PSIBLAST alignment of GI: 254780999 and protein with PDB id: 2ggk

>gi|99032529|pdb|2GGK|A Chain A, The Mutant A302c Of Agrobacterium Radiobacter N-Carbamoyl-D- Amino-Acid Amidohydrolase Length = 304
>gi|99032530|pdb|2GGK|B Chain B, The Mutant A302c Of Agrobacterium Radiobacter N-Carbamoyl-D- Amino-Acid Amidohydrolase Length = 304
 Score =  101 bits (252), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 46/298 (15%), Positives = 103/298 (34%), Gaps = 35/298 (11%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIA----KARRAREEANRQGMDLILFTELFISGYPPEDL 56
           M +++ +A+ Q  P+    A        +       A  +G++ I+F EL ++ + P   
Sbjct: 1   MTRQMILAVGQQGPIA--RAETREQVVGRLLDMLTNAASRGVNFIVFPELALTTFFPRWH 58

Query: 57  VFKKSFIQACSSA------IDTLKSDTHDGGAGIVVGFPR--QDQE--GVLNSVVILDA- 105
              ++ + +          +  L     + G G  +G+     +       N+ +++D  
Sbjct: 59  FTDEAELDSFYETEMPGPVVRPLFETAAELGIGFNLGYAELVVEGGVKRRFNTSILVDKS 118

Query: 106 GNIIAVRDKINLPNYSEFH--------EKRTFISGY-SNDPIVFRDIRLGILICEDIWKN 156
           G I+    KI+LP + E+         EKR F  G            ++G+ IC D    
Sbjct: 119 GKIVGKYRKIHLPGHKEYEAYRPFQHLEKRYFEPGDLGFPVYDVDAAKMGMFICNDRRWP 178

Query: 157 SNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVN--------QV 208
               + +  +GAE +     +P ++  + +   + +           Y N        +V
Sbjct: 179 ETW-RVMGLKGAEIICGGYNTPTHNPPVPQHDHLTSFHHLLSMQAGSYQNGAWSAAAGKV 237

Query: 209 GGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMY 266
           G ++  +  G S       ++        ++        D+      ++ +  A    
Sbjct: 238 GMEEGCMLLGHSCIVAPTGEIVALTTTLEDEVITAALDLDRCRELREHIFNFKAHRQP 295