PSIBLAST alignment of GI: 254780999 and protein with PDB id: 1f89

gi|16975399|pdb|1F89|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Nit3, A Member Of Branch 10 Of The Nitrilase Superfamily Length = 291
>gi|16975400|pdb|1F89|B Chain B, Crystal Structure Of Saccharomyces Cerevisiae Nit3, A Member Of Branch 10 Of The Nitrilase Superfamily Length = 291
 Score =  125 bits (314), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 52/259 (20%), Positives = 99/259 (38%), Gaps = 17/259 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMD--LILFTELFISGYPPEDLVFK 59
            +K+K+A+ QL+    D   N+ +A    E A ++  D  L++  E F S Y   D   K
Sbjct: 8   SQKIKVALVQLSGSSPDKMANLQRAATFIERAMKEQPDTKLVVLPECFNSPYST-DQFRK 66

Query: 60  KSFI---QACSSAIDTLKSDTHDGGAGIVVGF-PRQDQ--EGVLNSVVILD-AGNIIAVR 112
            S +   +  S+++  L +  +     +V G  P  D   + + N+ +I +  G +I   
Sbjct: 67  YSEVINPKEPSTSVQFLSNLANKFKIILVGGTIPELDPKTDKIYNTSIIFNEDGKLIDKH 126

Query: 113 DKINLP-----NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG 167
            K++L      N   FHE  T   G  +  I  +  + G+ IC D+     +     ++G
Sbjct: 127 RKVHLFDVDIPNGISFHESETLSPGEKSTTIDTKYGKFGVGICYDMRFP-ELAMLSARKG 185

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
           A  +   +A       L       +  + +    ++       Q      G S   D + 
Sbjct: 186 AFAMIYPSAFNTVTGPLHWHLLARSRAVDNQVYVMLCSPARNLQSSYHAYGHSIVVDPRG 245

Query: 228 QLAFQMKHFSEQNFMTEWH 246
           ++  +     E+    E  
Sbjct: 246 KIVAEAGE-GEEIIYAELD 263