PSIBLAST alignment of GI: 254780999 and protein with PDB id: 1nsy

>gi|2392477|pdb|1NSY|A Chain A, Crystal Structure Of Nh3-Dependent Nad+ Synthetase From Bacillus Subtilis Length = 271
>gi|2392478|pdb|1NSY|B Chain B, Crystal Structure Of Nh3-Dependent Nad+ Synthetase From Bacillus Subtilis Length = 271
 Score =  118 bits (295), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 61/281 (21%), Positives = 104/281 (37%), Gaps = 41/281 (14%)

Query: 265 MYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAI-------AVDALG 317
              P  + + +    V  L+ YV+K      ++G+SGG DS L   +         +  G
Sbjct: 11  HVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVESIREEGG 70

Query: 318 KENVQTIMLPYKYTSPQSLEDAAACAKALGC-KYDVLPIHDLVNHFFSLMSQFLQEEPSG 376
                 + LP  + + Q  +DA    K +   K     I   V+ F     Q   ++ + 
Sbjct: 71  DAQFIAVRLP--HGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQQETGDQLTD 128

Query: 377 IVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQ 436
               N+++R R     A+      ++L T + +E   G+ T YGD      PL  L K Q
Sbjct: 129 FNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLLPLTGLTKRQ 188

Query: 437 VFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAEL---RPHQTDQESLP-PYPILDDI 492
              L     +              P  +  K P+A+L   +P Q+D+  L   Y  +DD 
Sbjct: 189 GRTLLKELGA--------------PERLYLKEPTADLLDEKPQQSDETELGISYDEIDDY 234

Query: 493 IKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAP 533
           ++              + ++      E     +E+KR Q P
Sbjct: 235 LEG--------KEVSAKVSEAL----EKRYSMTEHKR-QVP 262