PSIBLAST alignment of GI: 254780999 and protein with PDB id: 2ggl

>gi|99032533|pdb|2GGL|A Chain A, The Mutant A222c Of Agrobacterium Radiobacter N-Carbamoyl-D- Amino Acid Amidohydrolase Length = 304
>gi|99032534|pdb|2GGL|B Chain B, The Mutant A222c Of Agrobacterium Radiobacter N-Carbamoyl-D- Amino Acid Amidohydrolase Length = 304
 Score =  102 bits (253), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/297 (14%), Positives = 91/297 (30%), Gaps = 33/297 (11%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIA----KARRAREEANRQGMDLILFTELFISGYPPEDL 56
           M +++ +A+ Q  P+    A        +       A  +G++ I+F EL ++ + P   
Sbjct: 1   MTRQMILAVGQQGPIA--RAETREQVVGRLLDMLTNAASRGVNFIVFPELALTTFFPRWH 58

Query: 57  VFKKSFIQACSSA------IDTLKSDTHDGGAGIVVGFPR--QDQE--GVLNSVVILDA- 105
              ++ + +          +  L     + G G  +G+     +       N+ +++D  
Sbjct: 59  FTDEAELDSFYETEMPGPVVRPLFETAAELGIGFNLGYAELVVEGGVKRRFNTSILVDKS 118

Query: 106 GNIIAVRDKINLPNYSEFH--------EKRTFISGY-SNDPIVFRDIRLGILICEDIWKN 156
           G I+    KI+LP + E+         EKR F  G            ++G+ IC D    
Sbjct: 119 GKIVGKYRKIHLPGHKEYEAYRPFQHLEKRYFEPGDLGFPVYDVDAAKMGMFICNDRRWP 178

Query: 157 SNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQV-------G 209
                   K         N   +     +  H      +  +                 G
Sbjct: 179 ETWRVMGLKGAEIICGGYNTPTHNPPVPQHDHLTSFHHLLSMQCGSYQNGAWSAAAGKVG 238

Query: 210 GQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMY 266
            ++  +  G S       ++        ++        D+      ++ +  A    
Sbjct: 239 MEEGCMLLGHSCIVAPTGEIVALTTTLEDEVITAALDLDRCRELREHIFNFKAHRQP 295