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           +AQ NP VGD+  N A+      +++A+    DLI+F EL ++GYPPEDL+F+K F QA 
Sbjct: 1   MAQTNPTVGDLTANRAQIIEIIKKKQADH---DLIIFPELALTGYPPEDLLFRKEFHQAV 57

Query: 67  SSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEK 126
           S  +  +++ T+D    +++G P  DQ+   NS+ IL  G II    K NLPNY  F E 
Sbjct: 58  SENLKQIQAVTND--CYVLIGHPSVDQKNCYNSLSILHDGKIITQYQKQNLPNYEVFDET 115

Query: 127 RTFISGYSNDPIV-FRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLK 185
           R F  G  N  ++  ++  +GI ICED W+   + + L   GA  + S+NASP+  +K +
Sbjct: 116 RYFTPGPKNPCLLNIKNYSIGICICEDAWRLGPV-EDLITNGASIIVSINASPFDISKYQ 174

Query: 186 KRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEW 245
           KR  ++     H  + +IYVNQ+GGQDEL+FDG S   D Q  +  +   F E     E 
Sbjct: 175 KRETLLKSHAQH-GVAVIYVNQIGGQDELLFDGQSLAMDHQGTICARAPAFKEDLCTIEI 233

Query: 246 HYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDS 305
                  +   +S  +A      L +E+  Y A V   +DYV KN+F  V++GLSGGIDS
Sbjct: 234 -------EGKKLSGPTAPL----LSKEQLLYEALVCGTKDYVNKNHFPGVLLGLSGGIDS 282

Query: 306 ALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSL 365
           AL  A+AVDALG E V  +++P +YT+  S EDA    + LG  + +L I    N   + 
Sbjct: 283 ALTLAVAVDALGAERVHAVLMPSRYTADISYEDAIKELEILGVSHSLLSIEPAFNTLMTT 342

Query: 366 MSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGG 425
           +       P     ENIQ+RIRG +LMA+SN S  M+LTTSNKSE +VGY TLYGDM GG
Sbjct: 343 LEPVFSGLPMDTTEENIQARIRGLLLMAMSNKSGNMVLTTSNKSESAVGYATLYGDMCGG 402

Query: 426 FNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPP 485
           F  LKD+ KT+V+ LA +RNS         L EVIP  ++ ++PSAELR +QTDQ+SLP 
Sbjct: 403 FGILKDVLKTEVYALARYRNS---------LAEVIPERVITRAPSAELRENQTDQDSLPE 453

Query: 486 YPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFG 544
           Y +LD II   +E   S     Q+ +  E V  V  L+  +EYKRRQA  G KI+  +FG
Sbjct: 454 YEVLDAIIVAYMEKNLSPAEIIQQGFKAEDVTRVIQLIKRNEYKRRQAAPGIKISPMAFG 513

Query: 545 RDRLYPISNKFR 556
           +D  YPI+N F+
Sbjct: 514 KDWRYPITNGFK 525


>gi|297544156|ref|YP_003676458.1| NAD+ synthetase [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
 gi|296841931|gb|ADH60447.1| NAD+ synthetase [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
          Length = 543

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 228/565 (40%), Positives = 326/565 (57%), Gaps = 36/565 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQ+NPVVGDI GN  K       A  Q  DL++F EL   GYPP+D +F + F++
Sbjct: 1   MKIALAQINPVVGDIKGNFEKIVEFINRAKYQKADLVVFPELATVGYPPKDFLFMQDFLK 60

Query: 65  ACSSAIDTLK-SDTHDGGAGIVVGFPRQDQEGVL-NSVVILDAGNIIAVRDKINLPNYSE 122
           A    I+ +    T+    G+++G  RQD EG L NS   +  G I+ V DK  LPNY  
Sbjct: 61  ANEKYINEIVLPATYQ--IGVILGTVRQDTEGNLYNSAFFIYDGKIVEVFDKTLLPNYDV 118

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKN----------SNICKHLKKQGAEFLF 172
           F EKR F          F+ I+LG+ ICEDIWK+           ++ +   K   +   
Sbjct: 119 FDEKRYFKPAQLRKVASFKGIKLGVNICEDIWKDYVFEPNVDYSVDVLEEQYKLKPDIFI 178

Query: 173 SLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQ 232
           +++ASPYY  K   R E++  +I    +P IYVNQVG  DELIFDG+SF  + + +   Q
Sbjct: 179 NISASPYYLGKQNMRVEMIEKKIKKYAIPFIYVNQVGANDELIFDGSSFVVNEEGKRVVQ 238

Query: 233 MKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNF 292
           +K F E   + +    +   +   M +D +             YNA VL +RDY +K+ F
Sbjct: 239 LKAFEEDIKIVDIDELKNFKELPEMKEDISWV-----------YNALVLGVRDYCKKSGF 287

Query: 293 HKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDV 352
            K ++GLSGGIDSA+  AIAV+ALGKENV  + +P +Y+S  S  DA   A+ LG ++ V
Sbjct: 288 KKAVVGLSGGIDSAVVCAIAVEALGKENVLAVSMPSRYSSEGSKSDARILAENLGIEFRV 347

Query: 353 LPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEIS 412
           +PI  +   + S+ +         +  ENIQ+RIRGN LM +SN    ++LTT NKSE++
Sbjct: 348 IPIEPVFESYLSVFNG-DNSAIGDLAEENIQARIRGNYLMFISNREGHIVLTTGNKSELA 406

Query: 413 VGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAE 472
           +GY TLYGDMSG   P+ D+ KT V++LA + N            E+IP SI+EK+PSAE
Sbjct: 407 MGYCTLYGDMSGSLAPIADVPKTMVYELAKYINRK---------KEIIPISIIEKAPSAE 457

Query: 473 LRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQ 531
           LRP+Q D++SLPPY ILD+I+K  +E   S     ++ Y+++ V+ V + +   EYKR+Q
Sbjct: 458 LRPNQKDEDSLPPYKILDEILKMYIEENRSVKEIVEKGYDEKLVKDVINKVNRVEYKRKQ 517

Query: 532 APVGTKITAKSFGRDRLYPISNKFR 556
           A    K+T K+FG  R  PI + F+
Sbjct: 518 AAPVLKVTTKAFGIGRRMPIVHNFK 542


>gi|255318866|ref|ZP_05360092.1| glutamine-dependent NAD+ synthetase [Acinetobacter radioresistens
           SK82]
 gi|262378876|ref|ZP_06072033.1| glutamine-dependent NAD+ synthetase [Acinetobacter radioresistens
           SH164]
 gi|255304122|gb|EET83313.1| glutamine-dependent NAD+ synthetase [Acinetobacter radioresistens
           SK82]
 gi|262300161|gb|EEY88073.1| glutamine-dependent NAD+ synthetase [Acinetobacter radioresistens
           SH164]
          Length = 541

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 229/566 (40%), Positives = 330/566 (58%), Gaps = 33/566 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  KIA+AQ +P  G+   N  K      EA +Q  D+I+F EL   GY  EDL+ + S
Sbjct: 1   MKSFKIALAQFSPHTGNFELNAQKMVEQANEAKKQRADIIVFPELCTVGYSAEDLLLRPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
             +      + L     D    +V GF  Q + G   NS  ++  G ++ V +K NLPNY
Sbjct: 61  LSKRTQKVFEIL-GQVKD--IVMVFGFVNQAETGQRYNSAAVVKDGQVLGVYNKQNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDI--RLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           S F EKR F SG  N  +VF  +  +  +LICEDIW + N  + L +  A+ +  LN+SP
Sbjct: 118 SVFDEKRYFASG--NQQLVFEYMEHKFAVLICEDIW-SINTVQQLTQLKAQTVLVLNSSP 174

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K + R + +   +  ++  ++YVNQV GQD++IFDG+SF  + Q +L  +   F E
Sbjct: 175 YEVGKPQHRIQTMQQLVKQLNFNLVYVNQVCGQDDIIFDGSSFVLNPQGELVTRAPSFQE 234

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
                E+  D+       ++ +  +   I        Y A V++ RDY+Q++ F  VI+G
Sbjct: 235 CLHYAEYSADKDAFIVQEIAPELDTMAEI--------YQALVMATRDYIQRSGFPGVILG 286

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL  AIAVDA+G + VQ +M+PY YT+  S+EDAAA AK +G  + +  I+ +
Sbjct: 287 LSGGIDSALTLAIAVDAIGADKVQAVMMPYTYTAQISVEDAAAQAKTMGVTFGIAEINPI 346

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           VN F   +  F    P+    EN+Q+R RG +LMALSN    ++L+T NKSE++VGY TL
Sbjct: 347 VNGFLQTLYPFFGNSPADTTEENLQARARGTLLMALSNKFGNLVLSTGNKSEVAVGYCTL 406

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTE--VIPPSILEKSPSAELRPH 476
           YGDM GGF+ LKD+YKT VF+LA +RNS         L+E  VIP  ++ + PSAEL P 
Sbjct: 407 YGDMVGGFSVLKDVYKTIVFELAKYRNS---------LSEVPVIPERVITRPPSAELSPD 457

Query: 477 QTDQESLPPYPILDDIIKRIVE---NEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAP 533
           Q DQ+SLPPY ILD I+   +E   ++E  I   + +   TV  V  L+  +EYKRRQ  
Sbjct: 458 QKDQDSLPPYDILDAILYAYIEEDMSQEDIIA--KGFERATVEKVIKLVDRNEYKRRQGA 515

Query: 534 VGTKITAKSFGRDRLYPISNKFRDHI 559
           +G +I++++FGRDR YPI N ++  +
Sbjct: 516 IGPRISSRAFGRDRRYPIVNGWKPGV 541


>gi|223935581|ref|ZP_03627497.1| NAD+ synthetase [bacterium Ellin514]
 gi|223895589|gb|EEF62034.1| NAD+ synthetase [bacterium Ellin514]
          Length = 545

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 227/570 (39%), Positives = 322/570 (56%), Gaps = 45/570 (7%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+A+AQ+N  VGD+AGN AK     + A   G+DL++F EL I+GYPP DL+ KK FI 
Sbjct: 1   MKVALAQINTTVGDLAGNEAKILAGYQRAVEAGVDLVMFPELTITGYPPRDLLHKKRFIA 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQ----EGVLNSVVILDAGNIIAVRDKINLPNY 120
                ++ L + +  G  G++VG+  +++    + + N V +L  G I+  R K  LP Y
Sbjct: 61  ENLEVLNRLAAVS--GKVGMLVGYVTENKTRPGKELSNCVALLQNGKIVESRIKTLLPTY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNS----------NICKHLKKQGAEF 170
             F E R F     N P+ F   +LG+ ICEDIW +           N    L   GA  
Sbjct: 119 DVFDEDRYFEPANENQPVEFNGTKLGLTICEDIWNDEDFWPERRYRHNPPMELAGAGAGI 178

Query: 171 LFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLA 230
           LF+++ASP+   K + R+ ++         P+++ NQ+GG DELIFDG S  F+ +  L 
Sbjct: 179 LFNVSASPWSLGKEETRYNMLRSMAIKSKRPVVFCNQIGGNDELIFDGGSLAFNAEGTLI 238

Query: 231 FQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQE---EEADYNACVLSLRDYV 287
            +   F+E  F+                 D+ S++ +P  E   EE  Y A VL LRDY+
Sbjct: 239 GRGDMFAEDFFVV----------------DTESSVEVPRMEWSAEEFIYKALVLGLRDYL 282

Query: 288 QKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALG 347
            K  F   ++GLSGGIDSAL A IAVDALGKE+V+ + LP +Y+S  SL+DA   A+ LG
Sbjct: 283 HKCGFKSAVLGLSGGIDSALTAVIAVDALGKEHVRGVSLPSQYSSQGSLDDAQILAERLG 342

Query: 348 CKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSN 407
            +YDV+PI          ++            ENIQ+R+RG  LMA+SN   A+LLTT N
Sbjct: 343 IRYDVVPIQPEFEAVKKQLASVFTGLKEDTTEENIQARLRGVTLMAMSNKFGALLLTTGN 402

Query: 408 KSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEK 467
           KSE++VGY TLYGDM GG   + D+ KT V+Q++ W N            E+IP   + K
Sbjct: 403 KSELAVGYCTLYGDMCGGLAVISDVPKTMVYQISKWINRE---------QEIIPRDTITK 453

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKR-IVENEESFINNDQEYNDETVRYVEHLLYGSE 526
            PSAELRP+QTDQ+SLPPY +LD I+   +V+ +         + + TV+ V  L+  +E
Sbjct: 454 PPSAELRPNQTDQDSLPPYEVLDAILDAYVVQGKGMREIIALGFEEPTVKRVIRLIDFNE 513

Query: 527 YKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           YKRRQA  G K+T+K+FG  R  PI+ K++
Sbjct: 514 YKRRQAAPGLKVTSKAFGVGRRIPIAQKYQ 543


>gi|167038045|ref|YP_001665623.1| NAD+ synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167040910|ref|YP_001663895.1| NAD+ synthetase [Thermoanaerobacter sp. X514]
 gi|300914946|ref|ZP_07132262.1| NAD+ synthetase [Thermoanaerobacter sp. X561]
 gi|307723820|ref|YP_003903571.1| NAD+ synthetase [Thermoanaerobacter sp. X513]
 gi|320116454|ref|YP_004186613.1| NAD+ synthetase [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166855150|gb|ABY93559.1| NAD+ synthetase [Thermoanaerobacter sp. X514]
 gi|166856879|gb|ABY95287.1| NAD+ synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|300889881|gb|EFK85027.1| NAD+ synthetase [Thermoanaerobacter sp. X561]
 gi|307580881|gb|ADN54280.1| NAD+ synthetase [Thermoanaerobacter sp. X513]
 gi|319929545|gb|ADV80230.1| NAD+ synthetase [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 543

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 228/564 (40%), Positives = 324/564 (57%), Gaps = 34/564 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQ+NPVVGDI GN  K       A  Q  DL++F EL   GYPP+D +F + F++
Sbjct: 1   MKIALAQINPVVGDIKGNFEKIVEFINTAKYQKADLVVFPELATVGYPPKDFLFMQDFLE 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVL-NSVVILDAGNIIAVRDKINLPNYSEF 123
           A    I+ +    +    G+++G  RQD EG L NS   +  G I+ + DK  LPNY  F
Sbjct: 61  ANEKYINEIVL-PNTNQIGVILGTVRQDTEGNLYNSAFFIYEGEIVEIFDKTLLPNYDVF 119

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKN----------SNICKHLKKQGAEFLFS 173
            EKR F          F+ I+LG+ ICEDIWK+           ++ +   K   +   +
Sbjct: 120 DEKRYFKPAQLRKVASFKGIKLGVNICEDIWKDYVFEPNVDYSVDVLEEQFKLKPDIFIN 179

Query: 174 LNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQM 233
           ++ASPYY  K   R E++  +I    +P +YVNQVG  DELIFDGASF  + + +   Q+
Sbjct: 180 ISASPYYLGKENMRVEMIEKKIKKYAIPFVYVNQVGANDELIFDGASFVVNEEGKRVVQL 239

Query: 234 KHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFH 293
           K F E   + +    + L +   + +D +             YNA VL +RDY +K+ F 
Sbjct: 240 KAFEEDIKVFDIDELKNLRKLPEIKEDISWV-----------YNALVLGVRDYCKKSGFK 288

Query: 294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVL 353
           K ++GLSGGIDSA+  AIAV+ALGKENV  + +P +Y+S  S  DA   A  LG ++ V+
Sbjct: 289 KAVVGLSGGIDSAVVCAIAVEALGKENVLAVSMPSRYSSEGSKSDARILADNLGIEFRVI 348

Query: 354 PIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISV 413
           PI  +   + S+ +         +  ENIQ+RIRGN LM +SN    ++LTT NKSE+++
Sbjct: 349 PIEPVFKSYLSVFNG-DNNVIGDLAEENIQARIRGNYLMFISNREGHIVLTTGNKSELAM 407

Query: 414 GYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAEL 473
           GY TLYGDMSG   P+ D+ KT V+ LA + N            E+IP SI+EK+PSAEL
Sbjct: 408 GYCTLYGDMSGSLAPIADVPKTMVYDLARFINRE---------REIIPISIIEKAPSAEL 458

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQA 532
           RP+Q D++SLPPY ILD+I+K  +E   S     ++ Y++  V+ V + +   EYKR+QA
Sbjct: 459 RPNQKDEDSLPPYKILDEILKMYIEENRSAKEIIEKGYDERLVKDVINKVNRVEYKRKQA 518

Query: 533 PVGTKITAKSFGRDRLYPISNKFR 556
             G KIT K+FG  R  PI + F+
Sbjct: 519 APGLKITTKAFGTGRRMPIVHNFK 542


>gi|226940195|ref|YP_002795268.1| NadE [Laribacter hongkongensis HLHK9]
 gi|226715121|gb|ACO74259.1| NadE [Laribacter hongkongensis HLHK9]
          Length = 739

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 217/535 (40%), Positives = 306/535 (57%), Gaps = 29/535 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +++A+AQ NP+VGDIAGN  +  R   EA   G D++L  EL ++GY PEDL+ + +F  
Sbjct: 1   MRLALAQFNPIVGDIAGNANEIARLAREAMAAGADVLLTPELALTGYSPEDLLLRPAFYA 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
             +  +D L       G  +++G P        N+  ++  GNI+    K+ LPN   F 
Sbjct: 61  EVNRQLDRL---MEIDGITLIIGHPAMLGSERFNAATVMRDGNILGTYHKMRLPNEEVFD 117

Query: 125 EKRTFISGYSNDPIVFRD--IRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           E R F  G +  P+VF    + +G+L+CEDIW      + L   GA+ L  +NASP++  
Sbjct: 118 EVRYFTPGVA--PLVFGQDGVNIGVLVCEDIWGPEPAAEALDA-GADVLLVMNASPFHRE 174

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K   R +    ++    LP+ YVN VGGQDEL+FDGASF  +   +   ++ HF      
Sbjct: 175 KHAVREQECRWRVEETGLPVAYVNLVGGQDELVFDGASFALNRAGEPVCRLPHF------ 228

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEE-EADYNACVLSLRDYVQKNNFHKVIIGLSG 301
                +  L   +    D    +  PL +  EA Y A VL +RDY+ KN F  V++GLSG
Sbjct: 229 -----EAALGFLDVQDGDIRPAVMAPLPDPVEAVYRALVLGVRDYIGKNGFPGVLLGLSG 283

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSAL  AIAVDALG + V  +M+P +YT+  S++D+    + LG +YD + I  +   
Sbjct: 284 GIDSALTLAIAVDALGADRVHAVMMPSRYTADISVDDSRDMVERLGVRYDEVAIWPMYES 343

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F   ++       +    EN+QSRIRG ILMALSN +  ++LTT NKSE++ GY TLYGD
Sbjct: 344 FMQALTPLFAGAAADTTEENLQSRIRGVILMALSNKTGKLVLTTGNKSEMTTGYATLYGD 403

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGF  LKD+ KT V++L+ WRN  G        +EVIP  I++++PSAELRP Q DQ+
Sbjct: 404 MAGGFAVLKDVAKTLVYELSEWRNRQG--------SEVIPRRIIDRAPSAELRPDQVDQD 455

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           SLPPY +LD I+   VE   S  +     Y+   V  +  LL  +EYKRRQAPVG
Sbjct: 456 SLPPYDVLDAIMAEYVEMNRSAADIVALGYDTADVERITRLLKVNEYKRRQAPVG 510


>gi|118595150|ref|ZP_01552497.1| NAD synthetase [Methylophilales bacterium HTCC2181]
 gi|118440928|gb|EAV47555.1| NAD synthetase [Methylophilales bacterium HTCC2181]
          Length = 532

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 216/553 (39%), Positives = 320/553 (57%), Gaps = 26/553 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+ +AQLN +VGD+  N     +  E+A   G D++L  EL ISGYPPEDL+    FI 
Sbjct: 1   MKVHLAQLNTIVGDLNFNKNLILKEAEKAMLNGADILLTPELSISGYPPEDLLLDHEFIN 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
            C   +D +     D    IV+G P  +   + NS+  L    ++    K  LPNY  F 
Sbjct: 61  ECDKCVDEIAIKFPD--ILIVIGHPMLEDNKLYNSLSALYKSKVLCTYHKRVLPNYGVFD 118

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G  N  I +   ++  LICED+W    + + L KQG + +  +NASP+   K 
Sbjct: 119 EKRYFSEGKDNATINYNGKKISFLICEDVW-TEGLVESLVKQGVDIILCINASPFEVKKQ 177

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           +KR + +T +I+   + ++Y+N +GGQD ++FDG SF +DG + L F++  FS  + + +
Sbjct: 178 QKRIDQITNKIAGNEVALVYLNALGGQDNVVFDGGSFVYDGMKGLIFELPQFSLTSEIID 237

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
            +   +L    Y              + E   N  VL+L DY++KNN  +V +GLSGGID
Sbjct: 238 LNVGTKLLPKIY-------------NDLEIILNGLVLALHDYLEKNNIERVFLGLSGGID 284

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL   IA  A+ K+N+  +M+P KYT+  SLEDA +  + LG  Y    I  L+N+   
Sbjct: 285 SALVLFIATKAMAKKNIHAVMMPSKYTANISLEDAQSLTENLGVNYQTYSIETLINNIDQ 344

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
           + S+  +  P+ I  EN Q+RIRG +LM L+N    M+L TSNKSE++VGY T+YGDM G
Sbjct: 345 VFSEEFKNLPADITEENFQARIRGLLLMGLANKHHGMVLATSNKSELAVGYSTIYGDMVG 404

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF  LKD+ KT V+ LA   N             +IP  I+ + PSAEL+ +QTDQ++LP
Sbjct: 405 GFCVLKDVPKTMVYDLARHINRE---------ENIIPSRIITREPSAELKNNQTDQDTLP 455

Query: 485 PYPILDDIIKRIVENEES-FINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
            Y ILDD+I+  VE +++     +  ++ + V  V +L+ GSE+KRRQ+  G KIT+K+F
Sbjct: 456 SYEILDDVIRLYVEEKQTPAFMIESGFDSQIVEKVVNLINGSEFKRRQSAPGPKITSKAF 515

Query: 544 GRDRLYPISNKFR 556
             DR +PI+NK++
Sbjct: 516 SVDRRFPITNKYK 528


>gi|170691912|ref|ZP_02883076.1| NAD+ synthetase [Burkholderia graminis C4D1M]
 gi|170143196|gb|EDT11360.1| NAD+ synthetase [Burkholderia graminis C4D1M]
          Length = 591

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 237/596 (39%), Positives = 339/596 (56%), Gaps = 47/596 (7%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           K +IA+AQ+N  VGD AGN+AK   A  +A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQINVTVGDFAGNVAKIVAAARDAHSAGAKLLVAPELALSGYPPEDLLLRPAFY 61

Query: 64  QACSSAIDTLKSDTHD-GGAGIVVGFPRQD--------------------QEGV-----L 97
            A ++A+  L        G  ++VG P +D                    Q GV      
Sbjct: 62  TASAAALADLAQQLKQFAGLHVIVGHPLRDAADSVANSAASGHGNANAPIQRGVPPVDTF 121

Query: 98  NSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWK 155
           N+  ++  G I     K +LPN   F EKR F S     P VF    ++ G++ICED W 
Sbjct: 122 NAASLVVDGRIAGTYRKQDLPNTEVFDEKRYFAS--DAQPFVFELDGVKYGVVICEDAW- 178

Query: 156 NSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELI 215
           +++  +  K  GA+ L   N SP++ NK   R +I+  +I    LP++YVN VG QDEL+
Sbjct: 179 HASAAQMAKAAGAQVLLIPNGSPFHLNKEAVRFDILRARIRETGLPMVYVNMVGAQDELV 238

Query: 216 FDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQL------SQWNYMSDDSASTMYIP- 268
           FDG SF  D Q +L  +M  F E     E+     L      ++ N     S +T   P 
Sbjct: 239 FDGGSFVLDAQGELVAKMPQFEEATAFVEFENAVPLRGHGGEAKANDAQLFSGATGANPA 298

Query: 269 ----LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTI 324
               L  E   Y A V+ +RDYV KN F   +IGLSGG+DSAL  A+A DALG + V+ +
Sbjct: 299 IAPELSLEAQVYAALVMGVRDYVNKNGFPGALIGLSGGVDSALVLAVACDALGADRVRAV 358

Query: 325 MLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQS 384
           M+P +YT+  S  DAA  A+ +G +YD + I  + + F S ++Q  +  P     ENIQ+
Sbjct: 359 MMPSRYTADISTTDAAEMARRVGVRYDEIAIAPMFDAFRSSLAQEFEGRPEDATEENIQA 418

Query: 385 RIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWR 444
           RIRG +LMALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +R
Sbjct: 419 RIRGTLLMALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCHYR 478

Query: 445 NSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFI 504
           N     +  G    VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E + S  
Sbjct: 479 NQ---ATAFG-TQNVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRSLA 534

Query: 505 N-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
                 Y  E V+ V  L+  +EYKRRQAP+G ++T ++FGRD  YPI++++ + +
Sbjct: 535 EIIAAGYAVEDVKRVTRLIKINEYKRRQAPIGIRVTHRAFGRDWRYPITSRYTEPV 590


>gi|330831161|ref|YP_004394113.1| glutamine-dependent NAD(+) synthetase [Aeromonas veronii B565]
 gi|328806297|gb|AEB51496.1| Glutamine-dependent NAD(+) synthetase (NAD(+) synthase) [Aeromonas
           veronii B565]
          Length = 540

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 229/556 (41%), Positives = 335/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M K L + +AQLN  VG I  N  K   A  +A +QG DL++ +EL ++GYPPEDL+ + 
Sbjct: 1   MAKALSLMLAQLNLTVGAIEDNTDKVLAAAAQAEQQGADLLVCSELALTGYPPEDLLLRA 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +    +A+  + +    G   I+VG P ++ E + N+  + + G +I    K +LPNY
Sbjct: 61  DLMIRVEAALSRIAA--WQGACAILVGHPWREGEALYNAASLYEQGQLITRYFKQDLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +      + FR  +LG+LICED+W+        K  GAE L ++NASPY 
Sbjct: 119 GVFDEKRYFTAATETCVVPFRGYQLGLLICEDLWQPGPA-LAAKAAGAELLLTINASPYD 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R E++  +     LP++Y+NQV GQDELIFDG S  F  Q +L  ++  F+E+ 
Sbjct: 178 QEKPWIRRELMAERCDQTGLPLVYLNQVCGQDELIFDGCSKVFSSQGELTHKLAPFAEEL 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +  +   Q + +    +         PL+     Y A VL++RDYV KN FH  ++GLS
Sbjct: 238 ALVRFADGQPVKEREPAA---------PLEPLAETYQALVLAVRDYVTKNGFHGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIA DA+G + VQ +M+P++YT+  S+EDA   A+ +G +++++ I  +  
Sbjct: 289 GGIDSALTLAIAADAIGADKVQAVMMPFRYTAQMSVEDAKEQAERMGVEFNIISIEPMFE 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + ++   +        EN+Q+R RG +LMALSN  + ++LTT NKSE++VGY TLYG
Sbjct: 349 GFMTQLAPLFEGTARDTTEENLQARCRGVLLMALSNKRRRIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L  +RNS         +  VIP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLCEYRNS---------VDYVIPQRVIDRPPSAELAPDQVDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I+KR VE + S  +   E + +  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILKRYVEEDASVADMVAEGFEEAVVRKVIRLVDLNEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|307265807|ref|ZP_07547358.1| NAD+ synthetase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919202|gb|EFN49425.1| NAD+ synthetase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 543

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 226/565 (40%), Positives = 326/565 (57%), Gaps = 36/565 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQ+NPVVGDI GN  K       A  Q  DL++F+EL   GYPP+D +F + F++
Sbjct: 1   MKIALAQINPVVGDIKGNFEKIVEFINRAKYQKADLVVFSELVTVGYPPKDFLFMQDFLE 60

Query: 65  ACSSAIDTLK-SDTHDGGAGIVVGFPRQDQEGVL-NSVVILDAGNIIAVRDKINLPNYSE 122
           A    I+ +    T+    G+++G  RQD EG L NS   +  G I+ V DK  LPNY  
Sbjct: 61  ANEKYINEIVLPATYQ--IGVILGTVRQDAEGNLYNSAFFIYDGKIVEVFDKTLLPNYDV 118

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKN----------SNICKHLKKQGAEFLF 172
           F EKR F          F+ I+LG+ ICEDIWK+           ++ +   K   +   
Sbjct: 119 FDEKRYFKPAQIRKVASFKGIKLGVNICEDIWKDYVFEPNVDYSVDVLEEQFKLKPDIFI 178

Query: 173 SLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQ 232
           +++ASPYY  K   R E++  +I    +P +YVNQVG  DELIFDG+SF  + + +   Q
Sbjct: 179 NISASPYYLGKQNMRVEMIEKKIKKYAIPFVYVNQVGANDELIFDGSSFVVNEEGKRVVQ 238

Query: 233 MKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNF 292
           +K F E   + +    +   +   + +D +             YNA V+ +RDY +K+ F
Sbjct: 239 LKAFEEDIKIFDMEELKNFKELPEIKEDISWV-----------YNALVVGVRDYCKKSGF 287

Query: 293 HKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDV 352
            K ++GLSGGIDSA+  AIAV+ALGKENV  + +P +Y+S  S  DA   A+ LG ++ V
Sbjct: 288 KKAVVGLSGGIDSAVVCAIAVEALGKENVLAVSMPSRYSSEGSKTDARILAENLGVEFRV 347

Query: 353 LPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEIS 412
           +PI  +   + S+ +         +  ENIQ+RIRGN LM +SN    ++LTT NKSE++
Sbjct: 348 IPIEPVFKSYLSVFNG-DNSVIGDLAEENIQARIRGNYLMFISNREGHIVLTTGNKSELA 406

Query: 413 VGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAE 472
           +GY TLYGDMSG   P+ D+ KT V++LA + N            E+IP SI+EK PSAE
Sbjct: 407 MGYCTLYGDMSGSLAPIADVPKTMVYELARYINRE---------REIIPISIIEKVPSAE 457

Query: 473 LRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQ 531
           LRP+Q D++SLPPY ILD+I+K  +E   S     ++ Y++  V+ V + +   EYKR+Q
Sbjct: 458 LRPNQKDEDSLPPYKILDEILKMYIEENRSAKEIIEKGYDERLVKDVINNVNKVEYKRKQ 517

Query: 532 APVGTKITAKSFGRDRLYPISNKFR 556
           A  G K+T K+FG  R  PI + F+
Sbjct: 518 AAPGLKVTTKAFGTGRRMPIVHNFK 542


>gi|262369416|ref|ZP_06062744.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262315484|gb|EEY96523.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 541

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 226/560 (40%), Positives = 329/560 (58%), Gaps = 27/560 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  KIA+AQ +P +G++  N  K      EA +Q  DLI+F EL   GYP EDL+ + S
Sbjct: 1   MKSFKIALAQFSPHIGNLEANAQKMLEQANEAKKQNADLIIFPELSSIGYPAEDLLLRPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
             +      + LK+        +V GF  Q ++G   N+  ++  G ++ V +K NLPNY
Sbjct: 61  LTKRTQQVFEQLKTVKD---IVMVFGFVNQTEDGQRYNAAAVMKDGQVLGVYNKQNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F EKR F  G+ +    +   + G+LICED+W  S + + L +   E    LNASPY 
Sbjct: 118 SVFDEKRYFTEGHQHLVFEYLGHKFGVLICEDVWSLSTV-QQLAQLNVETALVLNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R E ++     ++L ++Y NQVGGQD+LIFDG SF       +  Q + F E  
Sbjct: 177 VGKPQHRVETMSALAKQMNLNLVYANQVGGQDDLIFDGTSFVIAKNGSIVLQAESFKESL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIGL 299
           +  E+  +QQ  + N +          P  +  A+ Y + V++ RDYVQ++ F  VI+GL
Sbjct: 237 YFAEYEAEQQAFKANALP---------PALDTMAEIYQSLVMATRDYVQRSGFPGVILGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIA DA+G + VQ +M+PY YT+  S+EDAA  AK++G  + +  I+ +V
Sbjct: 288 SGGIDSALTLAIAADAIGADKVQAVMMPYTYTAQISVEDAAEQAKSMGVTFGIAEINPIV 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           N F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSE++VGY TLY
Sbjct: 348 NSFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSELAVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GGF  LKD+YKT VF+LA +RNS  I+        VIP  ++ + PSAELRP Q D
Sbjct: 408 GDMVGGFAVLKDVYKTIVFELAKYRNS--ISD-----KPVIPERVITRPPSAELRPDQKD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           Q+SLPPY +LD I+   +E + S   +D   + ++ E V  V  L+  +EYKRRQ  +G 
Sbjct: 461 QDSLPPYDVLDAILYAYIEEDMS--QDDIIAKGFDAEVVAKVIRLVDFNEYKRRQGAIGP 518

Query: 537 KITAKSFGRDRLYPISNKFR 556
           +I++++F R+R YPI N ++
Sbjct: 519 RISSRAFSRERRYPIMNGWK 538


>gi|166366233|ref|YP_001658506.1| NAD synthetase [Microcystis aeruginosa NIES-843]
 gi|166088606|dbj|BAG03314.1| glutamine-dependent NAD(+) synthetase [Microcystis aeruginosa
           NIES-843]
          Length = 552

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 225/574 (39%), Positives = 333/574 (58%), Gaps = 46/574 (8%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IAIAQLNP+VGDI GN  +   A + A  QG +L+L  EL + GYPP DL+    F++
Sbjct: 1   MRIAIAQLNPIVGDIEGNAQRILEAAQTAFNQGAELLLTPELSLCGYPPRDLLLNLGFVE 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQD-------QEGVLNSVVILDAGNIIAVRDKINL 117
             S  +  L     +  A ++VGF  ++       ++ + NS+ +L +  I  +  K  L
Sbjct: 61  KMSRQLQLLSQQLPEKLA-VLVGFVEKNPSATVRGEKPLFNSIALLKSQEIKQIFTKRLL 119

Query: 118 PNYSEFHEKRTFISGYSND--PIVFRDIRLGILICEDIWKNS----------NICKHLKK 165
           P Y  F E R F SG  +    +   ++++G+ ICED+W +           N    L  
Sbjct: 120 PTYDVFDEDRYFASGKESQYFQLTENNVKIGVTICEDVWNDEQFWGQRQYAVNPIADLAN 179

Query: 166 QGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDG 225
            G + + +L+ASPY   K K R  +++   +  +LPI+YVNQVGG D+LIFDG S  F+ 
Sbjct: 180 LGVDLIVNLSASPYSVGKQKLRESLLSHSATRYNLPIVYVNQVGGNDDLIFDGDSVAFNR 239

Query: 226 QQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRD 285
           Q ++ ++ + F+    + E++ D             A    +P+ E+E  Y A VL +RD
Sbjct: 240 QGEVIYRAQAFTSSLELIEFNQDLL----------PAVIHPLPVDEDEEIYRALVLGVRD 289

Query: 286 YVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKA 345
           YVQK  F +VI GLSGGIDS+L AAIA DALGKENV  +M+P  Y+S  S+ DA A    
Sbjct: 290 YVQKCGFKRVIFGLSGGIDSSLVAAIASDALGKENVLAVMMPSPYSSDHSISDAVALVNN 349

Query: 346 LGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTT 405
           LG K + L I +++  +  L+         GI  EN+QSRIRGN+LMALSN    +LL+T
Sbjct: 350 LGIKSEKLAIQEIMTAYDQLLEPVFAGTDFGIAEENLQSRIRGNLLMALSNKFGHLLLST 409

Query: 406 SNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSIL 465
            NKSE++VGY TLYGDM+GG   + D+ KT+V+ L  W N HG         E+IP +++
Sbjct: 410 GNKSEMAVGYCTLYGDMNGGLAVIADVPKTRVYSLCRWLNRHG---------EIIPLNVI 460

Query: 466 EKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ----EYNDETVRYVEHL 521
            K+PSAEL+P+Q DQ+SLPPY ILD I+  +++  +S    +Q     +  E V+ V  L
Sbjct: 461 NKAPSAELKPNQKDQDSLPPYEILDAILALLIDRHQS---AEQIIAAGFEPEIVQKVIKL 517

Query: 522 LYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           +  +E+KR+QAP G KI+ ++FG     PI++++
Sbjct: 518 VKNAEFKRKQAPPGLKISDRAFGTGWRMPIASRW 551


>gi|241663744|ref|YP_002982104.1| NAD synthetase [Ralstonia pickettii 12D]
 gi|240865771|gb|ACS63432.1| NAD+ synthetase [Ralstonia pickettii 12D]
          Length = 545

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 226/565 (40%), Positives = 329/565 (58%), Gaps = 34/565 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           + +A+AQ+N  VGD AGN ++   A  EA++ G  ++L  EL ++GYPPEDL+ + +FI 
Sbjct: 3   VSVALAQINCTVGDFAGNASRIVAAAREAHQAGARILLTPELSLTGYPPEDLLLRPAFID 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFPRQDQE----GVL----NSVVILDAGNIIAVRDKI 115
           A + A+D L ++     G  +++G P+   E    GVL    NSV +   G ++   +K+
Sbjct: 63  ASARALDALIAELAAFPGLHVLIGHPQLSLEAPAPGVLPKPTNSVTVAVDGRVVGRYNKL 122

Query: 116 NLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLKKQGAEFLFS 173
            LPN   F EKR F  G   +P VF     R G++ICED W  +             L  
Sbjct: 123 ELPNNEVFDEKRYFQPG--TEPFVFEVDGTRFGVIICEDAWYATATAYAKAAGAQVVLIP 180

Query: 174 LNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQM 233
            NASPY+ +K   R  I+  ++    LP +Y N VGGQDEL+FDG SF  D +  +  +M
Sbjct: 181 -NASPYHLDKEDLRERIIGARVKESGLPHVYANLVGGQDELVFDGGSFVLDAEGNVVVRM 239

Query: 234 KHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFH 293
             F E     ++   + L            T+      E   Y A  L +RDY+ KN F 
Sbjct: 240 GQFVEGVGYVQFDGGRALP----------GTIVPEASLEAQVYEALKLGVRDYLGKNGFP 289

Query: 294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVL 353
             IIGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA   A  LG +YD +
Sbjct: 290 GAIIGLSGGVDSALVLAIAVDALGADRVRAVMMPSRYTADISWVDARDMAARLGVQYDEI 349

Query: 354 PIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISV 413
            I  + + F   +++  +  P     ENIQ+RIRG +LMALSN S  ++LTT NKSE++V
Sbjct: 350 AISPMFDAFKGALAEDFRGLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSEMAV 409

Query: 414 GYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAEL 473
           GY TLYGDM+GGF  +KD++KT V++L  +RN+         L+EVIP  IL ++PSAEL
Sbjct: 410 GYCTLYGDMAGGFAVIKDIFKTLVYRLCRYRNA---------LSEVIPERILTRAPSAEL 460

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETVRYVEHLLYGSEYKRRQA 532
           R +QTDQ+SLP Y  LD I++R +E  +   +   + + +  V+ +  L+  +EYKRRQA
Sbjct: 461 RENQTDQDSLPEYDALDAIVQRYMEQNQPVADIIADGFAEADVQKIVRLIKINEYKRRQA 520

Query: 533 PVGTKITAKSFGRDRLYPISNKFRD 557
           PVG ++T ++FGRD  YPI+++F++
Sbjct: 521 PVGIRVTQRAFGRDWRYPITSRFKE 545


>gi|124514781|gb|EAY56293.1| NAD+ synthase [Leptospirillum rubarum]
          Length = 592

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 232/602 (38%), Positives = 331/602 (54%), Gaps = 57/602 (9%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           ++KLK+A+AQ NP+VGDI GN+A  +    +A  + +D+++F EL ++GYPPEDL+ K S
Sbjct: 1   MRKLKLALAQTNPIVGDIPGNLAHIKDMILQARSEHVDVVVFPELALTGYPPEDLLLKPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI     A+D L     +    ++VGF  + Q+ + N+  +L  G +  +  K  LPNY 
Sbjct: 61  FIDKNLRALDELLGFAPE--LLVLVGFVDR-QDDIYNAAAVLHGGKLHGIYRKQYLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG-AEFLFSLNASPYY 180
            F E R F  G  +  + +R  RLGI ICEDIW            G AE + +L+ASP++
Sbjct: 118 VFDENRYFQEGVESPVLEYRSARLGINICEDIWYPKGPLYTQTLMGDAECILNLSASPFH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R  ++  +       I YVN VGGQDEL+FDG S       ++  + K F E  
Sbjct: 178 AGKREVRENMLCTRAVDSACYIAYVNMVGGQDELVFDGQSLVISPDGEIESRGKAFQEDL 237

Query: 241 FMTE-----------------------------WHYDQQLSQWNYMSDDS---------- 261
            +TE                             W+ D  L +W                 
Sbjct: 238 LITEIDLDHVFRVRLHDPRRRKDRLSQSLDRPQWNQDDVLVRWKIEEAGRRQAPGGARPE 297

Query: 262 -----ASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDAL 316
                 S    PL      Y A V  +RDYV+KN+F +V++GLSGGIDSAL AAIA DAL
Sbjct: 298 KKVLVKSPYTQPLDRLSEIYEALVTGVRDYVRKNSFREVLVGLSGGIDSALVAAIATDAL 357

Query: 317 GKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSG 376
           G E+V  + +P  +TS +S ED    +  L    + +PI      F  ++S   Q+ P  
Sbjct: 358 GAEHVHGLFMPSMFTSQESYEDVLKLSGTLKVHVETIPIGAAFEQFLQILSPHFQDRPRD 417

Query: 377 IVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQ 436
              EN+QSRIRG +LMALSN    ++LTT NKSE+SVGY TLYGDM+GGF+ LKD+ KT 
Sbjct: 418 TAEENLQSRIRGLLLMALSNKFHWLVLTTGNKSEMSVGYQTLYGDMAGGFSVLKDVPKTL 477

Query: 437 VFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRI 496
           V+ LA + N+           ++IP  I+EK+P+AELRP+Q D +SLPPY ILD I++  
Sbjct: 478 VYDLADFLNTRR--------ADIIPHRIIEKAPTAELRPNQKDLDSLPPYEILDPIMEAY 529

Query: 497 VENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           VE+++ F     + ++  TV  V  L+  SEYKRRQ+P G K+T ++FG+D   PI+N+F
Sbjct: 530 VEDDQGFEEIVGKGFDPATVARVLSLIDKSEYKRRQSPPGIKLTLRAFGKDWRVPITNRF 589

Query: 556 RD 557
           ++
Sbjct: 590 KE 591


>gi|16330978|ref|NP_441706.1| NAD synthetase [Synechocystis sp. PCC 6803]
 gi|8928223|sp|P74292|NADE_SYNY3 RecName: Full=Probable glutamine-dependent NAD(+) synthetase;
           AltName: Full=NAD(+) synthase [glutamine-hydrolyzing]
 gi|1653472|dbj|BAA18386.1| NH(3)-dependent NAD(+) synthetase [Synechocystis sp. PCC 6803]
          Length = 558

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 227/569 (39%), Positives = 322/569 (56%), Gaps = 39/569 (6%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           IA+AQLNP +G IA N  K   A  +A  +G DL+L  EL + GYPP+DL+   SF++  
Sbjct: 4   IALAQLNPTIGAIAENAEKIVTAALQAQARGADLLLTPELALCGYPPKDLLLNPSFVEQL 63

Query: 67  SSAIDTLKSDTHDGGAGIVVGF-------PRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
              +  L ++       I+VG         RQ Q+ + NS V+++ G I     K  LP 
Sbjct: 64  EEELQWL-AEKMPPSIAILVGTVTPHHQAERQGQKKLWNSAVLIEQGQIKQWFHKCLLPT 122

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNS----------NICKHLKKQGAE 169
           Y  F E R F S   ++  +++++++G+ ICED+W +           N    L  QG  
Sbjct: 123 YDVFDEDRYFASAAKSEYFIYKNVKIGVTICEDLWNDEAFWGQKFYQVNPLMDLIDQGVN 182

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            + +L+ASPY   K   R  +++      ++P+IYVNQVGG D+LIFDG SF  + Q ++
Sbjct: 183 LVVNLSASPYSCGKHYLRESLISHSAKRFNVPLIYVNQVGGNDDLIFDGGSFAVNSQGKI 242

Query: 230 AFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQK 289
             +   F E   +    YD  LS         AS   +P+ + E  + A VL + DY+ K
Sbjct: 243 IGRSPLFQED--LALLSYD--LSSGELTGQKLAS---LPMVDTEELWQALVLGVGDYLHK 295

Query: 290 NNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCK 349
             F K I+GLSGGIDS+L AAIAV+ALGKENV  I++P  Y+S  S++DA A AK LG  
Sbjct: 296 CGFSKAILGLSGGIDSSLVAAIAVEALGKENVLGILMPSPYSSDHSIQDALALAKNLGMN 355

Query: 350 YDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKS 409
              +PI  ++  +   +    Q+ P G+  EN+QSRIRGN+LMA++N    +LL+T NKS
Sbjct: 356 TQTIPIGPIMATYDQALVPLFQDAPFGLAEENLQSRIRGNLLMAIANKFGHLLLSTGNKS 415

Query: 410 EISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSP 469
           E++VGY TLYGDM+GG   + D+ KTQVF+L  W N             +IPPS+L K P
Sbjct: 416 ELAVGYCTLYGDMNGGLAAIADVPKTQVFELCRWLNRE---------QTIIPPSVLTKPP 466

Query: 470 SAELRPHQTDQESLPPYPILDDIIKRIVENEES---FINNDQEYNDETVRYVEHLLYGSE 526
           SAEL+P Q D +SLPPY +LD I+ R+VE  +S    IN    +  E V  +  L+  SE
Sbjct: 467 SAELKPGQVDTDSLPPYDVLDGILGRLVEKHQSPQEIINAG--FEREVVLKICQLVQKSE 524

Query: 527 YKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           +KRRQA  G K+T ++FG     PI+  F
Sbjct: 525 FKRRQAAPGLKVTDRAFGSGWRMPIAQAF 553


>gi|326391022|ref|ZP_08212571.1| NAD+ synthetase [Thermoanaerobacter ethanolicus JW 200]
 gi|325992967|gb|EGD51410.1| NAD+ synthetase [Thermoanaerobacter ethanolicus JW 200]
          Length = 543

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 226/565 (40%), Positives = 325/565 (57%), Gaps = 36/565 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQ+NPVVGDI GN  K       A  Q  DL++F EL   GYPP+D +F + F++
Sbjct: 1   MKIALAQINPVVGDIKGNFEKIVEFINTAKYQKADLVVFPELATVGYPPKDFLFMQDFLE 60

Query: 65  ACSSAIDTLK-SDTHDGGAGIVVGFPRQDQEGVL-NSVVILDAGNIIAVRDKINLPNYSE 122
           A    I+ +    T+    G+++G  RQD EG L NS   +  G I+ V DK  LPNY  
Sbjct: 61  ANEKYINEIVLPATYQ--IGVILGTVRQDTEGNLYNSAFFIYDGKIVEVFDKTLLPNYDV 118

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKN----------SNICKHLKKQGAEFLF 172
           F EKR F          F+ I+LG+ ICEDIWK+           ++ +   K   +   
Sbjct: 119 FDEKRYFKPAQIRKVASFKGIKLGVNICEDIWKDYVFEPNVDYSVDVLEEQFKLKPDIFI 178

Query: 173 SLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQ 232
           +++ASPYY  K   R E++  +I    +P +YVNQVG  DELIFDG+SF  + + +   Q
Sbjct: 179 NISASPYYLGKQNMRVEMIEKKIKKYAIPFVYVNQVGANDELIFDGSSFVVNEEGKRVVQ 238

Query: 233 MKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNF 292
           +K F E   + +    +   +   + +D +             YNA V+ +RDY +K+ F
Sbjct: 239 LKAFEEDIKIVDMEELKNFKELPEIKEDISWV-----------YNALVVGVRDYCKKSGF 287

Query: 293 HKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDV 352
            K ++GLSGGIDSA+  AIAV+ALGKENV  + +P +Y+S  S  DA   A+ LG ++ V
Sbjct: 288 KKAVVGLSGGIDSAVVCAIAVEALGKENVLAVSMPSRYSSEGSKTDARILAENLGVEFRV 347

Query: 353 LPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEIS 412
           +PI  +   + S+ +         +  ENIQ+RIRGN LM +SN    ++LTT NKSE++
Sbjct: 348 IPIEPVFKSYLSVFNG-DNSVIGDLAEENIQARIRGNYLMFISNREGHIVLTTGNKSELA 406

Query: 413 VGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAE 472
           +GY TLYGDMSG   P+ D+ KT V++LA + N            E+IP SI+EK PSAE
Sbjct: 407 MGYCTLYGDMSGSLAPIADVPKTMVYELARYINRE---------REIIPISIIEKVPSAE 457

Query: 473 LRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQ 531
           LRP+Q D++SLPPY ILD+I+K  +E   S     ++ Y++  V+ V + +   EYKR+Q
Sbjct: 458 LRPNQKDEDSLPPYKILDEILKMYIEENRSAKEIIEKGYDERLVKDVINKVNRVEYKRKQ 517

Query: 532 APVGTKITAKSFGRDRLYPISNKFR 556
           A  G K+T K+FG  R  PI + F+
Sbjct: 518 AAPGLKVTTKAFGTGRRMPIVHNFK 542


>gi|167814772|ref|ZP_02446452.1| NAD synthetase [Burkholderia pseudomallei 91]
          Length = 566

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 238/588 (40%), Positives = 340/588 (57%), Gaps = 56/588 (9%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF- 62
           K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPAFY 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEG-----VLNSVV 101
             + ++            G  ++VG P                R  + G       N+  
Sbjct: 62  AASDAALAALAAQLKPLAGLAVLVGHPLRAAGAGASSADGNANRPIERGAAPVDTYNAAS 121

Query: 102 ILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNI 159
           ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W +++ 
Sbjct: 122 LIVGGGVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HASA 178

Query: 160 CKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGA 219
            +  K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG 
Sbjct: 179 AQLAKAAGAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFDGG 238

Query: 220 SFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEEAD 275
           SF  DG  +L  +M  F E + + E+              D A  +  P    L  E   
Sbjct: 239 SFVLDGAGELVAKMPQFEESHAIVEF--------------DGARALPAPIAPALPVEAQV 284

Query: 276 YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQS 335
           Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+  S
Sbjct: 285 YRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTADIS 344

Query: 336 LEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNILM 392
             DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +LM
Sbjct: 345 TTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTLLM 401

Query: 393 ALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSG 452
           ALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+      
Sbjct: 402 ALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEYGA 461

Query: 453 LGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYN 511
           L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y 
Sbjct: 462 L----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYA 517

Query: 512 DETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 518 EADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 565


>gi|160903300|ref|YP_001568881.1| NAD+ synthetase [Petrotoga mobilis SJ95]
 gi|160360944|gb|ABX32558.1| NAD+ synthetase [Petrotoga mobilis SJ95]
          Length = 575

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 218/580 (37%), Positives = 335/580 (57%), Gaps = 37/580 (6%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           K++I++AQ+N  VGD  GN+ K +    +A+ +G D+ILF EL ++GYPPEDL+ K  F+
Sbjct: 2   KIRISLAQMNSTVGDYPGNVEKIKDFISKADEKGADIILFPELSLNGYPPEDLILKTQFL 61

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +    +I+ ++  +      IV+G    D E   NS  ++  G I     K+ LPNYS F
Sbjct: 62  KDSLKSIEEIQDFSKSKDVVIVLGAVDWDVES-YNSAFVIYKGEIYGSYKKMFLPNYSVF 120

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            EKR F +G +   +    I++GI ICED+W  +     L + GA  + +L++SP+Y  +
Sbjct: 121 DEKRYFTAGRAPFLMEMERIKIGITICEDLWVPNGPAVSLAQNGANLILNLSSSPFYKGR 180

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
            K R E++  + S +   I Y N +GGQDEL+FDG S   +   ++      F E  +  
Sbjct: 181 NKVRFEMLKTRASELSSWIAYCNIIGGQDELVFDGGSVVINPYGEIELSAPSFEEGLYFI 240

Query: 244 EW----------------HYDQQ--LSQWNYMSDDSASTMYIPLQEEEAD--------YN 277
           +                 HY+Q       N +  +       P++  + D        Y 
Sbjct: 241 DIDPLEPTRANLREGKRKHYNQSAYYESVNTIKIEKKIREKTPIKAVKVDSFDIYEQLYL 300

Query: 278 ACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLE 337
           A    ++DYV KN F KV++GLSGGIDS+L AAIA DA+G ENV  +++P +Y+S  S++
Sbjct: 301 AVKTGIKDYVLKNGFQKVVLGLSGGIDSSLTAAIAADAIGPENVVGLLMPSQYSSKGSID 360

Query: 338 DAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNH 397
           D+   +K LG  Y ++PI+D+   +   + +  +        ENIQ+RIRGN++MA SN 
Sbjct: 361 DSIELSKNLGINYKIIPINDIYEKYIENLKESFKNTDEDKTEENIQARIRGNLVMAFSNK 420

Query: 398 SKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNS-HGITSGLGPL 456
              + L   NKSE + GY TLYGDM+GGF+P+KDLYKT ++++A   N  HG        
Sbjct: 421 FGYLALACGNKSEAATGYATLYGDMAGGFSPIKDLYKTDLYKVARKYNELHG-------- 472

Query: 457 TEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-YNDETV 515
            E+I  SILEK+PSAELRP+Q D++ LPPY +LD+I+ + ++ E S+    QE Y++  +
Sbjct: 473 KEIIIKSILEKAPSAELRPNQKDEDILPPYALLDEILFKYIDREMSYDELLQEGYDEGLL 532

Query: 516 RYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           + V +++  +EYKRRQ+  G K+T +SFG+DR  PI+NK+
Sbjct: 533 KNVINMVNKNEYKRRQSAPGIKLTERSFGKDRRMPITNKY 572


>gi|218780476|ref|YP_002431794.1| NAD+ synthetase [Desulfatibacillum alkenivorans AK-01]
 gi|218761860|gb|ACL04326.1| NAD+ synthetase [Desulfatibacillum alkenivorans AK-01]
          Length = 548

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 226/580 (38%), Positives = 337/580 (58%), Gaps = 55/580 (9%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQ+NP+VGD  G  +K +   ++A     DL++F EL + GYPP DL+ +KSFI+
Sbjct: 1   MKIALAQINPIVGDFKGARSKIQEFAQKAKNLSCDLVIFPELSVCGYPPRDLLERKSFIR 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG------VLNSVVILDAGNIIAVRDKINLP 118
           AC  A+ +L  D H  G G+++GF   D+ G      + N+ ++ + GNI+ V  K  LP
Sbjct: 61  ACQDAVQSLLDDIH--GIGVILGF--VDRVGGAPGKPIANAAMLFEDGNILEVVHKRLLP 116

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNI----------CKHLKKQGA 168
            Y  F E R F  G   +P +++ + +G+ ICED W + ++           + L  + A
Sbjct: 117 TYDVFDESRYFAPGGKAEPFMYKGMNIGLTICEDAWNDKDLFPEQLYEWDPVQTLADKKA 176

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
           + + ++ ASP++  K   R  I++       L  +YVNQVGG D LIFDGAS        
Sbjct: 177 DLIINIAASPFHAGKRAVRGSIMSHLAKKHRLSCVYVNQVGGNDHLIFDGASTVHTPGGD 236

Query: 229 LAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD--YNACVLSLRDY 286
           LA     F E++ +T   +D +  + +            P+ E EA+    A V  + DY
Sbjct: 237 LAALAGEF-EEDLVT---FDTETGKGDIH----------PVCESEAESLAKALVTGVGDY 282

Query: 287 VQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKAL 346
           V+K  F KV++GLSGGIDSAL  A+A +ALG EN  +I +P +YTS Q+  D    A  L
Sbjct: 283 VRKCGFSKVVVGLSGGIDSALTLAVAAEALGPENTYSIFMPSEYTSQQNHTDTKELADNL 342

Query: 347 GCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTS 406
           GC Y+++PI  +   F S +S F  +E  G+  +NIQ+R RG+ILMA SN + AM+L+T 
Sbjct: 343 GCPYEIIPITPIFETFLSSLS-FCNKEDFGVTEQNIQARTRGSILMAFSNKTGAMVLSTG 401

Query: 407 NKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILE 466
           NKSE++VGY TLYGDM+GG + + DL K  V++++ + N            E+IP SIL 
Sbjct: 402 NKSEVAVGYCTLYGDMNGGLSVISDLPKELVYEVSRYFNKD---------REIIPESILT 452

Query: 467 KSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQE-----YNDETVRYVEHL 521
           K+PSAELRP QTDQ+ LPPY +LD I+   +E+    + + +E     Y ++ VR +   
Sbjct: 453 KAPSAELRPDQTDQDDLPPYEVLDPILHAYIED----LKDPEEIIAMGYEEKIVRDIVRR 508

Query: 522 LYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHISE 561
           +  +EYKRRQA  G K+T+K+FG  R YP++ +F+D   E
Sbjct: 509 VVRNEYKRRQAAPGLKLTSKAFGEGRRYPVAQRFKDQDGE 548


>gi|289577867|ref|YP_003476494.1| NAD+ synthetase [Thermoanaerobacter italicus Ab9]
 gi|289527580|gb|ADD01932.1| NAD+ synthetase [Thermoanaerobacter italicus Ab9]
          Length = 543

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 226/565 (40%), Positives = 325/565 (57%), Gaps = 36/565 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQ+NPVVGDI GN  K       A  Q  DL++F EL   GYPP+D +F + F++
Sbjct: 1   MKIALAQINPVVGDIKGNFEKIVEFINRAKYQKADLVVFPELATVGYPPKDFLFMQDFLK 60

Query: 65  ACSSAIDTLK-SDTHDGGAGIVVGFPRQDQEGVL-NSVVILDAGNIIAVRDKINLPNYSE 122
           A    ++ +    T+    G+++G  RQD EG L NS   +  G I+ V DK  LPNY  
Sbjct: 61  ANEKYVNEIVLPATYQ--IGVILGTVRQDTEGNLYNSAFFIYDGKIVEVFDKTLLPNYDV 118

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKN----------SNICKHLKKQGAEFLF 172
           F EKR F          F+ I+LG+ ICEDIWK+           ++ +   K   +   
Sbjct: 119 FDEKRYFKPAQLRKVASFKGIKLGVNICEDIWKDYVFEPNVDYSVDVLEEQHKLKPDIFI 178

Query: 173 SLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQ 232
           +++ASPYY  K   R E++  +I    +P IYVNQVG  DELIFDG+SF  + + +   Q
Sbjct: 179 NISASPYYLGKQNMRVEMIEKKIKKYAIPFIYVNQVGANDELIFDGSSFVVNEEGKRVVQ 238

Query: 233 MKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNF 292
           +K F E   + +    +   +   M +D +             YNA VL +RDY +K+ F
Sbjct: 239 LKAFEEDIKIVDIDELKNFKELPEMKEDISWV-----------YNALVLGVRDYCKKSGF 287

Query: 293 HKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDV 352
            K ++GLSGGIDSA+  AIAV+ALGKENV  + +P +Y+S  S  DA   A  LG ++ V
Sbjct: 288 KKAVVGLSGGIDSAVVCAIAVEALGKENVFAVSMPSRYSSEGSKSDARILADNLGIEFRV 347

Query: 353 LPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEIS 412
           +PI  +   + S+ +         +  ENIQ+RIRGN LM +SN    ++LTT NKSE++
Sbjct: 348 IPIEPVFESYLSVFNG-DNSAIGDLAEENIQARIRGNYLMFISNREGHIVLTTGNKSELA 406

Query: 413 VGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAE 472
           +GY TLYGDMSG   P+ D+ KT V++LA + N            E+IP SI+EK+PSAE
Sbjct: 407 MGYCTLYGDMSGSLAPIADVPKTMVYELAKYINRK---------KEIIPISIIEKAPSAE 457

Query: 473 LRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQ 531
           LRP+Q D++SLPPY +LD+I+K  +E   S     ++ Y+++ V+ V + +   EYKR+Q
Sbjct: 458 LRPNQKDEDSLPPYKVLDEILKMYIEENRSVKEIVEKGYDEKLVKDVINKVNRVEYKRKQ 517

Query: 532 APVGTKITAKSFGRDRLYPISNKFR 556
           A    K+T K+FG  R  PI + F+
Sbjct: 518 AAPVLKVTTKAFGIGRRMPIVHNFK 542


>gi|256371064|ref|YP_003108888.1| NAD+ synthetase [Acidimicrobium ferrooxidans DSM 10331]
 gi|256007648|gb|ACU53215.1| NAD+ synthetase [Acidimicrobium ferrooxidans DSM 10331]
          Length = 571

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 233/584 (39%), Positives = 322/584 (55%), Gaps = 43/584 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           ++ L I  AQLN  VG +  N    R A E A   G+D++ F EL ++GYPPEDL+ K +
Sbjct: 1   MRSLVIQAAQLNLTVGAVRRNRDAVRAAIESARAAGVDVVAFPELTLTGYPPEDLLLKPA 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVL-NSVVILDAGNIIAVRDKINLPNY 120
           FI+   +A+D L     D  A  VVGF   D+E  L NS  +L  G + AV  K  LPNY
Sbjct: 61  FIEEQRAALDELAGSCRDIVA--VVGF--VDRESDLHNSAAVLADGAVQAVYHKQLLPNY 116

Query: 121 SEFHEKRTFISGYSNDPIV-FRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           + F E R F  G    P+V    +RLG+ ICED W  +         GAE +  +NASPY
Sbjct: 117 TVFDEARYFQPGSVAPPVVEVNGVRLGLAICEDAWSPTGAIMQAAVAGAEVVVVINASPY 176

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
              +   R  +V  + +  H+ + YVN VGGQDEL+FDG SF  D    +  +   F E 
Sbjct: 177 EAGRQATRERLVAVRAADAHVAVSYVNLVGGQDELVFDGGSFVVDAVGAVIARAPQFREA 236

Query: 240 NFMTEW-----HYDQQLSQWNY-----MSDDSASTMY----------IPLQEEEAD---- 275
           N + E       Y Q+L           S + A  +           +PL     D    
Sbjct: 237 NLVVELELRGDRYRQRLVDPRGKVALGTSSEPAVRLATPGVRVARDPMPLAPAPVDGFDP 296

Query: 276 ---YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTS 332
              Y A VL+  DYV+K      ++ +SGGIDSAL A IAVDALG + +  + LP +Y+S
Sbjct: 297 GEVYAALVLATSDYVRKTGVPGALVAVSGGIDSALVATIAVDALGPDALTLVALPSRYSS 356

Query: 333 PQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILM 392
             SL DA   A  LG   +V+ I         ++S       SG+V EN+QSR+RG ++M
Sbjct: 357 EGSLRDARLLADRLGVTLEVIAIEPAHAALLEMLSPATAT--SGVVEENLQSRVRGTVMM 414

Query: 393 ALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSG 452
           ALSN S  ++LTT NKSE++VGY TLYGDM+GGF  L+DLYK QV+ LA W N     +G
Sbjct: 415 ALSNASGRLVLTTGNKSELAVGYSTLYGDMAGGFAVLRDLYKEQVYALARWVNDR---AG 471

Query: 453 LGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQEYND 512
           +    + IP +IL K PSAELRP Q D +SLPPY ILD +++ ++ +E+      +  + 
Sbjct: 472 I----DRIPTAILAKPPSAELRPGQLDTDSLPPYEILDRVLRSLI-DEDRTAAECEGVDP 526

Query: 513 ETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           E  R +E ++  +EYKRRQ P+G +I+ ++FG+DR  PI N++R
Sbjct: 527 ELARTIEAMVDRAEYKRRQGPIGPRISERAFGKDRRMPIVNRWR 570


>gi|254251714|ref|ZP_04945032.1| NAD+ synthase [Burkholderia dolosa AUO158]
 gi|124894323|gb|EAY68203.1| NAD+ synthase [Burkholderia dolosa AUO158]
          Length = 607

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 231/580 (39%), Positives = 335/580 (57%), Gaps = 41/580 (7%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           K ++A+AQ+N  VGD AGN+ +   A   A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 44  KTRLALAQINVTVGDFAGNVERIVAAARAAHDDGAQLMVTPELALSGYPPEDLLLRPAFY 103

Query: 64  QACSSAIDTLKSDTHD-GGAGIVVGFP-RQD--------------QEGV-----LNSVVI 102
            A ++++  L        G  ++VG P R D              + GV      N+V +
Sbjct: 104 AAAAASLHALADALKAFDGLAVLVGHPLRGDARAPAVDSNANGPIERGVPPVDTYNAVSL 163

Query: 103 LDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNIC 160
           +  G I+    K +LPN   F EKR F +    +P+VF    ++ G++ICED W +++  
Sbjct: 164 IVGGEIVGTYRKQDLPNAEVFDEKRYFAT--DAEPLVFELNGVKFGVIICEDAW-HASAA 220

Query: 161 KHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGAS 220
           +  K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG S
Sbjct: 221 QIAKAAGAQVLLIPNGSPYHMNKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFDGGS 280

Query: 221 FCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACV 280
           F  DGQ  L  Q+  F E + + E+   Q L             +   L  E   Y A V
Sbjct: 281 FVLDGQGALVAQLPQFDEAHAIVEFDGAQPLR----------GAIAPALSLEAQVYRALV 330

Query: 281 LSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAA 340
           L +RDY+ KN F   IIGLSGG+DSAL  A+A DALG E V+ +M+P ++T+  S  DAA
Sbjct: 331 LGVRDYIGKNGFPGAIIGLSGGVDSALVLALACDALGPERVRAVMMPSRFTADISTADAA 390

Query: 341 ACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKA 400
             A+ +G +YD + I  + + F + ++            ENIQ+RIRG +LMALSN   +
Sbjct: 391 EMARRVGVRYDEIAIAPMFDAFRAALADEFAGLAEDATEENIQARIRGTLLMALSNKFGS 450

Query: 401 MLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVI 460
           ++LTT NKSE++VGY TLYGDM+GGF  LKD+ KT V++L  +RN+    +    + +VI
Sbjct: 451 IVLTTGNKSEMAVGYCTLYGDMAGGFAVLKDIAKTLVYRLCRYRNATTDYA----VRDVI 506

Query: 461 PPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVE 519
           P  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y    V  V 
Sbjct: 507 PERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYAQADVERVT 566

Query: 520 HLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
            L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + +
Sbjct: 567 RLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFTERL 606


>gi|53725163|ref|YP_102509.1| NAD synthetase [Burkholderia mallei ATCC 23344]
 gi|67639855|ref|ZP_00438685.1| glutamine-dependent NAD(+) synthetase [Burkholderia mallei GB8
           horse 4]
 gi|124383580|ref|YP_001028956.1| NAD synthetase [Burkholderia mallei NCTC 10229]
 gi|167844790|ref|ZP_02470298.1| NAD synthetase [Burkholderia pseudomallei B7210]
 gi|167910020|ref|ZP_02497111.1| NAD synthetase [Burkholderia pseudomallei 112]
 gi|167918051|ref|ZP_02505142.1| NAD synthetase [Burkholderia pseudomallei BCC215]
 gi|254199416|ref|ZP_04905782.1| glutamine dependent NAD+ synthetase [Burkholderia mallei FMH]
 gi|254357888|ref|ZP_04974161.1| glutamine dependent NAD+ synthetase [Burkholderia mallei
           2002721280]
 gi|52428586|gb|AAU49179.1| glutamine dependent NAD+ synthetase [Burkholderia mallei ATCC
           23344]
 gi|124291600|gb|ABN00869.1| glutamine-dependent NAD(+) synthetase [Burkholderia mallei NCTC
           10229]
 gi|147749012|gb|EDK56086.1| glutamine dependent NAD+ synthetase [Burkholderia mallei FMH]
 gi|148027015|gb|EDK85036.1| glutamine dependent NAD+ synthetase [Burkholderia mallei
           2002721280]
 gi|238520463|gb|EEP83923.1| glutamine-dependent NAD(+) synthetase [Burkholderia mallei GB8
           horse 4]
          Length = 566

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 238/588 (40%), Positives = 340/588 (57%), Gaps = 56/588 (9%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF- 62
           K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPAFY 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEG-----VLNSVV 101
             + ++            G  ++VG P                R  + G       N+  
Sbjct: 62  AASDAALAALAAQLKPLAGLAVLVGHPLRAAGAGASSADGNANRPIERGAAPVDTYNAAS 121

Query: 102 ILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNI 159
           ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W +++ 
Sbjct: 122 LIVGGGVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HASA 178

Query: 160 CKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGA 219
            +  K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG 
Sbjct: 179 AQLAKAAGAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFDGG 238

Query: 220 SFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEEAD 275
           SF  DG  +L  +M  F E + + E+              D A  +  P    L  E   
Sbjct: 239 SFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEAQV 284

Query: 276 YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQS 335
           Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+  S
Sbjct: 285 YRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTADIS 344

Query: 336 LEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNILM 392
             DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +LM
Sbjct: 345 TTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTLLM 401

Query: 393 ALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSG 452
           ALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+      
Sbjct: 402 ALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEYGA 461

Query: 453 LGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYN 511
           L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y 
Sbjct: 462 L----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYA 517

Query: 512 DETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 518 EADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 565


>gi|271964118|ref|YP_003338314.1| NAD(+) synthase [Streptosporangium roseum DSM 43021]
 gi|270507293|gb|ACZ85571.1| NAD(+) synthase (glutamine-hydrolyzing) [Streptosporangium roseum
           DSM 43021]
          Length = 597

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 228/600 (38%), Positives = 325/600 (54%), Gaps = 47/600 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L+IA+AQ +PVVGD+A N  K       A  +G  L++FTE+F++GYP EDLV + S
Sbjct: 4   VAQLRIALAQTDPVVGDLAANADKLVEWTRRAAGRGAHLVVFTEMFLTGYPVEDLVLRSS 63

Query: 62  FIQACSSAIDTLKSDTHDGGAG---IVVGF-------PR--QDQEGVLNSVVILDAGNII 109
           F++A ++A++ L     D G G    VVG+       PR  Q +   L++  +L  G ++
Sbjct: 64  FVEASTAAVEALARRLADEGLGEIPAVVGYVDRADLAPRVGQPKGAPLDAAALLHRGRVV 123

Query: 110 AVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAE 169
               K +LPNY  F E R F+ G          + + I +CED+W+       + + GA 
Sbjct: 124 TKTAKHHLPNYGVFDEYRYFVRGDRLPIFRLHGVDVAIAVCEDLWQEGGPVAVVAEAGAG 183

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            L   NASPY   K   R  +V+ +       + Y NQVGGQDEL+FDG S       +L
Sbjct: 184 LLVVPNASPYEKEKDDVRLALVSRRAREAGCALAYANQVGGQDELVFDGDSIIVSASGEL 243

Query: 230 AFQMKHFSEQNFMTEWHY-DQQLSQWNYMSDDSASTMYIPLQEEEAD------------- 275
             +   F+E+  +T+    + +         D+     I ++  E               
Sbjct: 244 VARAAQFAEELLVTDLELPEARFGGLGTFQVDAGDGTVITVERLELSAFPVEPYAPEPPS 303

Query: 276 -----------YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTI 324
                      Y+A VL++RDYV KN F  VI+GLSGGIDSAL A IA DA+G + V  +
Sbjct: 304 IAPHLDDIAEVYSALVLAVRDYVAKNGFQSVILGLSGGIDSALTATIASDAIGPDRVHVV 363

Query: 325 MLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQS 384
           M+P +Y+S  SLEDA       G    ++PI D+V+ F        + E SG+ AEN+Q+
Sbjct: 364 MMPSRYSSEHSLEDAWELVNRQGVNARIVPIADIVDSFEK------EIELSGLAAENLQA 417

Query: 385 RIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWR 444
           R+RG ILM LSN    ++LTT NKSE++ GY TLYGD +GGF P+KD+ KT V++L+ WR
Sbjct: 418 RVRGMILMGLSNQHGHLVLTTGNKSELATGYSTLYGDSAGGFAPIKDVLKTLVWKLSRWR 477

Query: 445 NSHGITSGL---GPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEE 501
           N+    SG    G     IP + +EK PSAELRP Q D +SLP Y +LD ++   VE + 
Sbjct: 478 NAQAGRSGAFLHGFAVPPIPENSIEKEPSAELRPDQRDTDSLPEYDVLDRLLDDYVEKDM 537

Query: 502 SFINNDQEYNDET-VRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHIS 560
                    +D   V  +  L+  +EYKRRQ P G KIT K+FGRDR  PI+N +R+ I+
Sbjct: 538 GSAELIAAGHDPALVARIIRLVDLAEYKRRQYPPGPKITPKNFGRDRRLPITNHWRETIA 597


>gi|254197010|ref|ZP_04903434.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           S13]
 gi|169653753|gb|EDS86446.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           S13]
          Length = 609

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 238/590 (40%), Positives = 341/590 (57%), Gaps = 56/590 (9%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +
Sbjct: 43  VMKTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPA 102

Query: 62  F-IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEG-----VLNS 99
           F   + ++            G  ++VG P                R  + G       N+
Sbjct: 103 FYAASDAALAALAAQLKPLAGLAVLVGHPLRAAGAGASSADGNANRPIERGAAPVDTYNA 162

Query: 100 VVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNS 157
             ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W ++
Sbjct: 163 ASLIVGGGVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HA 219

Query: 158 NICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFD 217
           +  +  K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FD
Sbjct: 220 SAAQLAKAAGAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFD 279

Query: 218 GASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEE 273
           G SF  DG  +L  +M  F E + + E+              D A  +  P    L  E 
Sbjct: 280 GGSFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEA 325

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+ 
Sbjct: 326 QVYRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTAD 385

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNI 390
            S  DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +
Sbjct: 386 ISTTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTL 442

Query: 391 LMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGIT 450
           LMALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+    
Sbjct: 443 LMALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEY 502

Query: 451 SGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQE 509
             L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          
Sbjct: 503 GAL----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAG 558

Query: 510 YNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           Y +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 559 YAEADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 608


>gi|121600205|ref|YP_993581.1| NAD synthetase [Burkholderia mallei SAVP1]
 gi|126451392|ref|YP_001081129.1| NAD synthetase [Burkholderia mallei NCTC 10247]
 gi|251768136|ref|ZP_02269590.2| glutamine-dependent NAD(+) synthetase [Burkholderia mallei PRL-20]
 gi|254177493|ref|ZP_04884148.1| glutamine dependent NAD+ synthetase [Burkholderia mallei ATCC
           10399]
 gi|254205731|ref|ZP_04912083.1| glutamine dependent NAD+ synthetase [Burkholderia mallei JHU]
 gi|121229015|gb|ABM51533.1| glutamine dependent NAD+ synthetase [Burkholderia mallei SAVP1]
 gi|126244262|gb|ABO07355.1| glutamine-dependent NAD(+) synthetase [Burkholderia mallei NCTC
           10247]
 gi|147753174|gb|EDK60239.1| glutamine dependent NAD+ synthetase [Burkholderia mallei JHU]
 gi|160698532|gb|EDP88502.1| glutamine dependent NAD+ synthetase [Burkholderia mallei ATCC
           10399]
 gi|243060709|gb|EES42895.1| glutamine-dependent NAD(+) synthetase [Burkholderia mallei PRL-20]
          Length = 609

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 238/590 (40%), Positives = 341/590 (57%), Gaps = 56/590 (9%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +
Sbjct: 43  VMKTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPA 102

Query: 62  F-IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEG-----VLNS 99
           F   + ++            G  ++VG P                R  + G       N+
Sbjct: 103 FYAASDAALAALAAQLKPLAGLAVLVGHPLRAAGAGASSADGNANRPIERGAAPVDTYNA 162

Query: 100 VVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNS 157
             ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W ++
Sbjct: 163 ASLIVGGGVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HA 219

Query: 158 NICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFD 217
           +  +  K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FD
Sbjct: 220 SAAQLAKAAGAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFD 279

Query: 218 GASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEE 273
           G SF  DG  +L  +M  F E + + E+              D A  +  P    L  E 
Sbjct: 280 GGSFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEA 325

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+ 
Sbjct: 326 QVYRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTAD 385

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNI 390
            S  DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +
Sbjct: 386 ISTTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTL 442

Query: 391 LMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGIT 450
           LMALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+    
Sbjct: 443 LMALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEY 502

Query: 451 SGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQE 509
             L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          
Sbjct: 503 GAL----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAG 558

Query: 510 YNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           Y +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 559 YAEADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 608


>gi|161524057|ref|YP_001579069.1| NAD synthetase [Burkholderia multivorans ATCC 17616]
 gi|189351182|ref|YP_001946810.1| NAD synthetase [Burkholderia multivorans ATCC 17616]
 gi|160341486|gb|ABX14572.1| NAD+ synthetase [Burkholderia multivorans ATCC 17616]
 gi|189335204|dbj|BAG44274.1| NAD+ synthase [Burkholderia multivorans ATCC 17616]
          Length = 566

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 233/580 (40%), Positives = 336/580 (57%), Gaps = 38/580 (6%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           K ++A+AQ+N  VGD AGN+A+   A   A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRLALAQINVTVGDFAGNVARIVAAARAAHEDGAHLMIAPELALSGYPPEDLLLRPAFY 61

Query: 64  QACSSAIDTLKSDTHD-GGAGIVVGFPRQDQEGV-----------------LNSVVILDA 105
              ++A+D L        G  ++VG P +   GV                  N+  ++  
Sbjct: 62  AEAAAALDALADALKPFDGLAVLVGHPLRGAPGVDGNANRPIERGVPPVDTYNAASLIVG 121

Query: 106 GNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHL 163
           G I+    K +LPN   F EKR F +    +P+VF    +R G++ICED W +++  +  
Sbjct: 122 GRIVGTYRKQDLPNAEVFDEKRYFAT--DAEPLVFELNGVRFGVIICEDAW-HASAAQIA 178

Query: 164 KKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCF 223
           K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG SF  
Sbjct: 179 KAAGAQVLLIPNGSPYHMNKEAVRVDILRARIRETGLPMVYVNLVGGQDELVFDGGSFVL 238

Query: 224 DGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSL 283
           DGQ  L  QM  F E + + E+   + L             +  PL  +   Y A VL +
Sbjct: 239 DGQGALVAQMPQFDEGHAIVEFDGARPLP----------GAIAPPLPVDAQVYRALVLGV 288

Query: 284 RDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACA 343
           RDY+ KN F   +IGLSGG+DSAL  A+A DALG E V+ +M+P +YT+  S  DAA  A
Sbjct: 289 RDYIGKNGFPGALIGLSGGVDSALVLAVACDALGPERVRAVMMPSRYTADISTTDAADMA 348

Query: 344 KALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLL 403
           + +G +YD + I  + + F + ++            ENIQ+RIRG +LMALSN   +++L
Sbjct: 349 RRVGVRYDEIAIAPMFDAFRAALAAEFAGRAEDATEENIQARIRGTLLMALSNKFGSIVL 408

Query: 404 TTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPS 463
           TT NKSE++VGY TLYGDM+GGF  LKD+ KT V++L  +RN+   TS  G   ++IP  
Sbjct: 409 TTGNKSEMAVGYCTLYGDMAGGFAVLKDIAKTLVYRLCRYRNA---TSDYG-RRDIIPER 464

Query: 464 ILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLL 522
           IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y    V  V  L+
Sbjct: 465 ILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYAPADVARVTRLI 524

Query: 523 YGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHISEE 562
             +EYKRRQAP+G ++T ++FGRD  YPI+++F + + E 
Sbjct: 525 KLNEYKRRQAPIGIRVTHRAFGRDWRYPITSRFTERLGER 564


>gi|254298299|ref|ZP_04965751.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           406e]
 gi|157808118|gb|EDO85288.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           406e]
          Length = 609

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 238/590 (40%), Positives = 341/590 (57%), Gaps = 56/590 (9%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +
Sbjct: 43  VMKTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPA 102

Query: 62  F-IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEG-----VLNS 99
           F   + ++            G  ++VG P                R  + G       N+
Sbjct: 103 FYAASDAALAALAAQLKPLAGLAVLVGHPLRAAGAGASSADGNANRPIERGAAPVDTYNA 162

Query: 100 VVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNS 157
             ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W ++
Sbjct: 163 ASLIVGGEVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HA 219

Query: 158 NICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFD 217
           +  +  K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FD
Sbjct: 220 SAAQLAKAAGAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFD 279

Query: 218 GASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEE 273
           G SF  DG  +L  +M  F E + + E+              D A  +  P    L  E 
Sbjct: 280 GGSFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEA 325

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+ 
Sbjct: 326 QVYRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTAD 385

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNI 390
            S  DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +
Sbjct: 386 ISTTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTL 442

Query: 391 LMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGIT 450
           LMALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+    
Sbjct: 443 LMALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEY 502

Query: 451 SGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQE 509
             L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          
Sbjct: 503 GAL----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAG 558

Query: 510 YNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           Y +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 559 YAEADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 608


>gi|53718666|ref|YP_107652.1| NAD synthetase [Burkholderia pseudomallei K96243]
 gi|52209080|emb|CAH35021.1| putative glutamine-dependent NAD synthase [Burkholderia
           pseudomallei K96243]
          Length = 576

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 238/590 (40%), Positives = 341/590 (57%), Gaps = 56/590 (9%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +
Sbjct: 10  VMKTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPA 69

Query: 62  F-IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEGVL-----NS 99
           F   + ++            G  ++VG P                R  + G       N+
Sbjct: 70  FYAASDAALAALAAQLKPLAGLAVLVGHPLRAAGAGASSADGNANRPIERGAAPVDTYNA 129

Query: 100 VVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNS 157
             ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W ++
Sbjct: 130 ASLIVGGEVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HA 186

Query: 158 NICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFD 217
           +  +  K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FD
Sbjct: 187 SAAQLAKAAGAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFD 246

Query: 218 GASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEE 273
           G SF  DG  +L  +M  F E + + E+              D A  +  P    L  E 
Sbjct: 247 GGSFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEA 292

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+ 
Sbjct: 293 QVYRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTAD 352

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNI 390
            S  DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +
Sbjct: 353 ISTTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTL 409

Query: 391 LMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGIT 450
           LMALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+    
Sbjct: 410 LMALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEY 469

Query: 451 SGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQE 509
             L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          
Sbjct: 470 GAL----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAG 525

Query: 510 YNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           Y +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 526 YAEADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 575


>gi|167823227|ref|ZP_02454698.1| NAD synthetase [Burkholderia pseudomallei 9]
 gi|217419898|ref|ZP_03451404.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           576]
 gi|226194412|ref|ZP_03790010.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           Pakistan 9]
 gi|217397202|gb|EEC37218.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           576]
 gi|225933497|gb|EEH29486.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           Pakistan 9]
          Length = 566

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 238/588 (40%), Positives = 340/588 (57%), Gaps = 56/588 (9%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF- 62
           K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPAFY 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEG-----VLNSVV 101
             + ++            G  ++VG P                R  + G       N+  
Sbjct: 62  AASDAALAALAAQLKPLAGLAVLVGHPLRAAGAGASSADGNANRPIERGAAPVDTYNAAS 121

Query: 102 ILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNI 159
           ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W +++ 
Sbjct: 122 LIVGGEVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HASA 178

Query: 160 CKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGA 219
            +  K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG 
Sbjct: 179 AQLAKAAGAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFDGG 238

Query: 220 SFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEEAD 275
           SF  DG  +L  +M  F E + + E+              D A  +  P    L  E   
Sbjct: 239 SFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEAQV 284

Query: 276 YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQS 335
           Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+  S
Sbjct: 285 YRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTADIS 344

Query: 336 LEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNILM 392
             DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +LM
Sbjct: 345 TTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTLLM 401

Query: 393 ALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSG 452
           ALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+      
Sbjct: 402 ALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEYGA 461

Query: 453 LGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYN 511
           L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y 
Sbjct: 462 L----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYA 517

Query: 512 DETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 518 EADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 565


>gi|167900233|ref|ZP_02487634.1| NAD synthetase [Burkholderia pseudomallei 7894]
          Length = 567

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 238/589 (40%), Positives = 340/589 (57%), Gaps = 57/589 (9%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF- 62
           K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPAFY 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFP-----------------RQDQEG-----VLNSV 100
             + ++            G  ++VG P                 R  + G       N+ 
Sbjct: 62  AASDAALAALAAQLKPLAGLAVLVGHPLRAAGGAAASSADGNANRPIERGAAPVDTYNAA 121

Query: 101 VILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSN 158
            ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W +++
Sbjct: 122 SLIVGGGVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HAS 178

Query: 159 ICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDG 218
             +  K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG
Sbjct: 179 AAQLAKAAGAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFDG 238

Query: 219 ASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEEA 274
            SF  DG  +L  +M  F E + + E+              D A  +  P    L  E  
Sbjct: 239 GSFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEAQ 284

Query: 275 DYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQ 334
            Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+  
Sbjct: 285 VYRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTADI 344

Query: 335 SLEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNIL 391
           S  DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +L
Sbjct: 345 STTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTLL 401

Query: 392 MALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITS 451
           MALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+     
Sbjct: 402 MALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEYG 461

Query: 452 GLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEY 510
            L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y
Sbjct: 462 AL----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGY 517

Query: 511 NDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
            +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 518 AEADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 566


>gi|167718609|ref|ZP_02401845.1| NAD synthetase [Burkholderia pseudomallei DM98]
          Length = 567

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 238/589 (40%), Positives = 340/589 (57%), Gaps = 57/589 (9%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF- 62
           K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPAFY 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFP-----------------RQDQEG-----VLNSV 100
             + ++            G  ++VG P                 R  + G       N+ 
Sbjct: 62  AASDAALAALAAQLKPLAGLAVLVGHPLRVAGGAAASSADGNANRPIERGAAPVDTYNAA 121

Query: 101 VILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSN 158
            ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W +++
Sbjct: 122 SLIVGGEVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HAS 178

Query: 159 ICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDG 218
             +  K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG
Sbjct: 179 AAQLAKAAGAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFDG 238

Query: 219 ASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEEA 274
            SF  DG  +L  +M  F E + + E+              D A  +  P    L  E  
Sbjct: 239 GSFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEAQ 284

Query: 275 DYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQ 334
            Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+  
Sbjct: 285 VYRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTADI 344

Query: 335 SLEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNIL 391
           S  DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +L
Sbjct: 345 STTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTLL 401

Query: 392 MALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITS 451
           MALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+     
Sbjct: 402 MALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEYG 461

Query: 452 GLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEY 510
            L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y
Sbjct: 462 AL----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGY 517

Query: 511 NDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
            +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 518 AEADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 566


>gi|134281251|ref|ZP_01767960.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           305]
 gi|134247557|gb|EBA47642.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           305]
          Length = 610

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 238/591 (40%), Positives = 341/591 (57%), Gaps = 57/591 (9%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +
Sbjct: 43  VMKTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPA 102

Query: 62  F-IQACSSAIDTLKSDTHDGGAGIVVGFP-----------------RQDQEG-----VLN 98
           F   + ++            G  ++VG P                 R  + G       N
Sbjct: 103 FYAASDAALAALAAQLKPLAGLAVLVGHPLRAAGGAAASSADGNANRPIERGAAPVDTYN 162

Query: 99  SVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKN 156
           +  ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W +
Sbjct: 163 AASLIVGGEVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-H 219

Query: 157 SNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIF 216
           ++  +  K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+F
Sbjct: 220 ASAAQLAKAAGAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMVYVNLVGGQDELVF 279

Query: 217 DGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEE 272
           DG SF  DG  +L  +M  F E + + E+              D A  +  P    L  E
Sbjct: 280 DGGSFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVE 325

Query: 273 EADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTS 332
              Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+
Sbjct: 326 AQVYRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTA 385

Query: 333 PQSLEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGN 389
             S  DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG 
Sbjct: 386 DISTTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGT 442

Query: 390 ILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGI 449
           +LMALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+   
Sbjct: 443 LLMALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAE 502

Query: 450 TSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQ 508
              L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +         
Sbjct: 503 YGAL----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAA 558

Query: 509 EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
            Y +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 559 GYAEADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 609


>gi|166713131|ref|ZP_02244338.1| NAD synthetase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 546

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 233/572 (40%), Positives = 319/572 (55%), Gaps = 44/572 (7%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGN-------IAKARRAREEANRQGMDLILFTELFISGYPP 53
           M + L+IA+AQ +  VG +  N       IA AR   E       D++LF EL ISGYPP
Sbjct: 1   MSQTLRIAMAQFDFPVGGVTQNTDRIIEYIAAARDEFE------ADIVLFPELAISGYPP 54

Query: 54  EDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRD 113
           EDL+ +  F+  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   
Sbjct: 55  EDLLLRPGFLAHCEQALARIAAATR--GIVAVVGWPQSAGSVVYNAASVLRDGRIAATYR 112

Query: 114 KINLPNYSEFHEKRTFISGYSNDP------IVFRDIRLGILICEDIWKNSNICKHLKKQG 167
           K  LPNY+ F E+R F      DP      +  + +++G++ICED+W    +   +K  G
Sbjct: 113 KRELPNYAVFDERRYF----DVDPDGENCVVTVKGVQVGVVICEDLWFPEPLANTVKA-G 167

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
           AE +   NASPY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG  
Sbjct: 168 AEVVLVPNASPYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDG 227

Query: 228 QLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYV 287
            +      F +Q  + ++    +        DD   +M      +   + A V  L+DY 
Sbjct: 228 SVHPAAAAFVDQWLVVDYAAQARRFTPVVWVDDGDESM------DALAWRAVVRGLQDYC 281

Query: 288 QKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALG 347
           +KN F KV +GLSGGIDSAL  A+AVDALG +NV  + LP +YT+  S + AA    ALG
Sbjct: 282 RKNGFGKVWLGLSGGIDSALVLAMAVDALGSDNVTAVRLPSRYTAGLSNDLAAEQCDALG 341

Query: 348 CKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSN 407
            K + + I        + +          I  EN+QSR RG ILMALSN    +LLTT N
Sbjct: 342 VKLETVAIEPAFEGLLAALGPLFAGTEPDITEENLQSRSRGVILMALSNKFGGLLLTTGN 401

Query: 408 KSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEK 467
           KSE +VGY T+YGDM GG+ PLKDLYKT+VF LA WRN    T G  P   VIPP+++ +
Sbjct: 402 KSEYAVGYATIYGDMCGGYAPLKDLYKTEVFGLAKWRN----TVGGAP---VIPPAVISR 454

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYG 524
            PSAELR +QTDQ+SLPPY +LD I+ R V+ E+S   +D     Y  ETV +V  L+  
Sbjct: 455 PPSAELRDNQTDQDSLPPYDVLDGILYRYVDQEQS--RDDIVAAGYAAETVEHVLRLVRL 512

Query: 525 SEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           +E+KR QA  G K++ ++FGR+R YPI+N +R
Sbjct: 513 NEWKRHQAAPGPKVSRRAFGRERRYPITNGYR 544


>gi|294666976|ref|ZP_06732205.1| NAD + synthase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|292603265|gb|EFF46687.1| NAD + synthase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 546

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 230/572 (40%), Positives = 321/572 (56%), Gaps = 44/572 (7%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGN-------IAKARRAREEANRQGMDLILFTELFISGYPP 53
           M + L+IA+AQ +  VG +  N       IA AR   E       D++LF EL ISGYPP
Sbjct: 1   MSQTLRIAMAQFDFPVGGVTQNTDRIIEYIAAARDEFE------ADIVLFPELAISGYPP 54

Query: 54  EDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRD 113
           EDL+ +  F+  C  A+  + + TH  G   VVG+P+     V N+  +L  G I A   
Sbjct: 55  EDLLLRPGFLAHCEQALARIAAATH--GIVAVVGWPQSAGSVVYNAASVLRDGRIEATYR 112

Query: 114 KINLPNYSEFHEKRTFISGYSNDP------IVFRDIRLGILICEDIWKNSNICKHLKKQG 167
           K  LPNY+ F E+R F      DP      +  + +R+G++ICED+W    +   ++  G
Sbjct: 113 KRELPNYAVFDERRYF----DVDPDGENCVVTVKGVRVGVVICEDLWFAEPLANTVRA-G 167

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
           AE +   NASPY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG  
Sbjct: 168 AELVLVPNASPYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDG 227

Query: 228 QLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYV 287
            +      F +Q  + ++   ++        DD   +M      +   + A V  L+DY 
Sbjct: 228 TVHPAAAAFVDQWLVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYC 281

Query: 288 QKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALG 347
           +KN F KV +GLSGGIDSAL  A+AVDALG +NV  + LP +YT+  S + A    +ALG
Sbjct: 282 RKNGFSKVWLGLSGGIDSALVLAMAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALG 341

Query: 348 CKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSN 407
            K + + I          +    +     I  EN+QSR RG ILMALSN    ++LTT N
Sbjct: 342 VKLETIAIEPAFEGLLGALGPMFEGTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGN 401

Query: 408 KSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEK 467
           KSE +VGY T+YGDM GG+ PLKDLYKT+VF LA WRN    T G  P   VIPP+++ +
Sbjct: 402 KSEYAVGYATIYGDMCGGYAPLKDLYKTEVFGLAKWRN----TVGGAP---VIPPAVISR 454

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYG 524
            PSAELR +QTDQ+SLPPY +LD I+ R V+ E+S   +D     Y  +TV +V  L+  
Sbjct: 455 PPSAELRDNQTDQDSLPPYDVLDGILYRYVDQEQS--RDDIVAAGYAADTVEHVLRLVRL 512

Query: 525 SEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           +E+KR Q+  G K++ ++FGR+R YPI+N +R
Sbjct: 513 NEWKRHQSAPGPKVSRRAFGRERRYPITNGYR 544


>gi|167737637|ref|ZP_02410411.1| NAD synthetase [Burkholderia pseudomallei 14]
          Length = 566

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 237/588 (40%), Positives = 340/588 (57%), Gaps = 56/588 (9%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF- 62
           K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPAFY 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEG-----VLNSVV 101
             + ++            G  ++VG P                R  + G       N+  
Sbjct: 62  AASDAALAALAAQLKPLAGLAVLVGHPLRAAGAGASSADGNANRPIERGAAPVDTYNAAS 121

Query: 102 ILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNI 159
           ++  G ++    K +LPN   F EKR F +  +  P VF    +R G+++CED+W +++ 
Sbjct: 122 LIVGGGVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVLCEDVW-HASA 178

Query: 160 CKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGA 219
            +  K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG 
Sbjct: 179 AQLAKAAGAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFDGG 238

Query: 220 SFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEEAD 275
           SF  DG  +L  +M  F E + + E+              D A  +  P    L  E   
Sbjct: 239 SFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEAQV 284

Query: 276 YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQS 335
           Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+  S
Sbjct: 285 YRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTADIS 344

Query: 336 LEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNILM 392
             DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +LM
Sbjct: 345 TTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTLLM 401

Query: 393 ALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSG 452
           ALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+      
Sbjct: 402 ALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEYGA 461

Query: 453 LGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYN 511
           L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y 
Sbjct: 462 L----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYA 517

Query: 512 DETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 518 EADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 565


>gi|159029185|emb|CAO87545.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 552

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 225/574 (39%), Positives = 333/574 (58%), Gaps = 46/574 (8%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IAIAQLNP+VGDI GN  +   A + A  QG +L+L  EL + GYPP DL+    F++
Sbjct: 1   MRIAIAQLNPIVGDIEGNAQRILEAAQTAFNQGAELLLTPELSLCGYPPRDLLLNLGFVE 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQD-------QEGVLNSVVILDAGNIIAVRDKINL 117
             S  +  L     +  A ++VGF  ++       ++ + NS+ +L +  I  +  K  L
Sbjct: 61  KMSQQLQLLSQQLPEKLA-VLVGFVEKNPSATVRGEKPLFNSIALLKSQEIKQIFTKRLL 119

Query: 118 PNYSEFHEKRTFISGYSND--PIVFRDIRLGILICEDIWKNS----------NICKHLKK 165
           P Y  F E R F SG  +    +   ++++G+ ICED+W +           N    L  
Sbjct: 120 PTYDVFDEDRYFASGKESQYFQLTENNVKIGVTICEDVWNDEQFWGQRQYAVNPIADLAN 179

Query: 166 QGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDG 225
            G + + +L+ASPY   K K R  +++   +  +LPI+YVNQVGG D+LIFDG S  F+ 
Sbjct: 180 LGVDLIVNLSASPYSVGKQKLRESLLSHSATRYNLPIVYVNQVGGNDDLIFDGDSVAFNR 239

Query: 226 QQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRD 285
           Q ++ ++ K F+    + E++ D             A    +P+ E+E  Y A VL ++D
Sbjct: 240 QGEVIYRAKAFTSSLELIEFNQDLL----------PAIIHPLPVDEDEEIYQALVLGVQD 289

Query: 286 YVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKA 345
           YVQK  F +VI GLSGGIDS+L AAIA DALGKENV  +M+P  Y+S  S+ DA A    
Sbjct: 290 YVQKCGFKRVIFGLSGGIDSSLVAAIASDALGKENVLAVMMPSPYSSDHSISDAVALVNN 349

Query: 346 LGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTT 405
           LG K + L I +++  +  L+         GI  EN+QSRIRGN+LMALSN    +LL+T
Sbjct: 350 LGIKSEKLAIKEIMTAYDQLLESLFAGTDFGIAEENLQSRIRGNLLMALSNKFGHLLLST 409

Query: 406 SNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSIL 465
            NKSE++VGY TLYGDM+GG   + D+ KT+V+ L  W N HG         E+IP +++
Sbjct: 410 GNKSEMAVGYCTLYGDMNGGLAVIADVPKTRVYSLCRWLNRHG---------EIIPLNVI 460

Query: 466 EKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ----EYNDETVRYVEHL 521
            K+PSAEL+P+Q DQ+SLPPY ILD I+  +++  +S    +Q     +  E V+ V  L
Sbjct: 461 NKAPSAELKPNQKDQDSLPPYEILDAILALLIDRHQS---AEQIIAAGFEPEIVQKVIKL 517

Query: 522 LYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           +  +E+KR+QAP G KI+ ++FG     PI++++
Sbjct: 518 VKNAEFKRKQAPPGLKISDRAFGTGWRMPIASRW 551


>gi|126441824|ref|YP_001058134.1| NAD synthetase [Burkholderia pseudomallei 668]
 gi|126221317|gb|ABN84823.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           668]
          Length = 566

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 238/588 (40%), Positives = 340/588 (57%), Gaps = 56/588 (9%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF- 62
           K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPAFY 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEG-----VLNSVV 101
             + ++            G  ++VG P                R  + G       N+  
Sbjct: 62  AASDAALAALAAQLKPLAGLAVLVGHPLRAAGAGASSADGNANRPIERGAAPVDTYNAAS 121

Query: 102 ILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNI 159
           ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W +++ 
Sbjct: 122 LIVGGEVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HASA 178

Query: 160 CKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGA 219
            +  K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG 
Sbjct: 179 AQLAKAAGAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFDGG 238

Query: 220 SFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEEAD 275
           SF  DG  +L  +M  F E + + E+              D A  +  P    L  E   
Sbjct: 239 SFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEAQV 284

Query: 276 YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQS 335
           Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+  S
Sbjct: 285 YRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTADIS 344

Query: 336 LEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNILM 392
             DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +LM
Sbjct: 345 TTDAADMAKRVGVRYDEIAIAPMFDAFCASLAAEFAGLAEDAT---EENIQARIRGTLLM 401

Query: 393 ALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSG 452
           ALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+      
Sbjct: 402 ALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEYGA 461

Query: 453 LGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYN 511
           L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y 
Sbjct: 462 L----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYA 517

Query: 512 DETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 518 EADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 565


>gi|120611780|ref|YP_971458.1| NAD+ synthetase [Acidovorax citrulli AAC00-1]
 gi|120590244|gb|ABM33684.1| NAD+ synthetase [Acidovorax citrulli AAC00-1]
          Length = 550

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 231/562 (41%), Positives = 326/562 (58%), Gaps = 29/562 (5%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           I+IAQ N +VGD+ GN  K   A  EA+ QG  L+L  EL + GY  EDL  + +F+ AC
Sbjct: 5   ISIAQFNFIVGDVEGNARKIISAAHEAHAQGAALLLTPELALCGYAAEDLFLRPAFLDAC 64

Query: 67  SSAI-DTLKSDTHDGGAGIVVGFPRQDQEG----VLNSVVILDAGNIIAVRDKINLPNYS 121
             A+ D  ++    G   +VVG P +   G      N+  +L  G +     K  LPNY+
Sbjct: 65  DRALQDIAQATAACGDLAVVVGHPWRSVAGGAERCHNAASVLRGGRVEQTYAKQELPNYA 124

Query: 122 EFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
            F E+R F  G    P VF  + +R+G+LICED W      +  +   A+ L +LNASP+
Sbjct: 125 VFDEQRYFDPG--TQPCVFDVQGVRVGLLICEDAWFPGPAARAAQAG-AQLLATLNASPF 181

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           +  K  +R +I+  +++   LP++Y + VGGQDE++F+G SF  D    +  +   F+E 
Sbjct: 182 HLGKSAEREQIMRERVAETGLPLVYAHLVGGQDEVVFEGRSFALDATGFVGVRAPGFAEA 241

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLRDYVQKNNFHKVIIG 298
                   +  + ++     D A     P+   EAD ++A VL +RDYV KN F  V++G
Sbjct: 242 LVRVVARAEDGVLRFE---PDVA-----PIPAPEADLWSALVLGVRDYVGKNGFPGVLLG 293

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL  AIAVDALG + V+ +M+P  YT+  S  DA   A+ LG +YD + I   
Sbjct: 294 LSGGIDSALVLAIAVDALGPDKVRAVMMPSPYTADISWIDARDMAERLGVRYDEIAIAPQ 353

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
              F + ++            EN+Q+RIRG +LMALSN   +++LTT NKSE++ GY TL
Sbjct: 354 FEAFKAALASEFAGRAEDATEENLQARIRGTLLMALSNKFGSVVLTTGNKSEMATGYCTL 413

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHG-ITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           YGDM+GGF  +KD+ KT V+ LA WRN+H    +G  P    IP  I+ + PSAELRP Q
Sbjct: 414 YGDMAGGFAVIKDVAKTTVYGLARWRNAHDPFGTGASP----IPERIITRPPSAELRPDQ 469

Query: 478 TDQESLPPYPILDDIIKRIVENE---ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPV 534
            DQ+SLPPY +LD I+ R +EN+   ES I     Y    V  V  L+  +EYKRRQ+PV
Sbjct: 470 KDQDSLPPYDVLDAIVGRYMENDEPIESIIAAG--YARADVERVTRLIQVNEYKRRQSPV 527

Query: 535 GTKITAKSFGRDRLYPISNKFR 556
           G ++T +SFG+D  YPI+N+FR
Sbjct: 528 GIRVTRRSFGKDWRYPITNRFR 549


>gi|257054803|ref|YP_003132635.1| NAD+ synthetase [Saccharomonospora viridis DSM 43017]
 gi|256584675|gb|ACU95808.1| NAD+ synthetase [Saccharomonospora viridis DSM 43017]
          Length = 577

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 226/588 (38%), Positives = 329/588 (55%), Gaps = 45/588 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L+IA+AQ+N  VGD++GN          A   G  ++LF E+ + GYP EDL  + +
Sbjct: 1   MPQLRIALAQVNTTVGDLSGNSDLVVEWTRRAASDGAHVVLFPEMALPGYPVEDLALRGA 60

Query: 62  FIQACSSAIDTLKSDTHDGGAG---IVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLP 118
           F +A  +A+  L +   D G G   +VVG+   D  G  N+V  L  G ++A + K +LP
Sbjct: 61  FTEASRAAVTELATAIADAGHGDVCVVVGYLDADDVGPRNAVAALYRGEVVATQYKHHLP 120

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           NY  F E+R F  G +   +    + LG+ ICED+W+       L   G + + +LNASP
Sbjct: 121 NYGVFDERRYFEPGTTLTVLRTHGVDLGLAICEDLWQEGGPVAALGAFGVDLVLALNASP 180

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K   R  +VT + + V  P+ Y N VGGQD+L+FDG SF  D    L  +   F+E
Sbjct: 181 YERAKSDVRVPLVTRRAAEVKAPVAYANLVGGQDDLVFDGGSFVVDADGVLLARAPQFAE 240

Query: 239 QNFMTEWHYDQQLSQWN----------------YMSD---DSASTMYIP-----LQEEEA 274
              + +    ++    +                 +SD   D     Y P     L +E  
Sbjct: 241 HLLVVDLDLPERRGTGDRSRGEARVEGLAVRRRVLSDVPLDPYPVTYRPELAEPLSDEAE 300

Query: 275 DYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQ 334
            ++A V++L+DYV+KNNF  V++G SGGIDSA+ AA+A DALG + V  + +P KY+S  
Sbjct: 301 IWSALVMALQDYVRKNNFRSVLLGFSGGIDSAVVAALAADALGSDAVYGVSMPSKYSSAH 360

Query: 335 SLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMAL 394
           S  DAA  A+ LGC + V P+ ++V  +        Q +  G+  ENIQ+R+RG +LMAL
Sbjct: 361 SRSDAAELARRLGCHFRVEPVENIVAAYVD------QLQLEGVAEENIQARVRGMMLMAL 414

Query: 395 SNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLG 454
           SN    ++L T NK+E++VGY T+YGD  GGF P+KD++KTQV++LA WRN+     G  
Sbjct: 415 SNMEGHLVLATGNKTELAVGYSTIYGDAVGGFAPIKDVFKTQVWELARWRNAEAEKRGET 474

Query: 455 PLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-----NDQE 509
           P    IPP+ + K PSAELRP Q D +SLP Y +LD++++  V  +  F +      D E
Sbjct: 475 P---PIPPNSITKPPSAELRPGQLDTDSLPDYALLDELLENYVGGDRGFADLLAAGFDAE 531

Query: 510 YNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
             D  VR V+     +EYKRRQ P G KIT K+FGRDR  P++N + +
Sbjct: 532 TVDRVVRMVDR----AEYKRRQYPPGPKITFKAFGRDRRLPLTNAWHE 575


>gi|285017483|ref|YP_003375194.1| nad(+) synthase (glutamine-hydrolyzing) protein [Xanthomonas
           albilineans GPE PC73]
 gi|283472701|emb|CBA15206.1| putative nad(+) synthase (glutamine-hydrolyzing) protein
           [Xanthomonas albilineans]
          Length = 549

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 225/574 (39%), Positives = 318/574 (55%), Gaps = 46/574 (8%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEA-NRQGMDLILFTELFISGYPPEDLVFK 59
           ML  L++A+AQ +  VG +  N  +     E+A +  G D++LF EL +SGYPPEDL+ +
Sbjct: 1   MLSSLRLAMAQFDFPVGAVTQNTDRIMALIEQARDAYGADIVLFPELAVSGYPPEDLLLR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
             F+  C  A+  + +  H  G   VVG+P+     V N+  +L  G I A   K  LPN
Sbjct: 61  PGFLADCEQAVQRIAACVH--GVVAVVGWPQSAGSVVYNAASVLRDGRIAATYRKRELPN 118

Query: 120 YSEFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           Y+ F E+R F      +  VF  +  R+G++ICED+W    +   ++  GAE +   NAS
Sbjct: 119 YAVFDERRYFDVDLDGEHCVFDVKGTRVGLVICEDLWFPEPLAVTVRA-GAELVLVPNAS 177

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY   K  +R  ++  +       + Y+N VGGQD L+FDGAS   DG  ++      F+
Sbjct: 178 PYERGKHAQRDALLAERSRESGAALAYLNVVGGQDALVFDGASVVADGDGRVHPAAAAFT 237

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQ------------EEEADYNACVLSLRD 285
           +Q              W  +  D A+  ++PL              E   + A V  ++D
Sbjct: 238 DQ--------------WLVVDYDPAARRFVPLHWRCDSDSASEASSEALAWRAVVRGVQD 283

Query: 286 YVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKA 345
           Y +KN F KV +GLSGGIDSAL  A+AVDALG ENV  + LP +YT+  S + AA   + 
Sbjct: 284 YCRKNGFSKVWLGLSGGIDSALVLAMAVDALGAENVAAVRLPSRYTADLSNDLAAEQCRT 343

Query: 346 LGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTT 405
           LG + + + I          +          +  EN+QSR RG ILMAL+N    +LLTT
Sbjct: 344 LGVRLETVTIEPAFEGVLQALGPLFDGTQPDVTEENLQSRSRGLILMALANKFGGLLLTT 403

Query: 406 SNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSIL 465
            NKSE +VGY T+YGDM GG+ PLKDLYKT+VF LA+WRN+   T        VIPP+++
Sbjct: 404 GNKSEYAVGYATIYGDMCGGYAPLKDLYKTEVFALATWRNTTAATP-------VIPPAVI 456

Query: 466 EKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ----EYNDETVRYVEHL 521
            ++PSAELR +QTDQ+SLPPY +LD I+ R V+ E S    D+     Y  E V  V  L
Sbjct: 457 TRAPSAELRANQTDQDSLPPYDVLDGILYRYVDQEAS---RDEIIAAGYAAEVVDQVIRL 513

Query: 522 LYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           +  +E+KR QA  G K++ ++FGR+R YPISN +
Sbjct: 514 VRITEWKRHQAAPGPKVSRRAFGRERRYPISNGY 547


>gi|330817967|ref|YP_004361672.1| NAD+ synthetase [Burkholderia gladioli BSR3]
 gi|327370360|gb|AEA61716.1| NAD+ synthetase [Burkholderia gladioli BSR3]
          Length = 561

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 235/577 (40%), Positives = 335/577 (58%), Gaps = 39/577 (6%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           K +IA+AQLN  VGD AGN+A+   A   A++ G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVARLVEAARAAHKDGAQLLVAPELALSGYPPEDLLLRPAFF 61

Query: 64  QACSSAIDTLKSDTHDG-GAGIVVGFPRQDQE----------------GVLNSVVILDAG 106
            A + A+  L +      G  ++VG P ++                  G  N+  ++  G
Sbjct: 62  AAAAEALAELAARLAPLEGLAVLVGHPLRESSADGNANRPIERGAAPVGTYNAASLIVGG 121

Query: 107 NIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLK 164
            ++A   K +LPN   F EKR F +     P VF     R GI+ICEDIW +++  +  K
Sbjct: 122 EVVATYRKQDLPNTEVFDEKRYFAT--DPQPCVFELNGTRFGIVICEDIW-HASAAQLAK 178

Query: 165 KQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFD 224
             GAE L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG SF  D
Sbjct: 179 AAGAEVLLVPNGSPYHMNKDAVRVDILRARIRETGLPMVYVNLVGGQDELVFDGGSFVLD 238

Query: 225 GQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLR 284
              +L  +M  F E + + E+   + L             +   L  E   Y A VL +R
Sbjct: 239 AAGELVARMAQFEEGHAIVEFEGARPLP----------GEIAPALSTEAQVYRALVLGVR 288

Query: 285 DYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAK 344
           DY+ KN F   +IGLSGG+DSAL  A+A DALG + V+ +M+P +YT+  S  DAA  A+
Sbjct: 289 DYIGKNGFPGALIGLSGGVDSALVLAVACDALGPDRVRAVMMPSRYTADISTTDAADMAR 348

Query: 345 ALGCKYDVLPIHDLVNHF-FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLL 403
            +G +YD + I  + + F  SL ++F   E      ENIQ+RIRG +LMALSN   +++L
Sbjct: 349 RVGVRYDEIAIAPMFDAFRASLAAEFAGREEDA-TEENIQARIRGTLLMALSNKFGSIVL 407

Query: 404 TTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPS 463
           TT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+    +  G L  VIP  
Sbjct: 408 TTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCHYRNA---AAEFGRLA-VIPER 463

Query: 464 ILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLL 522
           IL ++PSAELR +QTDQ+SLP Y  LD I++  +E +          Y++  V  V  L+
Sbjct: 464 ILTRAPSAELRENQTDQDSLPSYDALDAIMRMYMEEDRPLAEIVAAGYDEADVTRVTRLI 523

Query: 523 YGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
             +EYKRRQAP+G ++T ++FGRD  YPI+++F + I
Sbjct: 524 KINEYKRRQAPIGIRVTHRAFGRDWRYPITSRFTERI 560


>gi|121604614|ref|YP_981943.1| NAD+ synthetase [Polaromonas naphthalenivorans CJ2]
 gi|120593583|gb|ABM37022.1| NAD+ synthetase [Polaromonas naphthalenivorans CJ2]
          Length = 565

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 233/576 (40%), Positives = 323/576 (56%), Gaps = 40/576 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           LKI +AQLN  VGD+ GN  K   A   A ++G  L+L  E+ I GY  EDL  + SFIQ
Sbjct: 3   LKICVAQLNYCVGDMPGNAQKIIAAARTAYQEGARLVLTPEMAICGYAAEDLFLRPSFIQ 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFPRQDQEG------------VLNSVVILDAGNIIAV 111
           AC  A++ +  +     G  +VVG P     G              N+  +L  G +I  
Sbjct: 63  ACDDAVNQVARELAGLKGLTVVVGTPVHGDSGKGLRTKSVAVQQRQNAARVLREGRVIET 122

Query: 112 RDKINLPNYSEFHEKRTFISGYSNDPIVFRD---------IRLGILICEDIWKNSNICKH 162
             K  LPNY  F E+R F  G      VF+          + +G+LICED W      + 
Sbjct: 123 YAKRELPNYQVFDERRYFAPGQGT--CVFQATGDEEGDEAVSIGLLICEDAWFEEP-ARL 179

Query: 163 LKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFC 222
            ++ GAE L  +NASP++  K  +R  ++  +     LP++Y + VGGQDE++F+G SF 
Sbjct: 180 AQQAGAELLVVINASPFHVGKGSEREVMMRERCLATGLPLVYAHLVGGQDEIVFEGHSFA 239

Query: 223 FDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVL 281
                 LA + + F E  F  +    Q  +    ++D       +PL+  EAD ++A VL
Sbjct: 240 LQADGALAGRAESFKENLFFAQAGRAQ--AAIELVAD------AVPLRSAEADLWDALVL 291

Query: 282 SLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAA 341
            +RDY+ KN F   IIGLSGGIDSAL  AIAVDALG + V+T+M+P  YT+  S  DA  
Sbjct: 292 GVRDYLGKNGFPGAIIGLSGGIDSALVLAIAVDALGADKVRTVMMPSPYTADISWIDARE 351

Query: 342 CAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAM 401
            A+ +  +YD + I      F + ++   +        ENIQ+RIRG  LMALSN   ++
Sbjct: 352 MAERMKVRYDEISIVPEFEAFKASLAGEFKGRAEDTTEENIQARIRGVFLMALSNKFGSI 411

Query: 402 LLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG-ITSGLGPLTEVI 460
           +LTT NKSE++ GY TLYGDM+GGF  +KDL KT VF+LA WRN +    +G  P    I
Sbjct: 412 VLTTGNKSEMATGYCTLYGDMAGGFAVIKDLLKTTVFRLARWRNENDPYGTGGSP----I 467

Query: 461 PPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESF-INNDQEYNDETVRYVE 519
           P  I+ + PSAELR  QTDQ+SLPPY +LD I+KR +EN++S        +    V  V 
Sbjct: 468 PERIITRPPSAELRADQTDQDSLPPYEVLDAILKRYMENDQSVEAVVAAGFERAVVERVA 527

Query: 520 HLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
            L+  +EYKRRQAPVG +++ +SFG+D  YPI++KF
Sbjct: 528 RLIRINEYKRRQAPVGIRVSHRSFGKDWRYPITSKF 563


>gi|294625816|ref|ZP_06704433.1| NAD + synthase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292599891|gb|EFF44011.1| NAD + synthase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
          Length = 546

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 230/572 (40%), Positives = 320/572 (55%), Gaps = 44/572 (7%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGN-------IAKARRAREEANRQGMDLILFTELFISGYPP 53
           M + L+IA+AQ +  VG +  N       IA AR   E       D++LF EL ISGYPP
Sbjct: 1   MSQTLRIAMAQFDFPVGGVTQNTDRIIEYIAAARDEFE------ADIVLFPELAISGYPP 54

Query: 54  EDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRD 113
           EDL+ +  F+  C  A+  + + TH  G   VVG+P+     V N+  +L  G I A   
Sbjct: 55  EDLLLRPGFLAHCEQALARIAAATH--GIVAVVGWPQSAGSVVYNAASVLRDGRIEATYR 112

Query: 114 KINLPNYSEFHEKRTFISGYSNDP------IVFRDIRLGILICEDIWKNSNICKHLKKQG 167
           K  LPNY+ F E+R F      DP      +  + +R+G++ICED+W    +   ++  G
Sbjct: 113 KRELPNYAVFDERRYF----DVDPDGENCVVTVKGVRVGVVICEDLWFAEPLANTVRA-G 167

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
           AE +   NASPY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG  
Sbjct: 168 AELVLVPNASPYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDG 227

Query: 228 QLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYV 287
            +      F +Q  + ++   ++        DD   +M      +   + A V  L+DY 
Sbjct: 228 TVHPAAAAFVDQWLVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYC 281

Query: 288 QKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALG 347
            KN F KV +GLSGGIDSAL  A+AVDALG +NV  + LP +YT+  S + A    +ALG
Sbjct: 282 HKNGFSKVWLGLSGGIDSALVLAMAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALG 341

Query: 348 CKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSN 407
            K + + I          +    +     I  EN+QSR RG ILMALSN    ++LTT N
Sbjct: 342 VKLETIAIEPAFEGLLGALGPMFEGTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGN 401

Query: 408 KSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEK 467
           KSE +VGY T+YGDM GG+ PLKDLYKT+VF LA WRN    T G  P   VIPP+++ +
Sbjct: 402 KSEYAVGYATIYGDMCGGYAPLKDLYKTEVFGLAKWRN----TVGGAP---VIPPAVISR 454

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYG 524
            PSAELR +QTDQ+SLPPY +LD I+ R V+ E+S   +D     Y  +TV +V  L+  
Sbjct: 455 PPSAELRDNQTDQDSLPPYDVLDGILYRYVDQEQS--RDDIVAAGYAADTVEHVLRLVRL 512

Query: 525 SEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           +E+KR Q+  G K++ ++FGR+R YPI+N +R
Sbjct: 513 NEWKRHQSAPGPKVSRRAFGRERRYPITNGYR 544


>gi|221205734|ref|ZP_03578749.1| glutamine-dependent NAD(+) synthetase [Burkholderia multivorans
           CGD2]
 gi|221174572|gb|EEE07004.1| glutamine-dependent NAD(+) synthetase [Burkholderia multivorans
           CGD2]
          Length = 593

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 232/580 (40%), Positives = 336/580 (57%), Gaps = 38/580 (6%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           K ++A+AQ+N  VGD AGN+A+   A   A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 25  KTRLALAQINVTVGDFAGNVARIVAAARAAHEDGAHLMIAPELALSGYPPEDLLLRPAFY 84

Query: 64  QACSSAIDTLKSDTHD-GGAGIVVGFPRQDQEGV-----------------LNSVVILDA 105
              ++A+D L        G  ++VG P +   GV                  N+  ++  
Sbjct: 85  AEAAAALDALADALKPLDGLAVLVGHPLRGAPGVDGNANRPIERGVPPVDTYNAASLIVG 144

Query: 106 GNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHL 163
           G I+    K +LPN   F EKR F +    +P+VF    ++ G++ICED W +++  +  
Sbjct: 145 GRIVGTYRKQDLPNAEVFDEKRYFAT--DAEPLVFELNGVKFGVIICEDAW-HASAAQIA 201

Query: 164 KKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCF 223
           K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG SF  
Sbjct: 202 KAAGAQVLLIPNGSPYHMNKEAMRVDILRARIRETGLPMVYVNLVGGQDELVFDGGSFVL 261

Query: 224 DGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSL 283
           DGQ  L  QM  F E + + E+   + L             +  PL  +   Y A VL +
Sbjct: 262 DGQGTLVAQMPQFDEGHAIVEFDGARPLP----------GAIASPLPVDAQVYRALVLGV 311

Query: 284 RDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACA 343
           RDY+ KN F   +IGLSGG+DSAL  A+A DALG E V+ +M+P +YT+  S  DAA  A
Sbjct: 312 RDYIGKNGFPGALIGLSGGVDSALVLAVACDALGPERVRAVMMPSRYTADISTTDAADMA 371

Query: 344 KALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLL 403
           + +G +YD + I  + + F + ++            ENIQ+RIRG +LMALSN   +++L
Sbjct: 372 RRVGVRYDEIAIAPMFDAFRAALAAEFAGRAEDATEENIQARIRGTLLMALSNKFGSIVL 431

Query: 404 TTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPS 463
           TT NKSE++VGY TLYGDM+GGF  LKD+ KT V++L  +RN+   TS  G   ++IP  
Sbjct: 432 TTGNKSEMAVGYCTLYGDMAGGFAVLKDIAKTLVYRLCRYRNA---TSDYG-RRDIIPER 487

Query: 464 ILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLL 522
           IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y    V  V  L+
Sbjct: 488 ILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYAPADVARVTRLI 547

Query: 523 YGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHISEE 562
             +EYKRRQAP+G ++T ++FGRD  YPI+++F + + E 
Sbjct: 548 KLNEYKRRQAPIGIRVTHRAFGRDWRYPITSRFAERLGER 587


>gi|221199364|ref|ZP_03572408.1| glutamine-dependent NAD(+) synthetase [Burkholderia multivorans
           CGD2M]
 gi|221180649|gb|EEE13052.1| glutamine-dependent NAD(+) synthetase [Burkholderia multivorans
           CGD2M]
          Length = 570

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 232/580 (40%), Positives = 336/580 (57%), Gaps = 38/580 (6%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           K ++A+AQ+N  VGD AGN+A+   A   A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRLALAQINVTVGDFAGNVARIVAAARAAHEDGAHLMIAPELALSGYPPEDLLLRPAFY 61

Query: 64  QACSSAIDTLKSDTHD-GGAGIVVGFPRQDQEGV-----------------LNSVVILDA 105
              ++A+D L        G  ++VG P +   GV                  N+  ++  
Sbjct: 62  AEAAAALDALADALKPLDGLAVLVGHPLRGAPGVDGNANRPIERGVPPVDTYNAASLIVG 121

Query: 106 GNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHL 163
           G I+    K +LPN   F EKR F +    +P+VF    ++ G++ICED W +++  +  
Sbjct: 122 GRIVGTYRKQDLPNAEVFDEKRYFAT--DAEPLVFELNGVKFGVIICEDAW-HASAAQIA 178

Query: 164 KKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCF 223
           K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG SF  
Sbjct: 179 KAAGAQVLLIPNGSPYHMNKEAMRVDILRARIRETGLPMVYVNLVGGQDELVFDGGSFVL 238

Query: 224 DGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSL 283
           DGQ  L  QM  F E + + E+   + L             +  PL  +   Y A VL +
Sbjct: 239 DGQGTLVAQMPQFDEGHAIVEFDGARPLP----------GAIASPLPVDAQVYRALVLGV 288

Query: 284 RDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACA 343
           RDY+ KN F   +IGLSGG+DSAL  A+A DALG E V+ +M+P +YT+  S  DAA  A
Sbjct: 289 RDYIGKNGFPGALIGLSGGVDSALVLAVACDALGPERVRAVMMPSRYTADISTTDAADMA 348

Query: 344 KALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLL 403
           + +G +YD + I  + + F + ++            ENIQ+RIRG +LMALSN   +++L
Sbjct: 349 RRVGVRYDEIAIAPMFDAFRAALAAEFAGRAEDATEENIQARIRGTLLMALSNKFGSIVL 408

Query: 404 TTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPS 463
           TT NKSE++VGY TLYGDM+GGF  LKD+ KT V++L  +RN+   TS  G   ++IP  
Sbjct: 409 TTGNKSEMAVGYCTLYGDMAGGFAVLKDIAKTLVYRLCRYRNA---TSDYG-RRDIIPER 464

Query: 464 ILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLL 522
           IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y    V  V  L+
Sbjct: 465 ILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYAPADVARVTRLI 524

Query: 523 YGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHISEE 562
             +EYKRRQAP+G ++T ++FGRD  YPI+++F + + E 
Sbjct: 525 KLNEYKRRQAPIGIRVTHRAFGRDWRYPITSRFAERLGER 564


>gi|167561982|ref|ZP_02354898.1| NAD synthetase [Burkholderia oklahomensis EO147]
          Length = 566

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 233/581 (40%), Positives = 336/581 (57%), Gaps = 42/581 (7%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF- 62
           K +IA+AQLN  VGD AGN+AK   A   A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVAKIVAAARAAHDAGAQLLIAPELALSGYPPEDLLLRPAFY 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEGV-----LNSVV 101
             + ++  +         G  ++VG P                R  + GV      N+  
Sbjct: 62  AASDAALAELAALLKPLAGLAVLVGHPQRAAGSGASSADGNANRPIERGVSPTDTYNAAS 121

Query: 102 ILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNI 159
           ++  G ++    K +LPN   F EKR F +  +  P VF    ++ G++ICED+W +++ 
Sbjct: 122 LIVDGEVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVKFGVVICEDVW-HASA 178

Query: 160 CKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGA 219
            +  K  GA+ L   N SPY+ NK   R +I+  +I    LP+IYVN VGGQDEL+FDG 
Sbjct: 179 AQLAKAAGAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMIYVNLVGGQDELVFDGG 238

Query: 220 SFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNAC 279
           SF  DG  +L  +M  F E N + E+   + L           + +   L  E   Y A 
Sbjct: 239 SFVLDGAGELVAKMPQFEEGNAVVEFDGARPLP----------ARIAPELSVEAQVYRAL 288

Query: 280 VLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDA 339
           VL + DY+ KN F   IIGLSGG+DSAL  A+AVDALG + V+ +M+P +YT+  S  DA
Sbjct: 289 VLGVHDYIGKNGFPGAIIGLSGGVDSALVLAVAVDALGADRVRAVMMPSRYTADISTTDA 348

Query: 340 AACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSK 399
           AA AK +G +YD + I  + + F + ++            ENIQ+RIRG +LMALSN   
Sbjct: 349 AAMAKRVGVRYDEIAIAPMFDAFRTSLAGEFAGRAEDATEENIQARIRGTLLMALSNKFG 408

Query: 400 AMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEV 459
           +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+      L    +V
Sbjct: 409 SIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEYGKL----DV 464

Query: 460 IPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYV 518
           IP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y++  V+ V
Sbjct: 465 IPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYSEADVKRV 524

Query: 519 EHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
             L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 525 TRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFTESI 565


>gi|21243946|ref|NP_643528.1| NAD synthetase [Xanthomonas axonopodis pv. citri str. 306]
 gi|21109556|gb|AAM38064.1| NH3-dependent NAD synthetase [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 546

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 230/572 (40%), Positives = 321/572 (56%), Gaps = 44/572 (7%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGN-------IAKARRAREEANRQGMDLILFTELFISGYPP 53
           M + L+IA+AQ +  VG +A N       IA AR   E       D++LF EL ISGYPP
Sbjct: 1   MSQTLRIAMAQFDFPVGGVAQNTDRIIEYIAAARDEFE------ADIVLFPELAISGYPP 54

Query: 54  EDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRD 113
           EDL+ +  F+  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   
Sbjct: 55  EDLLLRPGFLAHCEQALARIAAATR--GIVAVVGWPQSAGSVVYNAASVLRDGRIEATYR 112

Query: 114 KINLPNYSEFHEKRTFISGYSNDP------IVFRDIRLGILICEDIWKNSNICKHLKKQG 167
           K  LPNY+ F E+R F      DP      +  + +R+G++ICED+W    +   ++  G
Sbjct: 113 KRELPNYAVFDERRYF----DVDPDGENCVVTVKGVRVGVVICEDLWFAEPLANTVRA-G 167

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
           AE +   NASPY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG  
Sbjct: 168 AELVLVPNASPYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDG 227

Query: 228 QLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYV 287
            +      F +Q  + ++   ++        DD   +M      +   + A V  L+DY 
Sbjct: 228 TVHPAAAAFVDQWLVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYC 281

Query: 288 QKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALG 347
           +KN F KV +GLSGGIDSAL  A+AVDALG +NV  + LP +YT+  S + A    +ALG
Sbjct: 282 RKNGFSKVWLGLSGGIDSALVLAMAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALG 341

Query: 348 CKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSN 407
            K + + I          +    +     I  EN+QSR RG ILMALSN    ++LTT N
Sbjct: 342 VKLETIAIEPAFEGLLGALGPMFEGTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGN 401

Query: 408 KSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEK 467
           KSE +VGY T+YGDM GG+ PLKDLYKT+VF LA WRN    T G  P   VIPP+++ +
Sbjct: 402 KSEYAVGYATIYGDMCGGYAPLKDLYKTEVFGLAKWRN----TVGGAP---VIPPAVISR 454

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYG 524
            PSAELR +QTDQ+SLPPY +LD I+ R V+ E+S   +D     Y  +TV +V  L+  
Sbjct: 455 PPSAELRDNQTDQDSLPPYDVLDGILYRYVDQEQS--RDDIVAAGYAADTVEHVLRLVRL 512

Query: 525 SEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           +E+KR Q+  G K++ ++FGR+R YPI+N +R
Sbjct: 513 NEWKRHQSAPGPKVSRRAFGRERRYPITNGYR 544


>gi|145595855|ref|YP_001160152.1| NAD+ synthetase [Salinispora tropica CNB-440]
 gi|145305192|gb|ABP55774.1| NH(3)-dependent NAD(+) synthetase [Salinispora tropica CNB-440]
          Length = 598

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 230/597 (38%), Positives = 334/597 (55%), Gaps = 54/597 (9%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  L++A+ Q+NP VGD+AGN    R     A   G  LI F EL ++GYP EDLVF++S
Sbjct: 1   MTTLRLALCQVNPNVGDLAGNATIIREWARRAADAGAQLIAFPELTLTGYPVEDLVFRRS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAG---IVVGF-----PRQ---DQE---GVLNSVVILDAGN 107
           F+ A  +A+D L +D    G G   +VVG+     P Q   D E   G  N+  +L  G 
Sbjct: 61  FVAASKAALDELAADLAADGLGDLAVVVGYLDADGPPQVNGDAEPGHGARNAAALLHGGK 120

Query: 108 IIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG 167
            +A   K +LPNY  F E R F+ G +   +    + + + ICED+W+        ++ G
Sbjct: 121 TVATYFKHHLPNYGVFDEDRYFVPGETLSVVRVGGVDVTLTICEDLWQVGGPFAAARQAG 180

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
              + ++N SPY  NK   R  +V  + +     I YVN VGGQDEL+F+G S     + 
Sbjct: 181 VGLVLNINGSPYELNKDDVRLPLVRRRAAEAKATIAYVNMVGGQDELVFEGDSMIVAAEG 240

Query: 228 QLAFQMKHFSEQNFMTEWHY---------DQQLSQWNYM------------SDD-SASTM 265
           +L  +   F E   + +            D +L+    +            +D  +AS +
Sbjct: 241 ELLARAPQFVEHLLVHDLDLPAAADGPPADIELADGMRVLHRCIGSLPAAPTDTLAASEI 300

Query: 266 YIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIM 325
             P  +E   + A +L LRDYV KN+F  V++GLSGGIDS++ AA+AVDALG + V  + 
Sbjct: 301 AEPAADEAEVWQALLLGLRDYVDKNHFPSVVLGLSGGIDSSVVAALAVDALGADRVVGVS 360

Query: 326 LPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSR 385
           LP +++S  S EDAA  AK  G  Y + PI  +V  F + +S       SG+  EN+Q+R
Sbjct: 361 LPSQHSSEHSREDAAELAKRTGLDYRIEPIQPIVETFLANLSL------SGLSVENLQAR 414

Query: 386 IRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRN 445
           +RG ILMALSN    ++LTT NKSE++VGY TLYGD  GGFNP+KD++KT ++QLA WRN
Sbjct: 415 VRGVILMALSNQEGHLVLTTGNKSELAVGYSTLYGDSVGGFNPVKDVWKTLIWQLARWRN 474

Query: 446 SHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENE---ES 502
           +  +  G  P    IP + + K PSAEL P Q D ++LP Y +LD I+   ++ +   + 
Sbjct: 475 AEAVRRGETP---PIPENSISKPPSAELSPGQLDSDTLPEYDLLDPILVGYIDGDLGRDG 531

Query: 503 FI--NNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
            I   +D    D+ +R V+     +EYKRRQ+  GTKI+ K+FGRDR  PI+N++R+
Sbjct: 532 LIEAGHDPALVDQVLRMVDT----AEYKRRQSAPGTKISMKAFGRDRRLPITNRWRE 584


>gi|302524481|ref|ZP_07276823.1| glutamine-dependent NAD(+) synthetase [Streptomyces sp. AA4]
 gi|302433376|gb|EFL05192.1| glutamine-dependent NAD(+) synthetase [Streptomyces sp. AA4]
          Length = 590

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 224/585 (38%), Positives = 334/585 (57%), Gaps = 38/585 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L+IA+AQ+N  VGDI GN A       +A   G  +++F E+  +GYP EDL  +++
Sbjct: 18  MPQLRIALAQVNTTVGDIDGNTALTVEWTRKAAEAGAHVVVFPEMSQTGYPVEDLTLRRT 77

Query: 62  FIQACSSAIDTLKSDTHDGGAGIV---VGFPRQDQEGVLNSVVILDAGNIIAVRDKINLP 118
           F  A   ++  L     + G G V   VG+   D+ G  ++   L  G ++A + K +LP
Sbjct: 78  FADASRRSVTELARRLDEAGCGEVLAYVGYLDHDEVGPRDAAAALYRGEVVARQFKHHLP 137

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           NY  F E R F  G   + +    + +G++ICEDIW++      L K G + + + NASP
Sbjct: 138 NYGVFDEHRYFKPGTELEVLRLHGVDIGMVICEDIWQDGGPISALGKAGVDLVVAPNASP 197

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y  +K ++R  ++  + +    P++Y NQVGGQD+L+FDG S        L  +   F E
Sbjct: 198 YERSKDEQRLPLIARRAAEAGAPLVYTNQVGGQDDLVFDGDSLVVGADGTLLARAPQFVE 257

Query: 239 QNFM------------------TEWH----YDQQLSQWNYMSDDSASTMYIPLQEEEADY 276
              +                   E H     D  L++++ +   +A T+  PL +E   +
Sbjct: 258 HLLVLDLDVPASGAAATGSFEGLEVHRRVLTDSPLAEYSPL---AAPTISEPLSDEAEVW 314

Query: 277 NACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSL 336
           +A V+ LRDYV KN F  V  G SGGIDSA+CAA+A DALG +NV  + +P KY+S  S 
Sbjct: 315 SALVVGLRDYVHKNGFSTVTFGFSGGIDSAVCAALAADALGGDNVYGVSMPSKYSSSHSR 374

Query: 337 EDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSN 396
           +DA+  A+ +G  Y V PI D+V+ + +      Q + +G+  ENIQ+R+RG +LMALSN
Sbjct: 375 DDASDLAERIGAHYRVEPIGDMVDVYVN------QLQLTGLAEENIQARVRGMLLMALSN 428

Query: 397 HSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPL 456
               ++L T NK+E++VGY T+YGD  G F P+KDL+KT V+QLA WRN      G  P 
Sbjct: 429 LDGHLVLATGNKTELAVGYSTIYGDAVGAFAPIKDLFKTHVWQLARWRNEEAAKRGETP- 487

Query: 457 TEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETV 515
              IP + + K PSAELRP Q D +SLP Y +LDD++   VEN+  + +  +  ++ ET+
Sbjct: 488 --PIPENSITKPPSAELRPDQKDSDSLPDYELLDDVLDDYVENDRGYADLIEAGFDPETI 545

Query: 516 RYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHIS 560
             V  ++  +EYKRRQ P GTKIT K+FGRDR  P++N +R+  S
Sbjct: 546 DRVVRMVDRAEYKRRQYPPGTKITFKAFGRDRRLPMTNGWRERKS 590


>gi|300783141|ref|YP_003763432.1| NAD+ synthase (glutamine-hydrolysing) [Amycolatopsis mediterranei
           U32]
 gi|299792655|gb|ADJ43030.1| NAD+ synthase (glutamine-hydrolysing) [Amycolatopsis mediterranei
           U32]
          Length = 573

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 224/587 (38%), Positives = 330/587 (56%), Gaps = 48/587 (8%)

Query: 2   LKKLKIAIAQLNPVVGDIAGN----IAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           + +L+IA+AQ+NP VGD+ GN    +   RRA E     G  +++F E+ ++GYP EDL 
Sbjct: 1   MPQLRIALAQVNPTVGDLDGNADLHVEWTRRAAE----AGAHVVVFPEMSLTGYPIEDLS 56

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIV---VGFPRQDQEGVLNSVVILDAGNIIAVRDK 114
            +K+F  A    +++L     + G G V   VG+   D  G  ++   L  G I+A + K
Sbjct: 57  LRKTFAAASRQGLESLARRLDEAGCGEVLTYVGYLDLDDVGPRDAAAALYRGEIVARQFK 116

Query: 115 INLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSL 174
            +LPNY  F E R +  G + D + F  + +G++ICED+W++      L + G + + + 
Sbjct: 117 HHLPNYGVFDEHRWYKPGTTLDVVRFHGLDIGMVICEDLWQDGGPISALGRAGVDLVVAP 176

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           NASPY  +K ++R  ++  + +    P++Y NQ+GGQD+L+FDG S        L  +  
Sbjct: 177 NASPYERSKDEQRLPLIARRAAEAGAPLVYTNQIGGQDDLVFDGDSLVVGADGTLLARAP 236

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYI-----------------------PLQE 271
            F E   +     D  L +  Y  D S   +++                       PL +
Sbjct: 237 QFVEHLLV----LDMDLPKTGYAGDGSYEGLHVRRHVLSEEPLPAYEPTATPVISEPLSD 292

Query: 272 EEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYT 331
           E   ++A V+ LRDYV KN F  VI G SGGIDSA+CAA+A DALG  NV  + +P KY+
Sbjct: 293 EAEVWHALVIGLRDYVHKNGFSSVIFGFSGGIDSAVCAALAADALGGGNVYGVSMPSKYS 352

Query: 332 SPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNIL 391
           S  S +DAA  A+ +G  Y V P+ D+V  +   +S       +G+  ENIQ+R RG +L
Sbjct: 353 SGHSKDDAADLAQRIGAHYRVEPVEDMVRVYVDQLSL------TGLAEENIQARTRGMLL 406

Query: 392 MALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITS 451
           MALSN    ++L T NK+E++VGY T+YGD  G F P+KD++KT V+QLA WRN      
Sbjct: 407 MALSNLDGHLVLATGNKTELAVGYSTIYGDAVGAFAPIKDVFKTHVWQLARWRNDTAAKR 466

Query: 452 GLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEY 510
           G  P    IP + + K PSAELRP Q D +SLP Y +LDDI+   VE +  + +     +
Sbjct: 467 GETP---PIPENSITKPPSAELRPGQVDTDSLPDYALLDDILDDYVEGDRGYADLVSAGF 523

Query: 511 NDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           + ET+  V  ++  +EYKRRQ P GTKIT K+FGRDR  P++N +R+
Sbjct: 524 DPETIDRVVRMVDKAEYKRRQYPPGTKITFKAFGRDRRLPMTNLWRE 570


>gi|254181374|ref|ZP_04887971.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           1655]
 gi|184211912|gb|EDU08955.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           1655]
          Length = 609

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 237/590 (40%), Positives = 341/590 (57%), Gaps = 56/590 (9%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +
Sbjct: 43  VMKTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPA 102

Query: 62  F-IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEG-----VLNS 99
           F   + ++            G  ++VG P                R  + G       N+
Sbjct: 103 FYAASDAALAALAAQLKPLAGLAVLVGHPLRAAGAGASSADGNANRPIERGAAPVDTYNA 162

Query: 100 VVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNS 157
             ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W ++
Sbjct: 163 ASLIVGGGVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HA 219

Query: 158 NICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFD 217
           +  +  K  GA+ L   N SPY+ +K   R +I+  +I    LP++YVN VGGQDEL+FD
Sbjct: 220 SAAQLAKAAGAQVLIVPNGSPYHMHKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFD 279

Query: 218 GASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEE 273
           G SF  DG  +L  +M  F E + + E+              D A  +  P    L  E 
Sbjct: 280 GGSFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEA 325

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+ 
Sbjct: 326 QVYRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTAD 385

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNI 390
            S  DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +
Sbjct: 386 ISTTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTL 442

Query: 391 LMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGIT 450
           LMALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+    
Sbjct: 443 LMALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEY 502

Query: 451 SGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQE 509
             L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          
Sbjct: 503 GAL----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAG 558

Query: 510 YNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           Y +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 559 YAEADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 608


>gi|289667066|ref|ZP_06488141.1| NAD synthetase [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 551

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 230/564 (40%), Positives = 319/564 (56%), Gaps = 36/564 (6%)

Query: 5   LKIAIAQLNPVVGDIAGN-------IAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           L+IA+AQ +  VG +A N       IA AR   E       D++LF EL ISGYPPEDL+
Sbjct: 10  LRIAMAQFDFPVGAVAQNTDRIIEHIAAARDEFE------ADIVLFPELAISGYPPEDLL 63

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
            +  F+  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   K  L
Sbjct: 64  LRPGFLAHCEEALGRIAAATR--GIVAVVGWPQSAGSVVYNAASVLRDGRIEATYRKREL 121

Query: 118 PNYSEFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLN 175
           PNY+ F E+R F      D  VF  + +++G++ICED+W    +   +K + AE +   N
Sbjct: 122 PNYAVFDERRYFDVDPDGDNCVFTVKGVQVGVVICEDLWFAEPLANTVKAR-AELVLVPN 180

Query: 176 ASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKH 235
           ASPY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      
Sbjct: 181 ASPYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAA 240

Query: 236 FSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKV 295
           F +Q  + ++   ++        DD   +M      +   + A V  L+DY +KN F KV
Sbjct: 241 FVDQWLVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYCRKNGFSKV 294

Query: 296 IIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPI 355
            +GLSGGIDSAL  AIAVDALG +NV  + LP +YT+  S + A    +ALG K + + I
Sbjct: 295 WLGLSGGIDSALVLAIAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALGVKLETIAI 354

Query: 356 HDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGY 415
                     +    +     I  EN+QSR RG ILMALSN    ++LTT NKSE +VGY
Sbjct: 355 EPAFEGLLGALGPMFEGTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEYAVGY 414

Query: 416 GTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRP 475
            T+YGDM GG+ PLKDLYKT+VF LA WRN    T G  P   VIPP+++ + PSAELR 
Sbjct: 415 ATIYGDMCGGYAPLKDLYKTEVFGLAKWRN----TVGGAP---VIPPAVISRPPSAELRD 467

Query: 476 HQTDQESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYKRRQA 532
           +QTDQ+SLPPY +LD I+ R V+ E+S   +D     Y  +TV +V  L+  +E+KR Q+
Sbjct: 468 NQTDQDSLPPYDVLDGILYRYVDQEQS--RDDIVAAGYAADTVEHVLRLVRLNEWKRHQS 525

Query: 533 PVGTKITAKSFGRDRLYPISNKFR 556
             G K++ ++FGR+R YPI+N +R
Sbjct: 526 APGPKVSRRAFGRERRYPITNGYR 549


>gi|167901780|ref|ZP_02488985.1| NAD synthetase [Burkholderia pseudomallei NCTC 13177]
          Length = 567

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 237/589 (40%), Positives = 340/589 (57%), Gaps = 57/589 (9%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF- 62
           K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPAFY 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFP-----------------RQDQEG-----VLNSV 100
             + ++            G  ++VG P                 R  + G       N+ 
Sbjct: 62  AASDAALAALAAQLKPLAGLAVLVGHPLRVAGGAAASSADGNANRPIERGAAPVDTYNAA 121

Query: 101 VILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSN 158
            ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W +++
Sbjct: 122 SLIVGGEVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HAS 178

Query: 159 ICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDG 218
             +  K  GA+ L   N SPY+ +K   R +I+  +I    LP++YVN VGGQDEL+FDG
Sbjct: 179 AAQLAKAAGAQVLIVPNGSPYHMHKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFDG 238

Query: 219 ASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEEA 274
            SF  DG  +L  +M  F E + + E+              D A  +  P    L  E  
Sbjct: 239 GSFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEAQ 284

Query: 275 DYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQ 334
            Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+  
Sbjct: 285 VYRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTADI 344

Query: 335 SLEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNIL 391
           S  DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +L
Sbjct: 345 STTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTLL 401

Query: 392 MALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITS 451
           MALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+     
Sbjct: 402 MALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEYG 461

Query: 452 GLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEY 510
            L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y
Sbjct: 462 AL----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGY 517

Query: 511 NDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
            +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 518 AEADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 566


>gi|237811352|ref|YP_002895803.1| glutamine-dependent NAD+ synthetase [Burkholderia pseudomallei
           MSHR346]
 gi|237506688|gb|ACQ99006.1| glutamine-dependent NAD+ synthetase [Burkholderia pseudomallei
           MSHR346]
          Length = 566

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 237/588 (40%), Positives = 340/588 (57%), Gaps = 56/588 (9%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF- 62
           K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPAFY 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEG-----VLNSVV 101
             + ++            G  ++VG P                R  + G       N+  
Sbjct: 62  AASDAALAALAAQLKPLAGLAVLVGHPLRAAGAGASSADGNANRPIERGAAPVDTYNAAS 121

Query: 102 ILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNI 159
           ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W +++ 
Sbjct: 122 LIVGGEVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HASA 178

Query: 160 CKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGA 219
            +  K  GA+ L   N SPY+ +K   R +I+  +I    LP++YVN VGGQDEL+FDG 
Sbjct: 179 AQLAKAAGAQVLIVPNGSPYHMHKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFDGG 238

Query: 220 SFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEEAD 275
           SF  DG  +L  +M  F E + + E+              D A  +  P    L  E   
Sbjct: 239 SFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEAQV 284

Query: 276 YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQS 335
           Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+  S
Sbjct: 285 YRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTADIS 344

Query: 336 LEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNILM 392
             DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +LM
Sbjct: 345 TTDAADMAKRVGVRYDEIAIAPMFDAFRTSLAAEFAGLAEDAT---EENIQARIRGTLLM 401

Query: 393 ALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSG 452
           ALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+      
Sbjct: 402 ALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEYGA 461

Query: 453 LGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYN 511
           L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y 
Sbjct: 462 L----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYA 517

Query: 512 DETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 518 EADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 565


>gi|254190774|ref|ZP_04897281.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|157938449|gb|EDO94119.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           Pasteur 52237]
          Length = 609

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 237/590 (40%), Positives = 341/590 (57%), Gaps = 56/590 (9%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +
Sbjct: 43  VMKTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPA 102

Query: 62  F-IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEG-----VLNS 99
           F   + ++            G  ++VG P                R  + G       N+
Sbjct: 103 FYAASDAALAALAAQLKPLAGLAVLVGHPLRAAGAGASSADGNANRPIERGAAPVDTYNA 162

Query: 100 VVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNS 157
             ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W ++
Sbjct: 163 ASLIVGGEVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HA 219

Query: 158 NICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFD 217
           +  +  K  GA+ L   N SPY+ +K   R +I+  +I    LP++YVN VGGQDEL+FD
Sbjct: 220 SAAQLAKAAGAQVLIVPNGSPYHMHKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFD 279

Query: 218 GASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEE 273
           G SF  DG  +L  +M  F E + + E+              D A  +  P    L  E 
Sbjct: 280 GGSFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEA 325

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+ 
Sbjct: 326 QVYRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTAD 385

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNI 390
            S  DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +
Sbjct: 386 ISTTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTL 442

Query: 391 LMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGIT 450
           LMALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+    
Sbjct: 443 LMALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEY 502

Query: 451 SGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQE 509
             L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          
Sbjct: 503 GAL----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAG 558

Query: 510 YNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           Y +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 559 YAEADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 608


>gi|188990496|ref|YP_001902506.1| putative bifunctional NAD(+) synthase (glutamine-hydrolyzing) /
           nitrilase [Xanthomonas campestris pv. campestris str.
           B100]
 gi|167732256|emb|CAP50448.1| putative bifunctional NAD(+) synthase (glutamine-hydrolyzing) /
           nitrilase [Xanthomonas campestris pv. campestris]
          Length = 552

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 228/560 (40%), Positives = 318/560 (56%), Gaps = 30/560 (5%)

Query: 5   LKIAIAQLNPVVGDIAGN----IAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           L+IA+AQ +  VG +  N    I     AR+E +    D++LF EL ISGYPPEDL+ + 
Sbjct: 11  LRIAMAQFDFPVGAVTQNTDRIIEYIAAARDEFD---ADIVLFPELAISGYPPEDLLLRP 67

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F+  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   K  LPNY
Sbjct: 68  GFLAHCEQALARIAAATR--GIVAVVGWPQSAGSVVYNAASVLREGRIEATYRKRELPNY 125

Query: 121 SEFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           + F E+R F      D  V   + +++G++ICED+W    + K ++  GAE +   NASP
Sbjct: 126 AVFDERRYFDVDPDGDNCVVTVKGVQVGVVICEDLWFAEPLAKTVQA-GAELVLVPNASP 184

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      F +
Sbjct: 185 YERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAAFVD 244

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
           Q  + ++   ++        DD   +M      +   + A V  L+DY  KN F KV +G
Sbjct: 245 QWLVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLKDYCGKNGFRKVWLG 298

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL  A+AVDALG ENV  + LP +YT+  S + A    +ALG K + + I   
Sbjct: 299 LSGGIDSALVLAMAVDALGGENVTAVRLPSRYTAGLSNDLAEEQCRALGVKLETIAIEPA 358

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
                + +     +    I  EN+QSR RG ILMALSN    ++LTT NKSE +VGY T+
Sbjct: 359 FEGLLAALGPLFADTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEYAVGYATI 418

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM GG+ PLKDLYKT+VF LA WRN    T G  P   VIPP+++ + PSAELR +QT
Sbjct: 419 YGDMCGGYAPLKDLYKTEVFGLAKWRN----TVGGAP---VIPPAVISRPPSAELRDNQT 471

Query: 479 DQESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           DQ+SLPPY +LD I+ R V+ E+S   +D     Y  +TV +V  L+  +E+KR QA  G
Sbjct: 472 DQDSLPPYDVLDGILYRYVDQEQS--RDDIVAAGYAADTVEHVLRLVRLNEWKRHQAAPG 529

Query: 536 TKITAKSFGRDRLYPISNKF 555
            K++ ++FGR+R YPI+N +
Sbjct: 530 PKVSRRAFGRERRYPITNGY 549


>gi|117928126|ref|YP_872677.1| NH(3)-dependent NAD(+) synthetase [Acidothermus cellulolyticus 11B]
 gi|117648589|gb|ABK52691.1| NH(3)-dependent NAD(+) synthetase [Acidothermus cellulolyticus 11B]
          Length = 591

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 226/594 (38%), Positives = 320/594 (53%), Gaps = 53/594 (8%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+AQ++PVVGDIAGN+       + A  +   L+ F E+ ++GYP EDL  + S
Sbjct: 1   MPQLRLALAQVDPVVGDIAGNLELVVAWTKHAASRSAHLVAFPEMMLTGYPVEDLALRPS 60

Query: 62  FIQACSSAIDTLKSDTHD---GGAGIVVGF--------PRQDQEGV-LNSVVILDAGNII 109
           F+ A   A+  L         G  G++VG+        PR    G+  +S   L  G ++
Sbjct: 61  FVAASRRAVVELAERLAREGLGNIGVIVGYLDAAPDDRPRPGGRGLPTDSAAFLIGGRVV 120

Query: 110 AVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAE 169
           A  DK +LPNY  F E R F  G     +    + + + ICED+W++          G  
Sbjct: 121 ARYDKHHLPNYGVFDEYRYFSRGERLVVVRHLGVDIAMTICEDLWQDGGPLTAAWAAGVG 180

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            + ++N SPY   K   R  +   + + V  PI YVN VGGQDEL+FDG SF  D     
Sbjct: 181 LVVTINGSPYERGKPDARLRLAQRRAAEVRAPIAYVNMVGGQDELVFDGDSFVVDADGTP 240

Query: 230 AFQMKHFSEQNFMTEWHYDQQLSQWNY---MSDDSASTM------------YIP------ 268
             +   F E   + +       S+      + D S  T+            Y P      
Sbjct: 241 LVRAPQFDEGLAVIDLSLQPGTSRRRGSVDVRDGSRMTIERVDLKTPSLPDYPPAPTGLA 300

Query: 269 --LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIML 326
             L  E   Y A V   RDY++KN F  V++GLSGGIDSAL   IAVDA+G E V T+ +
Sbjct: 301 ARLAPEAEVYAALVTGTRDYIRKNRFRSVLVGLSGGIDSALVTTIAVDAIGAEAVHTVAM 360

Query: 327 PYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRI 386
           P +++S  SL DA   A+  G ++ V+PI D+V+ F   +         G+ AEN+Q+R+
Sbjct: 361 PSRWSSDHSLADAEELARRQGTRHTVIPITDMVDAFERHLDLH------GLAAENLQARV 414

Query: 387 RGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNS 446
           RG ILM+LSN    ++LTT NKSE++ GY TLYGD +GGF PLKD+ KT V++LA WRN+
Sbjct: 415 RGTILMSLSNEHGHLVLTTGNKSELATGYSTLYGDSAGGFAPLKDVPKTLVWELARWRNA 474

Query: 447 HGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEES---- 502
               SG  P    IP   ++K PSAELRP Q D +SLPPYP LD +++  VE++ S    
Sbjct: 475 QAERSGAVP---PIPQRCIDKPPSAELRPGQLDTDSLPPYPELDAVLRLYVEHDASRDDI 531

Query: 503 -FINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
               +D    D  +R V++    +EYKRRQ P G KIT ++FGRDR  PI+N++
Sbjct: 532 VAAGHDPFLVDRVIRLVDN----AEYKRRQYPPGPKITTRNFGRDRRLPITNRW 581


>gi|76809184|ref|YP_332653.1| NAD synthetase [Burkholderia pseudomallei 1710b]
 gi|126451553|ref|YP_001065369.1| NAD synthetase [Burkholderia pseudomallei 1106a]
 gi|242316719|ref|ZP_04815735.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           1106b]
 gi|254259592|ref|ZP_04950646.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           1710a]
 gi|76578637|gb|ABA48112.1| glutamine dependent NAD+ synthetase [Burkholderia pseudomallei
           1710b]
 gi|126225195|gb|ABN88735.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           1106a]
 gi|242139958|gb|EES26360.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           1106b]
 gi|254218281|gb|EET07665.1| glutamine-dependent NAD(+) synthetase [Burkholderia pseudomallei
           1710a]
          Length = 566

 Score =  389 bits (998), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 237/588 (40%), Positives = 340/588 (57%), Gaps = 56/588 (9%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF- 62
           K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPAFY 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEG-----VLNSVV 101
             + ++            G  ++VG P                R  + G       N+  
Sbjct: 62  AASDAALAALAAQLKPLAGLAVLVGHPLRAAGAGASSADGNANRPIERGAAPVDTYNAAS 121

Query: 102 ILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNI 159
           ++  G ++    K +LPN   F EKR F +  +  P VF    +R G++ICED+W +++ 
Sbjct: 122 LIVGGEVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVRFGVVICEDVW-HASA 178

Query: 160 CKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGA 219
            +  K  GA+ L   N SPY+ +K   R +I+  +I    LP++YVN VGGQDEL+FDG 
Sbjct: 179 AQLAKAAGAQVLIVPNGSPYHMHKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFDGG 238

Query: 220 SFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIP----LQEEEAD 275
           SF  DG  +L  +M  F E + + E+              D A  +  P    L  E   
Sbjct: 239 SFVLDGAGELVAKMPQFEEGHAIVEF--------------DGARALPAPIAPALPVEAQV 284

Query: 276 YNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQS 335
           Y A VL +RDY+ KN F   I+GLSGG+DSAL  A+AVDALG E V+ +M+P +YT+  S
Sbjct: 285 YRALVLGVRDYIGKNGFPGAIVGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTADIS 344

Query: 336 LEDAAACAKALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNILM 392
             DAA  AK +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +LM
Sbjct: 345 TTDAADMAKRVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTLLM 401

Query: 393 ALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSG 452
           ALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+      
Sbjct: 402 ALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEYGA 461

Query: 453 LGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYN 511
           L    +VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y 
Sbjct: 462 L----DVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYA 517

Query: 512 DETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           +  V+ V  L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 518 EADVKRVTRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFIESI 565


>gi|257060879|ref|YP_003138767.1| NAD synthetase [Cyanothece sp. PCC 8802]
 gi|256591045|gb|ACV01932.1| NAD+ synthetase [Cyanothece sp. PCC 8802]
          Length = 561

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 230/578 (39%), Positives = 330/578 (57%), Gaps = 46/578 (7%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQLNP +GD+  N  K   A   A  Q + L+L  EL + GYPP DL+   SFI+
Sbjct: 1   MKIAIAQLNPTIGDLVNNAHKILNAANLAASQNVRLLLTPELSLCGYPPRDLLLYPSFIK 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQD-------QEGVLNSVVILDAGNIIAVRDKINL 117
           + +  +  L        A ++VG    +       ++ + NS  +L+ G +  +  K  L
Sbjct: 61  SLTLELQELAQKLPSQLA-VLVGTVTPNNAAAINGEKPLFNSAALLENGEVKQLFHKCLL 119

Query: 118 PNYSEFHEKRTFISGYSNDPI-VFRD------IRLGILICEDIWKNS----------NIC 160
           PNY  F E R F SG   +   +F D      I++G+ ICED+W +           N  
Sbjct: 120 PNYDVFDEHRYFESGKQPNYFELFLDDHSSEPIKIGVTICEDLWNDEQFWQKRHYQQNPI 179

Query: 161 KHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGAS 220
           K L   G + + +L+ASPYY  K K R  ++     +  +P+IYVNQ+GG DELIFDG S
Sbjct: 180 KTLANLGVDLIVNLSASPYYLGKPKLRETMLQHSSKYYQIPLIYVNQIGGNDELIFDGNS 239

Query: 221 FCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWN--YMSDDSASTMYIPLQEEEADYNA 278
           F  +   ++  + K F+E         D ++  WN  +     AS    P  EEE  ++A
Sbjct: 240 FVVNEHGEIVLKAKSFAE---------DVKIFTWNKSFKKIVLASVNNFPNTEEEEIWSA 290

Query: 279 CVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLED 338
            VL ++DY QK  F KVI+GLSGGIDSAL AAIA +A+G  NV  I++P  Y+S  SL+D
Sbjct: 291 LVLGVKDYAQKCQFSKVILGLSGGIDSALVAAIATEAIGANNVLGILMPSPYSSDHSLKD 350

Query: 339 AAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHS 398
           A    K LG  +  LPI  ++  + +L++        GI  EN+Q+RIRGN+LMA++N  
Sbjct: 351 AEKLVKNLGINHQTLPISGIMKTYDNLLNPLFSGTQFGIAEENLQARIRGNLLMAIANKF 410

Query: 399 KAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTE 458
             +LL+T NKSEI+VGY TLYGDM+GG   + D+ KT+VF L  W N H          E
Sbjct: 411 GYLLLSTGNKSEIAVGYCTLYGDMNGGLAVIADVPKTRVFSLCHWLNRH---------QE 461

Query: 459 VIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRY 517
           +IP +IL K PSAEL+P+QTDQ+SLPPY ILD+I++R + + +SF    +  +N   V+ 
Sbjct: 462 IIPHNILIKPPSAELKPNQTDQDSLPPYEILDEILERRINHHQSFDEICEAGFNANIVQK 521

Query: 518 VEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           V  L+  +E+KR+QAP+  K+T K+FG     PI+++ 
Sbjct: 522 VLKLVARAEFKRKQAPLVLKVTDKAFGTGWRMPIASQI 559


>gi|326560148|gb|EGE10537.1| NAD+ synthetase [Moraxella catarrhalis 103P14B1]
          Length = 517

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 217/525 (41%), Positives = 305/525 (58%), Gaps = 19/525 (3%)

Query: 32  EANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQ 91
           +A  +G D+++F EL + GYPPEDL+ + +  +    A+  L       G  +++G+P  
Sbjct: 7   DAKARGADIVIFPELALVGYPPEDLLLRPTLGERVREAMAKLAEIE---GIVVILGYPHI 63

Query: 92  DQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICE 151
           D  G  NS  IL  G+      K  LPNY  F E+R F  G +     ++ + +G+LICE
Sbjct: 64  DHHGTFNSAAILQDGSQKGFYHKQCLPNYGIFDEQRYFQKGLNQVLFDYKGVTIGLLICE 123

Query: 152 DIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQ 211
           DIW +  I + LK+ GA+ +  +NASP+   K   R  ++T   S  HLPIIYVN VG Q
Sbjct: 124 DIWHDEPI-QALKQAGADLVIVINASPFEIGKQTARKSLLTRHSSTHHLPIIYVNTVGAQ 182

Query: 212 DELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQE 271
           D+++FDG S       ++A +   F  Q  M    +D Q   +     D+ +   + L E
Sbjct: 183 DDIVFDGGSLITQSDGRVAHEGVRFLNQLLMA--RFDTQNKTF-----DTQAKAPLVLSE 235

Query: 272 EEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYT 331
           E   Y A V+ LRDYV ++ F  VI+GLSGGIDSAL   IAVDALG + V  +M+PY+YT
Sbjct: 236 ESEMYQALVVGLRDYVNRSGFKGVIVGLSGGIDSALTLCIAVDALGCDRVYAVMMPYEYT 295

Query: 332 SPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNIL 391
           +  SLEDA A A  L   Y V PIHD V    S ++  L      +  EN+Q+R RG IL
Sbjct: 296 AQISLEDAEAQAARLNVSYTVCPIHDAVAGLRSALAPLLANSEPDVTEENLQARARGTIL 355

Query: 392 MALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITS 451
           MALSN    M+++T NKSE +VGY TLYGDM GGF+ LKD+YKT V++LA++RN      
Sbjct: 356 MALSNKFGHMVISTGNKSENAVGYSTLYGDMVGGFDVLKDVYKTDVYRLANYRNRL---- 411

Query: 452 GLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEY 510
                  VIP  ++ + PSAELRP+Q DQ+SL  Y  LD I+K  ++++  +       +
Sbjct: 412 ---EDNPVIPERVITRPPSAELRPNQKDQDSLGDYETLDSILKMYIDDDLGYKAIVAAGF 468

Query: 511 NDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
             +TV  +  ++  +EYKRRQ  +GTKIT KSFGR+R YP+ N +
Sbjct: 469 EPKTVEKILSMVDRAEYKRRQGAIGTKITKKSFGRERRYPLVNGW 513


>gi|21232521|ref|NP_638438.1| NAD synthetase [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66767395|ref|YP_242157.1| NAD synthetase [Xanthomonas campestris pv. campestris str. 8004]
 gi|21114312|gb|AAM42362.1| NH3-dependent NAD synthetase [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66572727|gb|AAY48137.1| NH3-dependent NAD synthetase [Xanthomonas campestris pv. campestris
           str. 8004]
          Length = 552

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 229/563 (40%), Positives = 317/563 (56%), Gaps = 36/563 (6%)

Query: 5   LKIAIAQLNPVVGDIAGN-------IAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           L+IA+AQ +  VG +  N       IA AR   E       D++LF EL ISGYPPEDL+
Sbjct: 11  LRIAMAQFDFPVGAVTQNTDRIIEYIAAARDEFE------ADIVLFPELAISGYPPEDLL 64

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
            +  F+  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   K  L
Sbjct: 65  LRPGFLAHCEQALARIAAATR--GIVAVVGWPQSAGSVVYNAASVLREGRIEATYRKREL 122

Query: 118 PNYSEFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLN 175
           PNY+ F E+R F      D  V   + +++G++ICED+W    + K ++  GAE +   N
Sbjct: 123 PNYAVFDERRYFDVDPDGDNCVVTVKGVQVGVVICEDLWFAEPLAKTVQA-GAELVLVPN 181

Query: 176 ASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKH 235
           ASPY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      
Sbjct: 182 ASPYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAA 241

Query: 236 FSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKV 295
           F +Q  + ++   ++        DD   +M      +   + A V  L+DY  KN F KV
Sbjct: 242 FVDQWLVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLKDYCGKNGFRKV 295

Query: 296 IIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPI 355
            +GLSGGIDSAL  A+AVDALG ENV  + LP +YT+  S + A    +ALG K + + I
Sbjct: 296 WLGLSGGIDSALVLAMAVDALGGENVTAVRLPSRYTAGLSNDLADEQCRALGVKLETIAI 355

Query: 356 HDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGY 415
                   + +     +    I  EN+QSR RG ILMALSN    ++LTT NKSE +VGY
Sbjct: 356 EPAFEGLLAALGPLFADTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEYAVGY 415

Query: 416 GTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRP 475
            T+YGDM GG+ PLKDLYKT+VF LA WRN    T G  P   VIPP+++ + PSAELR 
Sbjct: 416 ATIYGDMCGGYAPLKDLYKTEVFGLAKWRN----TVGGAP---VIPPAVISRPPSAELRD 468

Query: 476 HQTDQESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYKRRQA 532
           +QTDQ+SLPPY +LD I+ R V+ E+S   +D     Y  +TV +V  L+  +E+KR QA
Sbjct: 469 NQTDQDSLPPYDVLDGILYRYVDQEQS--RDDIVAAGYAADTVEHVLRLVRLNEWKRHQA 526

Query: 533 PVGTKITAKSFGRDRLYPISNKF 555
             G K++ ++FGR+R YPI+N +
Sbjct: 527 APGPKVSRRAFGRERRYPITNGY 549


>gi|325922862|ref|ZP_08184586.1| DNA-directed RNA polymerase, subunit H [Xanthomonas gardneri ATCC
           19865]
 gi|325546655|gb|EGD17785.1| DNA-directed RNA polymerase, subunit H [Xanthomonas gardneri ATCC
           19865]
          Length = 546

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 227/567 (40%), Positives = 322/567 (56%), Gaps = 36/567 (6%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGN-------IAKARRAREEANRQGMDLILFTELFISGYPP 53
           M + L+IA+AQ +  VG +A N       IA AR      +  G D++LF EL ISGYPP
Sbjct: 1   MSQTLRIAMAQFDFPVGAVARNTDRIIEFIAAAR------DEFGADIVLFPELAISGYPP 54

Query: 54  EDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRD 113
           EDL+ +  F+  C  A+  + ++T   G   VVG+P+     V N+  +L  G+I A   
Sbjct: 55  EDLLLRPGFLAHCEEALARIAANTR--GIVAVVGWPQSAGSVVYNAASVLRDGSIAATYR 112

Query: 114 KINLPNYSEFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNICKHLKKQGAEFL 171
           K  LPNY+ F E+R F      D  V   + +++G++ICED+W    +   ++  GAE +
Sbjct: 113 KRELPNYAVFDERRYFDVDPDGDNCVVTVKGVQVGVVICEDLWFAEPLAGTVQA-GAELV 171

Query: 172 FSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAF 231
              NASPY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   D    +  
Sbjct: 172 LVPNASPYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADADGTVHP 231

Query: 232 QMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNN 291
               F +Q  + ++   ++        DD   +M      +   + A V  L+DY +KN 
Sbjct: 232 AAAAFVDQWLVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYCRKNG 285

Query: 292 FHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYD 351
           F KV +GLSGGIDSAL  A+AVDALG +NV  + LP +YT+  S + A    +ALG K +
Sbjct: 286 FTKVWLGLSGGIDSALVLAMAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALGVKLE 345

Query: 352 VLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEI 411
            + I        + +    +     +  EN+QSR RG ILMALSN    +LLTT NKSE 
Sbjct: 346 TIAIEPAFEGLLAALGPLFEGTQPDVTEENLQSRSRGVILMALSNKFGGLLLTTGNKSEY 405

Query: 412 SVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSA 471
           +VGY T+YGDM GG+ PLKDLYKT+VF LA WRN    T G  P   VIPP+++ + PSA
Sbjct: 406 AVGYATIYGDMCGGYAPLKDLYKTEVFGLAKWRN----TVGGAP---VIPPAVISRPPSA 458

Query: 472 ELRPHQTDQESLPPYPILDDIIKRIVENEESFINND---QEYNDETVRYVEHLLYGSEYK 528
           ELR +QTDQ+SLPPY +LD I+ R V+ E+S   +D     Y  +TV +V  L+  +E+K
Sbjct: 459 ELRDNQTDQDSLPPYDVLDGILYRYVDQEQS--RDDIVAAGYAADTVEHVLRLVRLNEWK 516

Query: 529 RRQAPVGTKITAKSFGRDRLYPISNKF 555
           R Q+  G K++ ++FGR+R YPI+N +
Sbjct: 517 RHQSAPGPKVSRRAFGRERRYPITNGY 543


>gi|91788178|ref|YP_549130.1| NAD+ synthetase [Polaromonas sp. JS666]
 gi|91697403|gb|ABE44232.1| NAD+ synthetase [Polaromonas sp. JS666]
          Length = 562

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 234/574 (40%), Positives = 325/574 (56%), Gaps = 37/574 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           LKI +AQLN  VGD+ GN  K   A   A   G+ L+L  EL I GY  EDL  + SFIQ
Sbjct: 3   LKICVAQLNYCVGDMPGNAQKIIDAARTAYAGGVRLLLTPELAICGYAAEDLFLRPSFIQ 62

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFPRQDQEGVL------------NSVVILDAGNIIAV 111
           AC  A++ +  +     G  +VVG P     G              N+  +L  G ++  
Sbjct: 63  ACDDAVNLVARELAGLKGLTVVVGTPTGGDNGKGLRTKSVEVQQRHNAARVLREGRVLQT 122

Query: 112 RDKINLPNYSEFHEKRTFISGYSNDPIVFRD------IRLGILICEDIWKNSNICKHLKK 165
             K  LPNY  F E+R F  G      VF+       I +G+LICED W      +  + 
Sbjct: 123 YAKRELPNYQVFDERRYFTPG--QGVCVFQAGDGADAISVGLLICEDAWFEEP-ARLAQA 179

Query: 166 QGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDG 225
            GAE L  +NASP++  K  +R  ++  ++    LP++Y + VGGQDE++F+G SF    
Sbjct: 180 AGAEVLAVINASPFHVGKGGEREVMMRSRVLATGLPLVYAHLVGGQDEIVFEGHSFALQA 239

Query: 226 QQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-YNACVLSLR 284
              LA + + F E  F+TE   ++  +    +++        P +  EAD ++A VL +R
Sbjct: 240 DGALAGRAESFKENLFLTE--VERTSTAIKLIANIE------PGRSHEADLWDALVLGVR 291

Query: 285 DYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAK 344
           DY+ KN F   I+GLSGGIDSAL  AIAVDALG + V+T+M+P  YT+  S  DA   A+
Sbjct: 292 DYLGKNGFPGAILGLSGGIDSALVLAIAVDALGADKVRTVMMPSPYTADISWVDAREMAQ 351

Query: 345 ALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLT 404
            L  +YD + I      F + ++   +        ENIQ+RIRG  LMALSN   +++LT
Sbjct: 352 RLKVRYDEISIVPEFEAFKASLAHEFKGLKEDTTEENIQARIRGVFLMALSNKFGSIVLT 411

Query: 405 TSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG-ITSGLGPLTEVIPPS 463
           T NKSE++ GY TLYGDM+GGF  +KDL KT VF+LA WRN +    +G  P    IP  
Sbjct: 412 TGNKSEMATGYCTLYGDMAGGFAVIKDLAKTTVFKLARWRNENDPYGTGANP----IPER 467

Query: 464 ILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESF-INNDQEYNDETVRYVEHLL 522
           ++ + PSAELRP QTDQ+SLPPY +LD I++R +EN++S        +    V  V  L+
Sbjct: 468 VITRPPSAELRPDQTDQDSLPPYEVLDAILERYMENDQSVEAIIAAGFERAVVECVARLI 527

Query: 523 YGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
             +EYKRRQAPVG ++T +SFG+D  YPI++KFR
Sbjct: 528 KINEYKRRQAPVGIRVTHRSFGKDWRYPITSKFR 561


>gi|221211577|ref|ZP_03584556.1| glutamine-dependent NAD(+) synthetase [Burkholderia multivorans
           CGD1]
 gi|221168938|gb|EEE01406.1| glutamine-dependent NAD(+) synthetase [Burkholderia multivorans
           CGD1]
          Length = 570

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 230/579 (39%), Positives = 334/579 (57%), Gaps = 38/579 (6%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           K ++A+AQ+N  VGD AGN+A+   A   A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRLALAQINVTVGDFAGNVARIVAAARAAHEDGAHLMIAPELALSGYPPEDLLLRPAFY 61

Query: 64  QACSSAIDTLKSDTHD-GGAGIVVGFPRQDQEGV-----------------LNSVVILDA 105
              ++A+D L        G  ++VG P +   GV                  N+  ++  
Sbjct: 62  AEAAAALDALADALKPFDGLAVLVGHPLRGAPGVDGNANRPIERGVPPVDTYNAASLIVG 121

Query: 106 GNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHL 163
           G I+    K +LPN   F EKR F +    +P+VF    ++ G++ICED W +++  +  
Sbjct: 122 GRIVGTYRKQDLPNAEVFDEKRYFAT--DAEPLVFELNGVKFGVIICEDAW-HASAAQIA 178

Query: 164 KKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCF 223
           K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG SF  
Sbjct: 179 KAAGAQVLLIPNGSPYHMNKEAVRVDILRARIRETGLPMVYVNLVGGQDELVFDGGSFVL 238

Query: 224 DGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSL 283
           DGQ  L  QM  F E + + E+   Q L             +  PL  +   Y A VL +
Sbjct: 239 DGQGTLVAQMPQFDEGHAIVEFDGGQPLP----------GAIAPPLPVDAQVYRALVLGV 288

Query: 284 RDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACA 343
           RDY+ KN F   +IGLSGG+DSAL  A+A DALG E V+ +M+P +YT+  S  DAA  A
Sbjct: 289 RDYIGKNGFPGALIGLSGGVDSALVLAVACDALGPERVRAVMMPSRYTADISTTDAADMA 348

Query: 344 KALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLL 403
           + +G +YD + I  + + F + ++            ENIQ+RIRG +LMALSN   +++L
Sbjct: 349 RRVGVRYDEIAIAPMFDAFRAALAAEFAGRAEDATEENIQARIRGTLLMALSNKFGSIVL 408

Query: 404 TTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPS 463
           TT NKSE++VGY TLYGDM+GGF  LKD+ KT V++L  +RN+    +      ++IP  
Sbjct: 409 TTGNKSEMAVGYCTLYGDMAGGFAVLKDIAKTLVYRLCRYRNATFDYA----RRDIIPER 464

Query: 464 ILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLL 522
           IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y    V  V  L+
Sbjct: 465 ILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYAPADVARVTRLI 524

Query: 523 YGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHISE 561
             +EYKRRQAP+G ++T ++FGRD  YPI+++F + + E
Sbjct: 525 KLNEYKRRQAPIGIRVTHRAFGRDWRYPITSRFAERLGE 563


>gi|218247801|ref|YP_002373172.1| NAD synthetase [Cyanothece sp. PCC 8801]
 gi|218168279|gb|ACK67016.1| NAD+ synthetase [Cyanothece sp. PCC 8801]
          Length = 561

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 230/578 (39%), Positives = 330/578 (57%), Gaps = 46/578 (7%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQLNP +GD+  N  K   A   A  Q + L+L  EL + GYPP DL+   SFI+
Sbjct: 1   MKIAIAQLNPTIGDLVNNAHKILNAANLAASQNVRLLLTPELSLCGYPPRDLLLYPSFIK 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQD-------QEGVLNSVVILDAGNIIAVRDKINL 117
           + +  +  L        A ++VG    +       ++ + NS  +L+ G +  +  K  L
Sbjct: 61  SLTLELQELAQKLPSQLA-VLVGTVTPNNAAAINGEKPLFNSAALLENGEVKQLFHKCLL 119

Query: 118 PNYSEFHEKRTFISGYSNDPI-VFRD------IRLGILICEDIWKNS----------NIC 160
           PNY  F E R F SG   +   +F D      I++G+ ICED+W +           N  
Sbjct: 120 PNYDVFDEHRYFESGKQPNYFELFLDDHSSEPIKIGVTICEDLWNDEQFWQKRHYQQNPI 179

Query: 161 KHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGAS 220
           K L   G + + +L+ASPYY  K K R  ++     +  +P+IYVNQ+GG DELIFDG S
Sbjct: 180 KTLANLGVDLIVNLSASPYYLAKPKLRETMLQHTSKYYQIPLIYVNQIGGNDELIFDGNS 239

Query: 221 FCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWN--YMSDDSASTMYIPLQEEEADYNA 278
           F  +   ++  + K F+E         D ++  WN  +     AS    P  EEE  ++A
Sbjct: 240 FVVNEHGEIVLKAKSFAE---------DVKIFTWNKSFKKIVLASVNNFPNTEEEEIWSA 290

Query: 279 CVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLED 338
            VL ++DY QK  F KVI+GLSGGIDSAL AAIA +A+G  NV  I++P  Y+S  SL+D
Sbjct: 291 LVLGVKDYAQKCQFSKVILGLSGGIDSALVAAIATEAIGANNVLGILMPSPYSSDHSLKD 350

Query: 339 AAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHS 398
           A    K LG  +  LPI  ++  + +L++        GI  EN+Q+RIRGN+LMA++N  
Sbjct: 351 AEKLVKNLGINHQTLPISGIMKTYDNLLNPLFSGTQFGIAEENLQARIRGNLLMAIANKF 410

Query: 399 KAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTE 458
             +LL+T NKSEI+VGY TLYGDM+GG   + D+ KT+VF L  W N H          E
Sbjct: 411 GYLLLSTGNKSEIAVGYCTLYGDMNGGLAVIADVPKTRVFSLCHWLNRH---------QE 461

Query: 459 VIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRY 517
           +IP +IL K PSAEL+P+QTDQ+SLPPY ILD+I++R + + +SF    +  +N   V+ 
Sbjct: 462 IIPHNILIKPPSAELKPNQTDQDSLPPYEILDEILERRINHHQSFDEICEAGFNANIVQK 521

Query: 518 VEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           V  L+  +E+KR+QAP+  K+T K+FG     PI+++ 
Sbjct: 522 VLKLVARAEFKRKQAPLVLKVTDKAFGTGWRMPIASQI 559


>gi|163783722|ref|ZP_02178709.1| NH(3)-dependent NAD+ synthetase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881047|gb|EDP74564.1| NH(3)-dependent NAD+ synthetase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 567

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 229/581 (39%), Positives = 325/581 (55%), Gaps = 47/581 (8%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARR--AREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           L + +AQ+NPVVGDI GN+ K R   AR E       LI+F EL +SGY PEDL+ +  F
Sbjct: 2   LNVTLAQVNPVVGDIEGNVEKIRESVARCEDTSH---LIVFPELVVSGYFPEDLLLRIDF 58

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           ++ C  A++ L     D  + +VVG P    + + NS+ +L  G ++ V  K  LPNYS 
Sbjct: 59  VRKCMEAVEELAKSLKDAKSLVVVGAPFYGGD-LYNSLYLLYGGEVVGVYHKGRLPNYSV 117

Query: 123 FHEKRTFISGYSNDPIV--FRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           F EKR F  G   DP++     I+LG  ICEDIW   ++ +     GAE + ++NASPY+
Sbjct: 118 FDEKRYFREG--EDPLLVELNGIKLGFSICEDIWYPDHLERLSVLSGAEVIVNINASPYH 175

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R   V  +       ++Y N VGG DEL+FDG S   D   ++  + K F E  
Sbjct: 176 IGKHEFREGFVRARAEDNICFVLYANLVGGHDELVFDGRSMVVDPLGRVVGRAKSFEEDL 235

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD-----------------------YN 277
                  D+   +         ++  I     EA                        Y 
Sbjct: 236 LTLSIDVDKVRRRRLLDLRWRNASREIDPFPVEASIELPDKPYVEPRLEESPSEEEEVYR 295

Query: 278 ACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLE 337
           A VL   DYV KN F KV+IGLSGG+DS+L A IA DALG + V  + +P +++S +S E
Sbjct: 296 AVVLGTHDYVVKNGFSKVVIGLSGGMDSSLTACIATDALGADKVLGVFMPSRFSSKESFE 355

Query: 338 DAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNH 397
           DA   A  LG ++  +PI ++   +   +   L E       ENIQ+RIR NIL  +SN 
Sbjct: 356 DAKTLADNLGIEFHTVPIDEVYVAYHDELLPVLGEIEFDTADENIQARIRANILFYISNK 415

Query: 398 SKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLT 457
              ++L+TSNKSE + GY T+YGDMSGGF PLKDLYKT +++LA +RNS         L+
Sbjct: 416 LGHLVLSTSNKSESATGYTTIYGDMSGGFAPLKDLYKTTIYKLARYRNS---------LS 466

Query: 458 EVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENE---ESFINNDQEYNDET 514
            VIP  + +K PSAELRP+QTDQ++LPPY +LD+I+K  +E+    E  +   + Y+  T
Sbjct: 467 PVIPERVFQKPPSAELRPNQTDQDTLPPYEVLDEILKMYLEDNVSPEDIVK--KGYDRGT 524

Query: 515 VRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           V  V  ++  +EYKR+QAPVG K+T+++FG+D   PI+N++
Sbjct: 525 VFKVVKMVRRAEYKRKQAPVGVKVTSRAFGKDWRMPITNRY 565


>gi|167569235|ref|ZP_02362109.1| NAD synthetase [Burkholderia oklahomensis C6786]
          Length = 566

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 233/581 (40%), Positives = 335/581 (57%), Gaps = 42/581 (7%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF- 62
           K +IA+AQLN  VGD AGN+AK   A   A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVAKIVAAARAAHDAGAQLLIAPELALSGYPPEDLLLRPAFY 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFP----------------RQDQEGV-----LNSVV 101
             + ++  +         G  ++VG P                R  + GV      N+  
Sbjct: 62  AASDAALAELAALLKPLAGLAVLVGHPQRAAGSGASSADGNANRPIERGVSPTDTYNAAS 121

Query: 102 ILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNI 159
           ++  G ++    K +LPN   F EKR F +  +  P VF    ++ G++ICED+W +++ 
Sbjct: 122 LIVDGEVVGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVKFGVVICEDVW-HASA 178

Query: 160 CKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGA 219
            +  K  GA+ L   N SPY+ NK   R +I+  +I    LP+IYVN VGGQDEL+FDG 
Sbjct: 179 AQLAKAAGAQVLIVPNGSPYHMNKEAVRIDILRARIRETGLPMIYVNLVGGQDELVFDGG 238

Query: 220 SFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNAC 279
           SF  DG  +L  +M  F E N + E+   + L           + +   L  E   Y A 
Sbjct: 239 SFVLDGAGELVAKMPQFEEGNAVVEFDGARPLP----------ARIAPELSVEAQVYRAL 288

Query: 280 VLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDA 339
           VL + DY+ KN F   IIGLSGG+DSAL  A+AVDALG + V+ +M+P +YT+  S  DA
Sbjct: 289 VLGVHDYIGKNGFPGAIIGLSGGVDSALVLAVAVDALGADRVRAVMMPSRYTADISTTDA 348

Query: 340 AACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSK 399
           AA AK +G +YD + I  + + F + ++            ENIQ+RIRG +LMALSN   
Sbjct: 349 AAMAKRVGVRYDEIAIAPMFDAFRTSLAGEFAGRAEDATEENIQARIRGTLLMALSNKFG 408

Query: 400 AMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEV 459
           +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+      L    +V
Sbjct: 409 SIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEYGKL----DV 464

Query: 460 IPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYV 518
           IP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y++  V+ V
Sbjct: 465 IPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYSEADVKRV 524

Query: 519 EHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
             L+  +EYKRRQAPVG ++T ++FGRD  YPI++ F + I
Sbjct: 525 TRLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSCFTESI 565


>gi|108805552|ref|YP_645489.1| NH(3)-dependent NAD(+) synthetase [Rubrobacter xylanophilus DSM
           9941]
 gi|108766795|gb|ABG05677.1| NH(3)-dependent NAD(+) synthetase [Rubrobacter xylanophilus DSM
           9941]
          Length = 577

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 221/579 (38%), Positives = 327/579 (56%), Gaps = 38/579 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +++A+AQ+N  VGDI GN  +     E A R G +L+ F EL ++GYPPEDL+ +  F+ 
Sbjct: 1   MRVALAQINTTVGDIWGNAERVSGTLERALRGGAELVAFPELALTGYPPEDLLLRPGFVH 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
              +A++ + +   +G A   VGF     + + N+  ++  G ++    K  LPNY  F 
Sbjct: 61  DNLAALEEVAARVPEG-AVAAVGFVDLGTD-LFNACAVISGGRVLHRYHKRYLPNYGVFD 118

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E R F  G     +      +G+ +CEDIW      +     GA  L +++ASPY+  K 
Sbjct: 119 ENRYFREGGGAPVLRLDGTLVGVSVCEDIWYPGGPAREQALAGASVLLNISASPYHRRKG 178

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R  +++ + S     +++ N VGGQDEL+FDG S  FD + +L  + + F E     +
Sbjct: 179 ALRERMLSVRASDYGCYVLFCNLVGGQDELVFDGHSVVFDPEGRLLARARQFEEDLLFVD 238

Query: 245 WHYDQQLSQWNYMS-------DDSASTMYIP-------------------LQEEEADYNA 278
            + ++ L Q  + S       +     + +P                   L EE     A
Sbjct: 239 LYPEEALVQRLHESRPRKEELETEPEVVEVPGFRERREPAQSREPRAEELLPEEGEVLEA 298

Query: 279 CVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLED 338
            VL LRDY +KN F + ++GLSGGIDS+L AA+A  ALG ENV  +++P +YTS  S  D
Sbjct: 299 LVLGLRDYFRKNGFSRAVLGLSGGIDSSLTAAVAARALGPENVTGVLMPSRYTSEASNAD 358

Query: 339 AAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHS 398
           A A AK LG    V+PI    + +  ++++  +  P  +  ENIQ+RIRGNI+MALSN  
Sbjct: 359 ARAVAKNLGIDVRVIPIGRAFDAYREMLAEVFRGLPEDVTEENIQARIRGNIVMALSNKF 418

Query: 399 KAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRN-SHGITSGLGPLT 457
             + L+T NKSE+SVGY TLYGDM+GGF+ LKD+ KT V+++A + N + G         
Sbjct: 419 GWIALSTGNKSEMSVGYSTLYGDMAGGFSVLKDVPKTLVYRVARYVNEAEG--------R 470

Query: 458 EVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVR 516
           EVIP S+L K PSAELRP Q D +SLPPY +LD I++  VE+++         + +E VR
Sbjct: 471 EVIPESVLTKEPSAELRPGQRDVDSLPPYEVLDPILEAYVEDDKGVGEIVAMGFEEEDVR 530

Query: 517 YVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
            V  ++  +EYKRRQAPVG K+T ++FGRDR  PI+N++
Sbjct: 531 RVVRMVDRAEYKRRQAPVGIKVTTRAFGRDRRMPITNRY 569


>gi|56460294|ref|YP_155575.1| NAD synthetase [Idiomarina loihiensis L2TR]
 gi|56179304|gb|AAV82026.1| NAD synthase [Idiomarina loihiensis L2TR]
          Length = 543

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 220/566 (38%), Positives = 324/566 (57%), Gaps = 30/566 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + KL + +AQL+  VG I  N A   +   E   Q  D+I+F EL I+GYPPEDL+F+  
Sbjct: 1   MAKLSLCLAQLDFTVGAIHNNTALILKTLREQGEQ-HDIIVFPELAITGYPPEDLLFRDD 59

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
             QA  +A++ + +   D    ++VG P+     + N++ +L  G  +    K  LPNY 
Sbjct: 60  LHQAVDNAVEQISAAASD--CVVIVGHPQAVGGELFNAMSVLHRGECLHRYFKQRLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E+R FI G+ +    ++ +R+G+ ICED+W    + + L       L S+NASPY  
Sbjct: 118 VFDEQRYFIPGHQSQVFEWQGVRIGLQICEDLWHPQPLQQLLDDDIDLVL-SINASPYEL 176

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
           NK ++R  ++  +++    PI+Y+N  G QDEL+FDG S   D + +L  ++ H      
Sbjct: 177 NKHEQRLGVLKQRVAEAGKPILYLNNCGAQDELVFDGHSLVLDAEGELVAELPHCEMTTA 236

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEAD----YNACVLSLRDYVQKNNFHKVII 297
              +             D     +    + E+ D    Y+A VL++RDYV KN F  V++
Sbjct: 237 SVTY------------EDKGIRCVGFEPKAEQNDLAHVYDALVLAVRDYVTKNGFSGVVL 284

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSAL  AIA DALG + V  +M+P++YTS  SLEDA   A  LG +YDV+PI  
Sbjct: 285 GLSGGIDSALTLAIASDALGADKVHAVMMPFRYTSDMSLEDAEKQADTLGVRYDVVPIEP 344

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
           + N F + +     E  +    EN+QSR RG +LMALSN + +++L T NKSE++VGY T
Sbjct: 345 MFNEFMTQLGPLFGETETDTTEENLQSRCRGVLLMALSNKTGSLVLATGNKSEMAVGYAT 404

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM GGF P+KD+ K  V+QLA +RN+ G           IP  ++++ PSAEL P Q
Sbjct: 405 LYGDMCGGFAPIKDIPKLLVYQLAEFRNTRG---------ACIPQRVIDRPPSAELAPDQ 455

Query: 478 TDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            D +SLP Y  LD I+   VE + S  +     + +E VR V  L+  +EYKRRQ+ VG 
Sbjct: 456 VDSDSLPDYSDLDRILALYVERDWSVTDIIAAGFVEEDVRRVVRLVDLNEYKRRQSAVGP 515

Query: 537 KITAKSFGRDRLYPISNKFRDHISEE 562
           K+T ++FG+DR YPI++ +R  +  +
Sbjct: 516 KVTPRNFGKDRRYPITSHYRHELQRQ 541


>gi|33596092|ref|NP_883735.1| NAD synthetase [Bordetella parapertussis 12822]
 gi|33573095|emb|CAE36737.1| putative NAD synthetase [Bordetella parapertussis]
          Length = 544

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 227/556 (40%), Positives = 325/556 (58%), Gaps = 18/556 (3%)

Query: 6   KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQA 65
           ++ IAQ+N  VGD+AGN A+  +A  +A  QG D+++  EL ++GYPPEDL+ +  FIQ 
Sbjct: 5   RVGIAQINACVGDLAGNAARVLQAARQAAGQGADVLVTPELVLTGYPPEDLLLRPRFIQE 64

Query: 66  CSSAIDTLKSDTHD-GGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
             +  + L  D     G  +V+G     Q+ + N+  ++  G ++    K  LPNYS F 
Sbjct: 65  QQAVFERLCQDLAGLAGLHVVIGHVLARQDRLYNAATVVCEGRVLGSYCKRELPNYSVFD 124

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E+R F +         + +R G+ ICEDIW                L S NASPY   K 
Sbjct: 125 EQRYFSAHGEAFGFTVKGVRFGLNICEDIWLERAPRAAAADGAQVLLVS-NASPYNTGKQ 183

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           ++R  +    +      +IY N VGGQDEL+FDGASF  D Q +++ ++  F+E   + E
Sbjct: 184 EERLSVARRSVQDTGCALIYANLVGGQDELVFDGASFALDAQGRMSARLPDFTEGVNVLE 243

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
                 +     +   +      P   EE  +NA VL +RDY+ KN F   IIGLSGGID
Sbjct: 244 ------VDARGTVRPVTEQAAVQPYGLEEQVWNALVLGVRDYLGKNGFPGAIIGLSGGID 297

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+  A+AVDA+G +NV+ +M+P +YT+  SL DAA  A+ LG +YDV+ I ++V+ F +
Sbjct: 298 SAVVLAVAVDAVGADNVRAVMMPSRYTADISLTDAADMARRLGVQYDVIAIGEVVDRFEA 357

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++      P     ENIQ+R RG +LMALSN +  ++LTT NKSE++ GY TLYGDM+G
Sbjct: 358 ALAPQFAGLPVDATEENIQARARGTLLMALSNKTGRLVLTTGNKSEMTTGYCTLYGDMAG 417

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF  +KD+ KT V++LA+WRN             +IP  I+ + PSAELRP QTDQ+SLP
Sbjct: 418 GFAVIKDVPKTLVYRLANWRNQR---------QPIIPERIITRPPSAELRPDQTDQDSLP 468

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY ILD II+R +E+  S  +     +  E V  V  L+  +EYKRRQAP G +IT ++F
Sbjct: 469 PYDILDGIIERYMEHNASAADIVAAGFPREAVGQVVRLIRINEYKRRQAPPGPRITPRAF 528

Query: 544 GRDRLYPISNKFRDHI 559
           GRD  YP++N FR+ +
Sbjct: 529 GRDWRYPVTNGFRETV 544


>gi|167580208|ref|ZP_02373082.1| NAD synthetase [Burkholderia thailandensis TXDOH]
          Length = 561

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 236/579 (40%), Positives = 342/579 (59%), Gaps = 43/579 (7%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           K +IA+AQLN  VGD AGN+AK   A + A+  G  L++  EL +SGYPPEDL+ + +F 
Sbjct: 2   KTRIALAQLNVTVGDFAGNVAKIVAAAQAAHDAGAHLLIAPELALSGYPPEDLLLRPAFY 61

Query: 64  QACSSAIDTLKSDTHD-GGAGIVVGFP-----------RQDQEGV-----LNSVVILDAG 106
            A  +A+  L +      G  ++VG P           R  + GV      N+  ++  G
Sbjct: 62  AASDAALAELAAQLKPFAGLAVLVGHPLRAPSADGNANRAIERGVPPVDTYNAASLIVGG 121

Query: 107 NIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFR--DIRLGILICEDIWKNSNICKHLK 164
            +     K +LPN   F EKR F +  +  P VF    ++ G++ICED+W +++  +  K
Sbjct: 122 EVAGTYRKQDLPNTEVFDEKRYFATDAA--PYVFELNGVKFGVVICEDVW-HASAAQLAK 178

Query: 165 KQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFD 224
             GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG SF  D
Sbjct: 179 AAGAQVLIVPNGSPYHMNKDAVRIDILRARIRETGLPMVYVNLVGGQDELVFDGGSFVLD 238

Query: 225 GQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLR 284
           G  +L  +M  F E N + E+   + L      +    + +Y           A VL +R
Sbjct: 239 GAGELVAKMPQFEEGNAIVEFDGARALPAAIAPALSVEAQVY----------RALVLGVR 288

Query: 285 DYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAK 344
           DY+ KN F   IIGLSGG+DSAL  A+AVDALG E V+ +M+P +YT+  S  DAA  A+
Sbjct: 289 DYIGKNGFPGAIIGLSGGVDSALVLAVAVDALGAERVRAVMMPSRYTAGISTTDAADMAR 348

Query: 345 ALGCKYDVLPIHDLVNHF-FSLMSQF--LQEEPSGIVAENIQSRIRGNILMALSNHSKAM 401
            +G +YD + I  + + F  SL ++F  L E+ +    ENIQ+RIRG +LMALSN   ++
Sbjct: 349 RVGVRYDEIAIAPMFDAFRASLAAEFAGLAEDAT---EENIQARIRGTLLMALSNKFGSI 405

Query: 402 LLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIP 461
           +LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+           ++IP
Sbjct: 406 VLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAAAEYG----QPDIIP 461

Query: 462 PSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEH 520
             IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y++  V+ V  
Sbjct: 462 ERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYSEADVKRVTR 521

Query: 521 LLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
           L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + I
Sbjct: 522 LIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFVESI 560


>gi|75906642|ref|YP_320938.1| NAD synthetase [Anabaena variabilis ATCC 29413]
 gi|75700367|gb|ABA20043.1| NH(3)-dependent NAD(+) synthetase [Anabaena variabilis ATCC 29413]
          Length = 566

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 223/573 (38%), Positives = 322/573 (56%), Gaps = 42/573 (7%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF