PSIBLAST alignment of GI: 254780999 and protein with PDB id: 1xng

>gi|62738501|pdb|1XNG|A Chain A, Crystal Structure Of Nh3-Dependent Nad+ Synthetase From Helicobacter Pylori Length = 268
>gi|62738502|pdb|1XNG|B Chain B, Crystal Structure Of Nh3-Dependent Nad+ Synthetase From Helicobacter Pylori Length = 268
 Score =  142 bits (359), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 71/252 (28%), Positives = 121/252 (48%), Gaps = 26/252 (10%)

Query: 283 LRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAAC 342
           L   VQK  F KV+ GLSGG+DSA+   +      KEN   +++P   + P++  DA   
Sbjct: 16  LEKEVQKRGFKKVVYGLSGGLDSAVVGVLCQKVF-KENAHALLMPSSVSMPENKTDALNL 74

Query: 343 AKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAML 402
            +     Y    I       +  +     ++ S     N  +R+R   L   S  S +++
Sbjct: 75  CEKFSIPYTEYSIAP-----YDAIFSSHFKDASLTRKGNFCARLRMAFLYDYSLKSDSLV 129

Query: 403 LTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPP 462
           + TSNKSE  +GYGTL+GD++   NP+ +L+KT+V++LA   N              IP 
Sbjct: 130 IGTSNKSERMLGYGTLFGDLACAINPIGELFKTEVYELARRLN--------------IPK 175

Query: 463 SILEKSPSAELRPHQTDQESLP-PYPILDDII---KRIVENEESFINNDQ--EYNDETVR 516
            IL K PSA+L   Q+D++ L  PY ++D ++   + + + +           Y++  V+
Sbjct: 176 KILNKPPSADLFVGQSDEKDLGYPYSVIDPLLKDIEALFQTKPIDTETLAQLGYDEILVK 235

Query: 517 YVEHLLYGSEYK 528
            +   +  + +K
Sbjct: 236 NITSRIQKNAFK 247