PSIBLAST alignment of GI: 254780999 and protein with PDB id: 3dla

>gi|224983478|pdb|3DLA|A Chain A, X-Ray Crystal Structure Of Glutamine-Dependent Nad+ Synthetase From Mycobacterium Tuberculosis Bound To Naad+ And Don Length = 680
>gi|224983479|pdb|3DLA|B Chain B, X-Ray Crystal Structure Of Glutamine-Dependent Nad+ Synthetase From Mycobacterium Tuberculosis Bound To Naad+ And Don Length = 680
 Score =  326 bits (835), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 128/668 (19%), Positives = 239/668 (35%), Gaps = 114/668 (17%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +++A    +  +GD A N A         +  G  L +F EL +SGY  ED++ + S + 
Sbjct: 13  VRVAACTHHTTIGDPAANAASVLDMARACHDDGAALAVFPELTLSGYSIEDVLLQDSLLD 72

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           A   A+  L +++ D    +VVG P + +  + N+ V++  G ++ V  K  LP Y EF+
Sbjct: 73  AVEDALLDLVTESADLLPVLVVGAPLRHRHRIYNTAVVIHRGAVLGVVPKSYLPTYREFY 132

Query: 125 EKRTFISGYS-------------------NDPIVFRDIRLGILICEDIWKNSNICKHLKK 165
           E+R    G                               L + ICED++           
Sbjct: 133 ERRQMAPGDGERGTIRIGGADVAFGTDLLFAASDLPGFVLHVEICEDMFVPMPPSAEAAL 192

Query: 166 QGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGG--QDELIFDGASFCF 223
            GA  L +L+ SP    + + R  +     +      +Y     G    +L +DG +  +
Sbjct: 193 AGATVLANLSGSPITIGRAEDRRLLARSASARCLAAYVYAAAGEGESTTDLAWDGQTMIW 252

Query: 224 DGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMS------------------------- 258
           +    L  + + F +    +    D +L +   +                          
Sbjct: 253 EN-GALLAESERFPKGVRRSVADVDTELLRSERLRMGTFDDNRRHHRELTESFRRIDFAL 311

Query: 259 ----------DDSASTMYIPLQ------EEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
                      +     ++P        +    YN  V  L   ++  ++ KV+IG+SGG
Sbjct: 312 DPPAGDIGLLREVERFPFVPADPQRLQQDCYEAYNIQVSGLEQRLRALDYPKVVIGVSGG 371

Query: 303 IDSALCA-----AIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           +DS         A+  +   + ++    LP   T   +  +A   A+ALG  +  + I D
Sbjct: 372 LDSTHALIVATHAMDREGRPRSDILAFALPGFATGEHTKNNAIKLARALGVTFSEIDIGD 431

Query: 358 LVNHFFSLMSQFL--QEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGY 415
                   +       E+   +  EN+Q+ +R + L  ++N    ++L T + SE+++G+
Sbjct: 432 TARLMLHTIGHPYSVGEKVYDVTFENVQAGLRTDYLFRIANQRGGIVLGTGDLSELALGW 491

Query: 416 GTLY-GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
            T   GD    +N    + KT +  L  W  S G     G     +  S+L+   + EL 
Sbjct: 492 STYGVGDQMSHYNVNAGVPKTLIQHLIRWVISAGE---FGEKVGEVLQSVLDTEITPELI 548

Query: 475 PH-----QTDQESLPPYPILDDIIKRIVENEESFINND---------------------- 507
           P      Q+ +  + P+ + D  + +++                                
Sbjct: 549 PTGEEELQSSEAKVGPFALQDFSLFQVLRYGFRPSKIAFLAWHAWNDAERGNWPPGFPKS 608

Query: 508 --QEYNDETVRYVE-----HLLYGSEYKRRQAPVGTKITA-KSFGR--DRLYPISNK--- 554
               Y+   +R+            S++KR   P G K++   +     D   P       
Sbjct: 609 ERPSYSLAEIRHWLQIFVQRFYSFSQFKRSALPNGPKVSHGGALSPRGDWRAPSDMSARI 668

Query: 555 FRDHISEE 562
           + D I  E
Sbjct: 669 WLDQIDRE 676