PSIBLAST alignment of GI: 254780999 and protein with PDB id: 2uxy

>gi|146387426|pdb|2UXY|A Chain A, Aliphatic Amidase Length = 341
 Score = 75.5 bits (184), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 32/256 (12%), Positives = 62/256 (24%), Gaps = 15/256 (5%)

Query: 15  VVGDIAGNIAKARRAREEANRQ--GMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDT 72
              ++  N  K         +   GMDL++F E  + G   +     ++ +       + 
Sbjct: 27  TAAEVLDNARKIAEMIVGMKQGLPGMDLVVFPEYSLQGIMYDPAEMMETAVAIPGEETEI 86

Query: 73  LKSDTHDGGAGIVVGFP-RQDQEGV----LNSVVILDA-GNIIAVRDKINLPNYSEFHEK 126
                       V      + +E       N++V++D  G I+    KI           
Sbjct: 87  FSRACRKANVWGVFSLTGERHEEHPRKAPYNTLVLIDNNGEIVQKYRKIIPW-----CPI 141

Query: 127 RTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKK 186
             +  G               LI  D      I +    +GAE +       Y     + 
Sbjct: 142 EGWYPGGQTYVSEGPKGMKISLIIXDDGNYPEIWRDCAMKGAELIVRCQGYMYPAKDQQV 201

Query: 187 RHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWH 246
                       +  +   N  G      + G S       +   +           +  
Sbjct: 202 MMAKAMAWA--NNCYVAVANAAGFDGVYSYFGHSAIIGFDGRTLGECGEEEMGIQYAQLS 259

Query: 247 YDQQLSQWNYMSDDSA 262
             Q           + 
Sbjct: 260 LSQIRDARANDQSQNH 275