BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780999|ref|YP_003065412.1| NAD synthetase [Candidatus
Liberibacter asiaticus str. psy62]
         (562 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780999|ref|YP_003065412.1| NAD synthetase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040676|gb|ACT57472.1| NAD synthetase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 562

 Score =  573 bits (1476), Expect = e-161,   Method: Composition-based stats.
 Identities = 562/562 (100%), Positives = 562/562 (100%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK
Sbjct: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY
Sbjct: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY
Sbjct: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
           HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN
Sbjct: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS
Sbjct: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN
Sbjct: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
           HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG
Sbjct: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ
Sbjct: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           ESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA
Sbjct: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540

Query: 541 KSFGRDRLYPISNKFRDHISEE 562
           KSFGRDRLYPISNKFRDHISEE
Sbjct: 541 KSFGRDRLYPISNKFRDHISEE 562


>gi|315122406|ref|YP_004062895.1| NAD synthetase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495808|gb|ADR52407.1| NAD synthetase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 561

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 429/558 (76%), Positives = 493/558 (88%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   LKIAIAQLNP VGD++GNIAKAR+AREEANRQG DLI+FTELFISGYP EDL+ K+
Sbjct: 1   MSIHLKIAIAQLNPTVGDVSGNIAKARQAREEANRQGADLIIFTELFISGYPAEDLILKE 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           SFIQAC   + TLK DT D GAGI++GFPRQDQEG+ NSV ILDAG I+++RDKI+LPNY
Sbjct: 61  SFIQACYDGMLTLKDDTRDNGAGIIIGFPRQDQEGIFNSVAILDAGKIVSIRDKIHLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           +EFHEKRTFISG +ND +VFRD  +GILICEDIWKNSNIC+HLKKQGA+ L +LNASPY 
Sbjct: 121 NEFHEKRTFISGNTNDIVVFRDNPIGILICEDIWKNSNICRHLKKQGAKILLTLNASPYC 180

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NKLK RHEI++ QISHV++PI+YVNQVGGQDELIFDGASFCF+G +QLAFQMKHF EQN
Sbjct: 181 RNKLKTRHEIISTQISHVNIPIVYVNQVGGQDELIFDGASFCFNGDRQLAFQMKHFEEQN 240

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T+W+YD++ S  N +SD S S +YI   EEE DYNACV+ LRDYV+KNNFHKVIIGLS
Sbjct: 241 LITQWYYDKKSSSLNCISDYSQSKIYIFPTEEETDYNACVVGLRDYVKKNNFHKVIIGLS 300

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSALCA IAVDALGKENVQTIMLPYKYTS +SLEDAAACAK+L C+YDVLPIHDLV+
Sbjct: 301 GGIDSALCATIAVDALGKENVQTIMLPYKYTSNESLEDAAACAKSLDCRYDVLPIHDLVD 360

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
           HFFS+MSQFLQEEPSGIVAENIQSRIRGNILM LSN S+AMLLTT+NKSEIS+GYGTLYG
Sbjct: 361 HFFSIMSQFLQEEPSGIVAENIQSRIRGNILMTLSNKSEAMLLTTNNKSEISIGYGTLYG 420

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DMSGGFNPLKDLYKT+V++LA WRN+H I  GLGP  EVIPP ILEK+PSAELRP+Q D+
Sbjct: 421 DMSGGFNPLKDLYKTKVYKLAYWRNAHCIPCGLGPFKEVIPPRILEKAPSAELRPNQIDE 480

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           +SLPPY ILD+II+ IVEN+ES  N  ++Y+ ET+RY+E+LLY SEYKRRQ+P GTKIT+
Sbjct: 481 DSLPPYAILDNIIEDIVENKESLKNTKKKYSTETIRYIENLLYRSEYKRRQSPPGTKITS 540

Query: 541 KSFGRDRLYPISNKFRDH 558
           KSFGRDRLYPISNKFRD 
Sbjct: 541 KSFGRDRLYPISNKFRDQ 558


>gi|222148504|ref|YP_002549461.1| NAD synthetase [Agrobacterium vitis S4]
 gi|221735490|gb|ACM36453.1| NAD synthetase [Agrobacterium vitis S4]
          Length = 559

 Score =  549 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 308/557 (55%), Positives = 402/557 (72%), Gaps = 7/557 (1%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           + L+IA+AQ NP VGD+ GN++ AR AR +A   G DL+L +ELFISGYPPEDLV K +F
Sbjct: 9   ETLRIAVAQFNPTVGDVVGNLSLARTARAKAASLGADLLLLSELFISGYPPEDLVLKPAF 68

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           +QAC +A++ L +DT DGG G+++GFPRQ  +G  NSV I+D G I+ +RDKI+LPNY E
Sbjct: 69  LQACKAAVEELAADTADGGPGVIIGFPRQGDKGRHNSVAIIDGGKILGLRDKIDLPNYGE 128

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F+ G    P+ FR +RLG+ ICE+IW +  +C+ L + GAE L   N SPYYH 
Sbjct: 129 FDEKRVFVEGDMPGPVNFRGVRLGVPICEEIWNDLGVCETLAESGAEILLVPNGSPYYHG 188

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           KL+ R+++V  Q+    LP+++ NQVGGQDEL+FDGASFCF+  + LAFQM  F E   +
Sbjct: 189 KLEVRYQVVLRQVIESGLPLVFANQVGGQDELVFDGASFCFNADKTLAFQMPQFEESIVL 248

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
           T W   ++   W     + ++      + EEADY AC+L  RDYV KN F  V++GLSGG
Sbjct: 249 TTWT--READGWRCAPGEVSAIP----EGEEADYRACMLGFRDYVNKNGFKSVVLGLSGG 302

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSA+CAA+AVDALG E V+TIMLPY+YTS +S +DAA CAKALGC YD++PI + V  F
Sbjct: 303 IDSAICAAMAVDALGHERVRTIMLPYRYTSEESFKDAADCAKALGCHYDIVPISEPVEGF 362

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            + ++   +   SGI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM
Sbjct: 363 LASLADMFEGTESGITEENLQSRTRGTILMAVSNKFGSMVVTTGNKSEMSVGYATLYGDM 422

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGFNP+KDLYK QV+ L++WRN+H     LGP  EVIP +I+ K+PSAELRP Q DQ+S
Sbjct: 423 NGGFNPIKDLYKMQVYALSAWRNAHVPVGALGPAGEVIPANIIAKAPSAELRPDQKDQDS 482

Query: 483 LPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPYP+LDDI++ +VE E S      + ++  TV  VEHLLY +EYKRRQ+  G KIT K
Sbjct: 483 LPPYPVLDDILECLVEKEMSVDEILGRGHDIATVHRVEHLLYLAEYKRRQSAPGVKITKK 542

Query: 542 SFGRDRLYPISNKFRDH 558
           +FGRDR YPI+N+FRD 
Sbjct: 543 NFGRDRRYPITNRFRDR 559


>gi|154251557|ref|YP_001412381.1| NAD+ synthetase [Parvibaculum lavamentivorans DS-1]
 gi|154155507|gb|ABS62724.1| NAD+ synthetase [Parvibaculum lavamentivorans DS-1]
          Length = 554

 Score =  549 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 277/559 (49%), Positives = 369/559 (66%), Gaps = 8/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  KL+IA+AQLNPVVGDIAGN+ KA  AR  A+  G +LI+FTELF++GYPPEDLV K 
Sbjct: 1   MTDKLRIALAQLNPVVGDIAGNLQKAVEARRAASVAGAELIVFTELFLTGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F +   +A++ L   T DGG  +++G P  ++  + N+V+ LD G I   R K++LPNY
Sbjct: 61  AFQRVAKAAVEDLARQTADGGPAVLIGAPWAEEGKLYNAVLHLDRGEIKGRRYKVHLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F E R F SG    P   R +R+G  ICEDIW      + L++ GAE L   N SPY 
Sbjct: 121 SVFDEPRVFASGPMPGPFSIRGVRIGAPICEDIWYPDV-VECLEESGAELLLVPNGSPYE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK   R ++   +I    LP+ YVNQ+GGQDEL+FDG SF  +    LA QM  + E+ 
Sbjct: 180 FNKPDARLQLALSRIRESGLPLAYVNQLGGQDELVFDGGSFVLNADFSLALQMPAWEEKI 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
             T+W      ++       +     +  + +E+ Y A V  LRDYV+KN F  V++GLS
Sbjct: 240 TCTDW------TRGEKGWVCAPGEKALVEEGDESLYLAVVQGLRDYVKKNRFPGVVLGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL AAIAVDALG + V  +MLPY+YTS +SL DA ACAK LG +YDV+PI + V 
Sbjct: 294 GGIDSALVAAIAVDALGADKVHCVMLPYRYTSSESLTDAEACAKLLGVRYDVVPIEEPVA 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F S + +  +   SG+  EN+QSR RG +LMA+SN   +MLLTT NKSE+S GY T+YG
Sbjct: 354 GFTSALEKMFEGTQSGVTEENLQSRTRGVVLMAISNKFGSMLLTTGNKSEVSAGYATIYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNP+KDLYK++VF+L++WRN+H     LGP   VIP  I+ + PSAELRP Q D+
Sbjct: 414 DMNGGFNPIKDLYKSRVFKLSNWRNTHMPKGCLGPEGRVIPERIITRPPSAELRPDQKDE 473

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ++DDI+  ++E E S  +   + ++ + V+ +EHLLY SEYKRRQA  G K+T
Sbjct: 474 DSLPPYEVMDDILHCLIEEEMSVTDIVARGHDRDLVKRIEHLLYISEYKRRQAAPGVKVT 533

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++FGRDR YPI N FRD 
Sbjct: 534 KRNFGRDRRYPIVNGFRDQ 552


>gi|163759637|ref|ZP_02166722.1| putative glutamine-dependent NAD(+) synthetase [Hoeflea
           phototrophica DFL-43]
 gi|162283234|gb|EDQ33520.1| putative glutamine-dependent NAD(+) synthetase [Hoeflea
           phototrophica DFL-43]
          Length = 562

 Score =  548 bits (1412), Expect = e-154,   Method: Composition-based stats.
 Identities = 298/558 (53%), Positives = 386/558 (69%), Gaps = 6/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
              L+IA+AQLNP VGD+AGN+AKAR AR +A+R G D++LFTELFI GYPPEDLV K +
Sbjct: 10  TDTLRIAVAQLNPTVGDVAGNLAKAREARADAHRHGADIVLFTELFIVGYPPEDLVLKPA 69

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
            I++C  A++ L +DT DGG  +++G+PR D     NSV +LD G ++  RDK++LPNY 
Sbjct: 70  LIRSCLKAVNELAADTADGGPAVIIGYPRSDDGKRHNSVAVLDGGKLVTSRDKVDLPNYG 129

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+  R +RLGI ICEDIW +  +C+ L + GAE L   N SPYY 
Sbjct: 130 EFDEKRVFDVGEMPGPVAIRGVRLGIPICEDIWGDLGVCETLAESGAEILLVPNGSPYYR 189

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+  RH++V  Q+    LP+++ NQVGGQDEL+FDGASF  +  + L FQM  F E   
Sbjct: 190 GKVDVRHQVVLRQVIESGLPMVFANQVGGQDELVFDGASFAMNADKSLGFQMSQFEETVS 249

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +  +       Q +         M +  + EEADY AC+L LRDYV KN F  V++GLSG
Sbjct: 250 IVTF-----KRQDDGTWRCKPGPMSVVPEGEEADYRACMLGLRDYVNKNGFRNVVLGLSG 304

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSALCAA+AVDALG+E V+T+MLPY+YTS  S  DA ACA+ALGC YD + I + V  
Sbjct: 305 GIDSALCAALAVDALGEERVRTVMLPYRYTSESSFTDAEACARALGCHYDTVAIEEPVQG 364

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F S + +  +    GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 365 FLSALGEMFEGTDEGITEENLQSRARGVILMAISNKFGSMVVTTGNKSEMSVGYATLYGD 424

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KDLYK QV+ L+ WRN+H     LGP  EVIP +I+ K+PSAELRP QTDQ+
Sbjct: 425 MNGGFNPIKDLYKLQVYALSRWRNAHVPPGALGPSGEVIPVNIINKAPSAELRPDQTDQD 484

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPY +LDDI++ +VE+E        + ++  TV  +EHLLY +EYKRRQ+  G KIT 
Sbjct: 485 SLPPYEVLDDILECLVEHEMGVEEIVARGHDIATVHRIEHLLYIAEYKRRQSAPGVKITR 544

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N++RD 
Sbjct: 545 KNFGRDRRYPITNRYRDR 562


>gi|86357986|ref|YP_469878.1| NAD synthetase [Rhizobium etli CFN 42]
 gi|86282088|gb|ABC91151.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli CFN
           42]
          Length = 559

 Score =  548 bits (1411), Expect = e-153,   Method: Composition-based stats.
 Identities = 317/558 (56%), Positives = 400/558 (71%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
               +IAI QLNP VGD+AGN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +
Sbjct: 8   SDIFRIAIGQLNPTVGDVAGNLAKAREARADAGREGAHLLVLTELFISGYPPEDLVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+AC  A+++L +DT DGG G+V+GFPRQDQ G  NSV +LD G ++AVRDK++LPNY 
Sbjct: 68  FIRACWKAVESLAADTADGGPGVVIGFPRQDQTGRYNSVAVLDGGKVVAVRDKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F+ G    P+ FR +RLGI ICEDIW +  +C+ L + GAE L S N SPYY 
Sbjct: 128 EFDEKRVFVQGAMPGPVNFRGVRLGIPICEDIWGDLGVCETLAESGAEILLSPNGSPYYR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+  RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     
Sbjct: 188 GKVDIRHQVVLKQVIETGLPLIYAAQLGGQDELVFDGASFAFNADKSLAFQMSQFETALA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +T W   +  + W+      A       ++EEADY AC+L  RDYV KN F  V++GLSG
Sbjct: 248 VTTW--KRGEAGWHCAEGPMARIP----EDEEADYRACLLGFRDYVNKNGFKTVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+C AIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI   V  
Sbjct: 302 GIDSAICTAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEQPVTG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F S +S   +   SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGD
Sbjct: 362 FSSALSNLFEGTESGITEENLQSRARGVILMAISNKFGAMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KDLYK QV+ LA WRN +     LGP  EVIP +I++K+PSAELRP Q DQ+
Sbjct: 422 MNGGFNPIKDLYKMQVYALARWRNENVPPGALGPSGEVIPQNIIDKAPSAELRPDQKDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VE E +      + ++  TV  VEHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|307946670|ref|ZP_07662005.1| NAD(+) synthase (glutamine-hydrolyzing) [Roseibium sp. TrichSKD4]
 gi|307770334|gb|EFO29560.1| NAD(+) synthase (glutamine-hydrolyzing) [Roseibium sp. TrichSKD4]
          Length = 555

 Score =  546 bits (1406), Expect = e-153,   Method: Composition-based stats.
 Identities = 279/558 (50%), Positives = 375/558 (67%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
             +++IA+AQLNP VGD+ GN  K R+AR+EA + G DL+L  EL +SGYPPEDLV K +
Sbjct: 3   TDRIRIAVAQLNPTVGDLTGNADKVRKARDEAAQLGADLVLCPELTLSGYPPEDLVLKPA 62

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+Q C   +  L S+T   G G+++G P  +   + N+V ++D G I ++R K +LPNYS
Sbjct: 63  FVQRCMDLVSELASETKGEGPGLLIGSPWAEDGQLYNAVALVDDGEIKSIRYKYDLPNYS 122

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F EKR F +G    P+ FR +RLG+ ICEDIW +    + L + GAE L   N SPY+H
Sbjct: 123 VFDEKRVFAAGPLPGPMDFRGVRLGVPICEDIWNDEVC-ECLAETGAELLLVPNGSPYWH 181

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
           N+ ++R ++V  ++    LP+IY NQ+GGQDEL+FDG SF     + LAFQM  F+    
Sbjct: 182 NRAEERLQVVVSRVVESDLPLIYCNQIGGQDELVFDGGSFGLQANRTLAFQMSQFTSDLA 241

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +TEW   +          +S     +P   + A++ ACV  LRDYV KN F  V++GLSG
Sbjct: 242 VTEWVKGED----EIWVCESGPKAALP-DLDTANWQACVRGLRDYVTKNGFPGVVLGLSG 296

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+AVDALG + V  IMLPY+YTS +S++DAA CA ALG +YD +PI + V  
Sbjct: 297 GIDSAICAAMAVDALGADKVHAIMLPYRYTSEESIKDAAECAAALGIRYDTVPIEEPVLG 356

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F +++S       S    EN+QSR RG ILMA+SN    M++TT NKSE+SVGY TLYGD
Sbjct: 357 FTNVLSDLFAGTKSDTTEENLQSRARGVILMAVSNKFGHMVVTTGNKSEMSVGYATLYGD 416

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GG+NP+KDLYKTQV+ LA WRN +     LGP  EVIP +I+ K P+AELR +QTDQ+
Sbjct: 417 MNGGYNPIKDLYKTQVYHLADWRNHNRPDGMLGPEGEVIPTNIITKVPTAELRENQTDQD 476

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPY +LDDI+  +VE E S      + ++   +  VEHLLY +EYKRRQAP G KIT+
Sbjct: 477 SLPPYDVLDDILNCLVEEEMSVNEIEARGHDKALIHKVEHLLYIAEYKRRQAPPGVKITS 536

Query: 541 KSFGRDRLYPISNKFRDH 558
           ++FG+DR YPI+N+FRD 
Sbjct: 537 RNFGKDRRYPITNRFRDR 554


>gi|241204941|ref|YP_002976037.1| NAD synthetase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858831|gb|ACS56498.1| NAD+ synthetase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 559

 Score =  544 bits (1402), Expect = e-152,   Method: Composition-based stats.
 Identities = 313/558 (56%), Positives = 398/558 (71%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
               +IAI QLNP VGD+AGN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +
Sbjct: 8   SDIFRIAIGQLNPTVGDVAGNLAKAREARTDAAREGAHLLVLTELFISGYPPEDLVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+AC  A++ L +DT DGG G+++GFPRQD+ G  NSV +LDAG +IAVRDKI+LPNY 
Sbjct: 68  FIRACWKAVENLAADTADGGPGVIIGFPRQDETGRYNSVAVLDAGKVIAVRDKIDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+ FR +R+GI ICEDIW +  +C+ L + GAE L S N SPYY 
Sbjct: 128 EFDEKRVFDQGAMPGPVNFRGVRIGIPICEDIWGDLGVCETLAESGAEILLSPNGSPYYR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+  RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     
Sbjct: 188 GKVDIRHQVVLKQVIETGLPLIYAAQLGGQDELVFDGASFAFNADKSLAFQMSQFETALA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +T W   +    W+      A       + EEADY AC+L  RDYV KN F  V++GLSG
Sbjct: 248 VTTW--KRGEDGWHCAEGPMAHIP----ESEEADYRACLLGFRDYVNKNGFKTVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CA+ALGC+YD++PI   V  
Sbjct: 302 GIDSAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCARALGCRYDIVPIEQPVTG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F S ++   +   SGI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 362 FSSALASLFEGTDSGITEENLQSRARGVILMAISNKFGSMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KDLYK QV+ ++ WRN +     LGP  EVIP +I++K+PSAELRP Q DQ+
Sbjct: 422 MNGGFNPIKDLYKMQVYAISRWRNENVPPGALGPSGEVIPQNIIDKAPSAELRPDQKDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VE E +      + ++  TV  VEHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|15965599|ref|NP_385952.1| NAD synthetase [Sinorhizobium meliloti 1021]
 gi|307302719|ref|ZP_07582475.1| NAD+ synthetase [Sinorhizobium meliloti BL225C]
 gi|15074780|emb|CAC46425.1| Putative NH3-dependent NAD+ synthetase [Sinorhizobium meliloti
           1021]
 gi|306903083|gb|EFN33674.1| NAD+ synthetase [Sinorhizobium meliloti BL225C]
          Length = 560

 Score =  533 bits (1372), Expect = e-149,   Method: Composition-based stats.
 Identities = 311/557 (55%), Positives = 399/557 (71%), Gaps = 7/557 (1%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
             L+IA+AQLNP VGDIAGN+AKAR AR  A R+G DL+L TELFISGYPPEDLV K +F
Sbjct: 9   STLRIAVAQLNPTVGDIAGNVAKAREARTAAAREGADLLLLTELFISGYPPEDLVLKPAF 68

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           ++AC  A++ L ++T DGG G+V+GFPRQ      NSV +LD G +IA+RDK++LPNY E
Sbjct: 69  LKACEQAVEKLAAETADGGPGVVIGFPRQAAGLRHNSVAVLDGGRVIAIRDKVDLPNYGE 128

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F +G    P+ FR +R+GI +CEDIW +  +C+ L + GAE L S N SPYY  
Sbjct: 129 FDEKRVFDAGEMPGPVNFRGVRIGIPVCEDIWGDLGVCETLAESGAEILLSPNGSPYYRG 188

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K+  RH++V  Q+    LP+IY NQ+GGQDEL+FDGASF F+  + LAFQM  F E   +
Sbjct: 189 KVDVRHQVVLRQVIETGLPMIYANQLGGQDELVFDGASFAFNADKSLAFQMSQFEEAVAV 248

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
           +EW   +    W   +   +       + EEADY AC+L  RDYV KN F  V++GLSGG
Sbjct: 249 SEW--KRGAGGWISANGLKSRIP----EGEEADYRACMLGFRDYVNKNGFRNVVLGLSGG 302

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSA+C A+AVDALG+E V+T+MLPY+YTS +SL DA ACAKALGC+YD++ I + V  F
Sbjct: 303 IDSAICTALAVDALGEERVRTVMLPYRYTSRESLRDAEACAKALGCRYDIVAIEEPVEGF 362

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            S ++   +   +GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM
Sbjct: 363 LSALADTFEGTEAGITEENLQSRTRGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDM 422

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGFNP+KDLYK QV+ LA WRN       LGP  EVIP +I++K+PSAELRP QTDQ+S
Sbjct: 423 NGGFNPIKDLYKMQVYALARWRNGTVPPGALGPSGEVIPQNIIDKAPSAELRPDQTDQDS 482

Query: 483 LPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPYP+LDDI++ +VE E S      + + + TV  +EHLLY +EYKRRQ+  G KIT K
Sbjct: 483 LPPYPVLDDILECLVEKEMSTEEIVARGHEEATVHRIEHLLYIAEYKRRQSAPGVKITRK 542

Query: 542 SFGRDRLYPISNKFRDH 558
           +FGRDR YPI+N+FRD 
Sbjct: 543 NFGRDRRYPITNRFRDR 559


>gi|118588086|ref|ZP_01545496.1| NAD synthetase [Stappia aggregata IAM 12614]
 gi|118439708|gb|EAV46339.1| NAD synthetase [Stappia aggregata IAM 12614]
          Length = 555

 Score =  532 bits (1371), Expect = e-149,   Method: Composition-based stats.
 Identities = 277/559 (49%), Positives = 382/559 (68%), Gaps = 9/559 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
             + ++A+AQLNP VGD+AGN    R+AR +A  QG DL+L +EL ++GY PEDLV K +
Sbjct: 3   SDRFRLAVAQLNPTVGDVAGNADLVRKARLDAASQGADLVLTSELVLAGYLPEDLVLKPA 62

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQ-DQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           F++ C  A +TL  +T DGG G+++G P + ++  V N+ ++LD G I AVR K +LPNY
Sbjct: 63  FVRRCMEAAETLAGETADGGPGLILGSPWRSEEGKVYNAALLLDQGEIKAVRYKYDLPNY 122

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F EKR F +G    P+ FR +R+G+ ICEDIW +    + L++ GAE L   N SPY+
Sbjct: 123 SVFDEKRVFAAGPLPGPVDFRGVRIGLPICEDIWNDEVC-ECLEETGAELLLVPNGSPYW 181

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            ++ + R ++V  ++    LP++Y NQ+GGQDEL+FDG SF     + LAFQM  F    
Sbjct: 182 EHRAEHRLQVVVSRVVQTGLPLVYCNQLGGQDELVFDGGSFALHADRSLAFQMPQFETAL 241

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +++W  D      +    ++ S   +P   +EA++ ACV+ L DYV KN F  V++GLS
Sbjct: 242 GISDWKRD-----GDTWLCENGSVAKLP-DLDEANWRACVMGLGDYVTKNGFPGVVLGLS 295

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+CAA+AVDALG + V  IMLPY+YTS +S+ DAAACAKALG +YD +PI + V 
Sbjct: 296 GGIDSAICAAMAVDALGADKVHAIMLPYRYTSEESITDAAACAKALGIRYDTVPISEPVE 355

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F S +S            EN+QSR RG ILMA+SN    M++TT NKSE+SVGY TLYG
Sbjct: 356 GFRSALSNLFAGTKEDTTEENLQSRARGVILMAVSNKFGHMVMTTGNKSEMSVGYATLYG 415

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKTQV+ LA WRN++     LGP  EVIP +I+ K P+AELR +QTDQ
Sbjct: 416 DMNGGYNPIKDLYKTQVYHLAEWRNNNRPEGLLGPGREVIPSNIITKVPTAELRENQTDQ 475

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LDDI++ +VE+E S  + ++  ++   +  +EHLLY +EYKRRQAP G KIT
Sbjct: 476 DSLPPYDVLDDILECLVEDEMSVGDIEKRGHDRALIHRIEHLLYIAEYKRRQAPPGVKIT 535

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++FG+DR YPI+N+FRD 
Sbjct: 536 ERNFGKDRRYPITNRFRDR 554


>gi|307318567|ref|ZP_07598001.1| NAD+ synthetase [Sinorhizobium meliloti AK83]
 gi|306895907|gb|EFN26659.1| NAD+ synthetase [Sinorhizobium meliloti AK83]
          Length = 560

 Score =  531 bits (1369), Expect = e-149,   Method: Composition-based stats.
 Identities = 310/557 (55%), Positives = 399/557 (71%), Gaps = 7/557 (1%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
             L+IA+AQLNP VGDIAGN+AKAR AR  A R+G DL+L TELFISGYPPEDLV K +F
Sbjct: 9   STLRIAVAQLNPTVGDIAGNVAKAREARTAAAREGADLLLLTELFISGYPPEDLVLKPAF 68

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           ++AC  A++ L ++T DGG G+V+GFPRQ      NSV +LD G +IA+RDK++LPNY E
Sbjct: 69  LKACEQAVEKLAAETADGGPGVVIGFPRQAAGLRHNSVAVLDGGRVIAIRDKVDLPNYGE 128

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F +G    P+ FR +R+GI +CEDIW +  +C+ L + GAE L S N SPYY  
Sbjct: 129 FDEKRVFDAGEMPGPVNFRGVRIGIPVCEDIWGDLGVCETLAESGAEILLSPNGSPYYRG 188

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K+  RH++V  Q+    LP+IY NQ+GGQDEL+FDGASF F+  + LAFQM  F E   +
Sbjct: 189 KVDVRHQVVLRQVIETGLPMIYANQLGGQDELVFDGASFAFNADKSLAFQMSQFEEAVAV 248

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
           +EW   +    W   +   +       + EEADY AC+L  RDYV KN F  V++GLSGG
Sbjct: 249 SEW--KRGAGGWISANGLKSRIP----EGEEADYRACMLGFRDYVNKNGFRNVVLGLSGG 302

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSA+C A+AVDALG+E V+T+MLPY+YTS +SL DA ACAKALGC+Y+++ I + V  F
Sbjct: 303 IDSAICTALAVDALGEERVRTVMLPYRYTSRESLRDAEACAKALGCRYNIVAIEEPVEGF 362

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            S ++   +   +GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM
Sbjct: 363 LSALADTFEGTEAGITEENLQSRTRGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDM 422

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGFNP+KDLYK QV+ LA WRN       LGP  EVIP +I++K+PSAELRP QTDQ+S
Sbjct: 423 NGGFNPIKDLYKMQVYALARWRNGTVPPGALGPSGEVIPQNIIDKAPSAELRPDQTDQDS 482

Query: 483 LPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPYP+LDDI++ +VE E S      + + + TV  +EHLLY +EYKRRQ+  G KIT K
Sbjct: 483 LPPYPVLDDILECLVEKEMSTEEIVARGHEEATVHRIEHLLYIAEYKRRQSAPGVKITRK 542

Query: 542 SFGRDRLYPISNKFRDH 558
           +FGRDR YPI+N+FRD 
Sbjct: 543 NFGRDRRYPITNRFRDR 559


>gi|218675144|ref|ZP_03524813.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli
           GR56]
          Length = 559

 Score =  531 bits (1367), Expect = e-148,   Method: Composition-based stats.
 Identities = 317/558 (56%), Positives = 399/558 (71%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
               +IAI QLNP VGD+ GN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +
Sbjct: 8   SDIFRIAIGQLNPTVGDVTGNLAKAREARADAAREGAHLLVLTELFISGYPPEDLVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+AC  A+++L +DT DGG G+++GFPRQD+ G  NSV +LD G +IAVRDK++LPNY 
Sbjct: 68  FIRACWKAVESLAADTADGGPGVIIGFPRQDENGRYNSVAVLDGGKVIAVRDKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+ FR +RLGI ICEDIW +  +C+ L + GAE L S N SPYY 
Sbjct: 128 EFDEKRVFHQGAMPGPVNFRGVRLGIPICEDIWGDLGVCETLAESGAEILLSPNGSPYYR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+  RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     
Sbjct: 188 GKVDIRHQVVLKQVIETGLPLIYAAQLGGQDELVFDGASFAFNADRSLAFQMSEFETALA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +T W   +  S W+      A       + EEADY AC+L  RDYV KN F  V++GLSG
Sbjct: 248 VTTW--KRGESGWHCAEGPMARIP----EGEEADYRACLLGFRDYVNKNGFKTVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI   V  
Sbjct: 302 GIDSAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEQPVTG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F S +S   +   SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGD
Sbjct: 362 FSSALSDLFEGTESGITEENLQSRARGVILMAISNKFGAMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KDLYK QV+ LA WRN +   + LGP  EVIP +I++K+PSAELRP Q DQ+
Sbjct: 422 MNGGFNPIKDLYKMQVYALARWRNENVPPTALGPSGEVIPLNIIDKAPSAELRPDQKDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VE E +      + ++  TV  VEHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|227822241|ref|YP_002826212.1| NAD synthetase [Sinorhizobium fredii NGR234]
 gi|227341241|gb|ACP25459.1| glutamine-dependent NAD(+) synthetase [Sinorhizobium fredii NGR234]
          Length = 560

 Score =  531 bits (1367), Expect = e-148,   Method: Composition-based stats.
 Identities = 321/557 (57%), Positives = 405/557 (72%), Gaps = 7/557 (1%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
            KL+IA+AQLNP VGDIAGN+A+AR AR +A RQG DL+LFTELFISGYPPEDLV K +F
Sbjct: 9   SKLRIAVAQLNPTVGDIAGNMARAREARADAARQGADLVLFTELFISGYPPEDLVLKPAF 68

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           + AC  A++ L ++T DGG G+++GFPRQ      NSV +LDAG I+AVRDK++LPNY E
Sbjct: 69  LAACLRAVEKLAAETADGGPGVIIGFPRQASLQRHNSVAVLDAGKIVAVRDKVDLPNYGE 128

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F +G    P+ FR IR+GI ICEDIW    +C+ LK+ GAE L S N SPYY  
Sbjct: 129 FDEKRVFDAGEMPGPVNFRGIRIGIPICEDIWGELGVCETLKESGAEILLSPNGSPYYRG 188

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K+  RH+IV  Q+    LP+IY NQ+GGQDEL+FDGASF F+  + LAFQM  F E   +
Sbjct: 189 KVDVRHQIVLKQVIETGLPMIYANQLGGQDELVFDGASFGFNADKSLAFQMSQFEEALSI 248

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
           +EW         +     S     +P  + EADY AC+L LRDYV KN F  V++GLSGG
Sbjct: 249 SEW-----ARAEDGWVSTSGLQSRLPESD-EADYRACMLGLRDYVNKNGFKNVVLGLSGG 302

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSA+CAA+AVDALG+E V+TIMLPY+YTS +SL+DA ACAKALGC YDV+ I + V  F
Sbjct: 303 IDSAICAALAVDALGEERVRTIMLPYRYTSQESLKDAEACAKALGCYYDVVAIEEPVEGF 362

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            + ++   +   SGI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM
Sbjct: 363 LNALADTFEGTESGITEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDM 422

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGFNP+KDLYK QV+ L+ WRN       LGP  EVIP +I++K+PSAELRP+QTDQ+S
Sbjct: 423 NGGFNPIKDLYKMQVYGLSRWRNGAVPPGALGPSGEVIPQNIIDKAPSAELRPNQTDQDS 482

Query: 483 LPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPYP+LDDI++ +VE E S      + +++ TV  +EHLLY +EYKRRQ+  G KIT K
Sbjct: 483 LPPYPVLDDILECLVERELSTEEIVARGHDEATVHRIEHLLYIAEYKRRQSAPGVKITKK 542

Query: 542 SFGRDRLYPISNKFRDH 558
           +FGRDR YPI+N+FRD 
Sbjct: 543 NFGRDRRYPITNRFRDR 559


>gi|116252435|ref|YP_768273.1| NAD synthetase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257083|emb|CAK08177.1| putative glutamine-dependent nad(+) synthetase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 559

 Score =  531 bits (1367), Expect = e-148,   Method: Composition-based stats.
 Identities = 313/558 (56%), Positives = 398/558 (71%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
               +IAI QLNP VGD+AGN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +
Sbjct: 8   SDIFRIAIGQLNPTVGDVAGNLAKAREARADAAREGAHLLVLTELFISGYPPEDLVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+AC  A+++L ++T DGG G+++GFPRQD  G  NSV +LD G +IAVRDKI+LPNY 
Sbjct: 68  FIRACWKAVESLAAETADGGPGVIIGFPRQDDTGRYNSVAVLDGGKVIAVRDKIDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+ FR +R+GI ICEDIW +  +C+ L + GAE L S N SPYY 
Sbjct: 128 EFDEKRVFDQGAMPGPVNFRGVRIGIPICEDIWGDLGVCETLAESGAEILLSPNGSPYYR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+  RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     
Sbjct: 188 GKVDIRHQVVLRQVIETGLPLIYAAQLGGQDELVFDGASFAFNADKSLAFQMSQFETALA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +T W   +  S W+      A       + EEADY AC+L  RDYV KN F  V++GLSG
Sbjct: 248 VTTW--KRGDSGWHCAEGPMAHIP----ESEEADYRACLLGFRDYVNKNGFKTVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CA+ALGC+YD++PI   V  
Sbjct: 302 GIDSAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCARALGCRYDIVPIEQPVTG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F S ++   +   SGI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 362 FSSALASLFEGTDSGITEENLQSRARGVILMAISNKFGSMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KDLYK QV+ L+ WRN +     LGP  EVIP +I++K+PSAELRP Q DQ+
Sbjct: 422 MNGGFNPIKDLYKMQVYALSRWRNENVPPGALGPSGEVIPQNIIDKAPSAELRPDQKDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VE E +      + ++  TV  VEHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|304391830|ref|ZP_07373772.1| NAD(+) synthase (glutamine-hydrolyzing) [Ahrensia sp. R2A130]
 gi|303296059|gb|EFL90417.1| NAD(+) synthase (glutamine-hydrolyzing) [Ahrensia sp. R2A130]
          Length = 556

 Score =  530 bits (1366), Expect = e-148,   Method: Composition-based stats.
 Identities = 281/559 (50%), Positives = 379/559 (67%), Gaps = 9/559 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
              L+IAIAQ+NP VGD++GN    R AR +A RQG DL++FTELFISGY PEDLV K +
Sbjct: 5   TDTLRIAIAQMNPTVGDVSGNTDLVREARSDAARQGADLVVFTELFISGYSPEDLVLKPA 64

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+ C  A++ L  +T DGG  ++VG P Q + G+ NSV +LD G I  +R K++LPNY 
Sbjct: 65  FIKRCREAVEALAEETKDGGPAVLVGVPWQAETGLHNSVALLDGGAIK-LRHKVDLPNYG 123

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F EKR F  G    P+ FR +RLG+ ICEDIW + ++C+ L + G+E L   N SPYY 
Sbjct: 124 VFDEKRVFAQGPMPGPLNFRGVRLGVPICEDIWGDLDVCETLAESGSEILIVPNGSPYYR 183

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+  R+++V  Q+    LP+++ NQ+GGQDEL+FDG SF  +  + +  QM  F     
Sbjct: 184 QKVDVRYQVVMRQVIVTELPMLFANQLGGQDELVFDGGSFVMNADKSIPVQMNQFESSVA 243

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +T W         +  + D      +P   +E D+ ACVL LRDYV+KN F  V++GLSG
Sbjct: 244 LTTW-----RRGSDGWACDRGVQTRLP-DVQECDWRACVLGLRDYVEKNGFKNVVLGLSG 297

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+ AA++VDALG+E V+ +MLPY+YTS +SL+DA  CA ALG +Y+ +PI   V  
Sbjct: 298 GIDSAIVAAMSVDALGEERVRCVMLPYRYTSDESLKDAQDCANALGVRYETIPIEPPVQG 357

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F   +S   ++   G+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 358 FLDTLSDVFEDTAEGVTEENLQSRARGVILMAISNKFGSMVVTTGNKSEMSVGYATLYGD 417

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KDLYK QV+ L+ WRN H     LGP  EVIP +I++K+P+AELR +QTDQ+
Sbjct: 418 MNGGFNPIKDLYKMQVYGLSDWRNKHMPPDCLGPSGEVIPQNIIDKAPTAELRENQTDQD 477

Query: 482 SLPPYPILDDIIKRIVENEESFINNDQ--EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           SLP YP+LD I++ +VENE S  +  +   +   TV  +EHLLY +EYKRRQA  G KIT
Sbjct: 478 SLPEYPVLDAILESLVENEMSVDDIVEKFGFERATVERMEHLLYIAEYKRRQAAPGVKIT 537

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++FGR+R YPI+N+FRD 
Sbjct: 538 RRAFGRERRYPITNRFRDR 556


>gi|163793633|ref|ZP_02187608.1| Glutamine-dependent NAD(+) synthetase [alpha proteobacterium
           BAL199]
 gi|159181435|gb|EDP65950.1| Glutamine-dependent NAD(+) synthetase [alpha proteobacterium
           BAL199]
          Length = 562

 Score =  529 bits (1363), Expect = e-148,   Method: Composition-based stats.
 Identities = 254/557 (45%), Positives = 350/557 (62%), Gaps = 8/557 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L I +AQLNP VGDIAGN+ K RR R +A  +G D++L  EL++ GYPPEDLV K 
Sbjct: 1   MTDTLTITLAQLNPRVGDIAGNLDKLRRVRAQAAAEGADVVLTPELYLCGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F+     A++ L  +T DGG  ++VG P  D   + N++V+LDAG ++  R K++LPNY
Sbjct: 61  MFVAEIRDAVEALARETGDGGPAVLVGAPWLDDGKLYNAMVLLDAGEVVTARYKVDLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F++G    PI  R +R+G+ ICEDIW      + + + G E L   N SP+ 
Sbjct: 121 GVFDEKRVFVAGPPPGPIDVRGVRIGVPICEDIWTPDI-VECVAETGGEILLIPNGSPFE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R ++   ++    LP++Y+NQ+GGQDEL+FDGASF  +  + LA QM  ++E  
Sbjct: 180 LGKSDVRVQLAVARVVESGLPLVYLNQIGGQDELVFDGASFVLNPDRSLALQMPAWTEAV 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
             T W   +    W   +           +  E+ Y A +  LRDYV KN F  VI+G+S
Sbjct: 240 VTTHW--KRTPDGWTCDTGVRTKQP----EGLESLYCALMTGLRDYVTKNGFPGVILGMS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ AAIAVDALG + V+ +M+P  YTS  SLEDAAA A+ +G +Y  + I   + 
Sbjct: 294 GGIDSAISAAIAVDALGPDKVRCVMMPSPYTSDHSLEDAAAAAEMMGVQYSSINIGPAMQ 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F  ++S+        I  EN+Q+R RG  LMALSN    M+L+T NKSE+SVGY TLYG
Sbjct: 354 AFDGMLSEAFAGTKPDITEENLQARSRGITLMALSNKFGHMVLSTGNKSEMSVGYATLYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GG++ LKD+YK  VF L+SWRNS+    GLGP   ++P  I+ K PSAELRP Q D+
Sbjct: 414 DMCGGYSVLKDVYKMTVFALSSWRNSNKPAGGLGPDGPIMPERIITKPPSAELRPDQKDE 473

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPYP+LD I+  ++ENE       ++ ++ +TV  +  +L  +EYKRRQAP G K+T
Sbjct: 474 DSLPPYPVLDAILMELIENESPIATIVEKGFDSDTVLRIWRMLDRAEYKRRQAPPGVKVT 533

Query: 540 AKSFGRDRLYPISNKFR 556
           A+SFGRDR YP++N F+
Sbjct: 534 ARSFGRDRRYPLTNAFQ 550


>gi|327190628|gb|EGE57716.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli
           CNPAF512]
          Length = 559

 Score =  528 bits (1360), Expect = e-147,   Method: Composition-based stats.
 Identities = 319/558 (57%), Positives = 398/558 (71%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
               +IAI QLNP VGD+ GN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +
Sbjct: 8   SDIFRIAIGQLNPTVGDVTGNLAKAREARADAAREGAHLLVLTELFISGYPPEDLVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+AC  A+++L +DT DGG G+++GFPRQD+ G  NSV +LD G +IAVRDK++LPNY 
Sbjct: 68  FIRACWKAVESLAADTVDGGPGVIIGFPRQDENGRYNSVAVLDGGKVIAVRDKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    PI FR IRLGI ICEDIW    +C+ L + GAE L S N SPYY 
Sbjct: 128 EFDEKRVFHQGAMPGPINFRGIRLGIPICEDIWGELGVCETLAESGAEILLSPNGSPYYR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+  RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     
Sbjct: 188 GKVDIRHQVVLKQVIETGLPLIYAAQLGGQDELVFDGASFAFNADKSLAFQMSEFETALA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +T W   +  S W+      A       + EEADY AC+L  RDYV KN F  V++GLSG
Sbjct: 248 VTTW--KRGESGWHCAEGPMARIP----EGEEADYRACLLGFRDYVNKNGFKTVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI   V  
Sbjct: 302 GIDSAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEQPVTG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F S +S   +   SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGD
Sbjct: 362 FSSALSDLFEGTDSGITEENLQSRARGVILMAISNKFGAMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KDLYK QV+ L+ WRN +   S LGP  EVIP +I++K+PSAELRP Q DQ+
Sbjct: 422 MNGGFNPIKDLYKMQVYALSRWRNENVPPSALGPSGEVIPQNIIDKAPSAELRPDQKDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VE E +      + ++  TV  VEHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|190892049|ref|YP_001978591.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli
           CIAT 652]
 gi|190697328|gb|ACE91413.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli
           CIAT 652]
          Length = 559

 Score =  528 bits (1359), Expect = e-147,   Method: Composition-based stats.
 Identities = 317/558 (56%), Positives = 397/558 (71%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
               +IAI QLNP VGD+AGN+ KAR AR +A R+G  L++ TELFISGYPPEDLV K +
Sbjct: 8   SDIFRIAIGQLNPTVGDVAGNLTKAREARADAAREGAHLLVLTELFISGYPPEDLVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+AC  A+++L +DT DGG G+++GFPRQD+ G  NSV +LD G +IAVRDK++LPNY 
Sbjct: 68  FIRACWKAVESLAADTVDGGPGVIIGFPRQDENGRYNSVAVLDGGKVIAVRDKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+ FR IRLGI ICEDIW    +C+ L + GAE L S N SPYY 
Sbjct: 128 EFDEKRVFHQGAMPGPVNFRGIRLGIPICEDIWGELGVCETLAESGAEILLSPNGSPYYR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+  RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     
Sbjct: 188 GKVDIRHQVVLKQVIETGLPLIYAAQLGGQDELVFDGASFAFNADKSLAFQMSEFETALA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +T W   +  S W+      A       + EEADY AC+L  RDYV KN F  V++GLSG
Sbjct: 248 VTTW--KRGESGWHCAEGPMARIP----EGEEADYRACLLGFRDYVNKNGFKTVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI   V  
Sbjct: 302 GIDSAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEQPVTG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F S +S   +   SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGD
Sbjct: 362 FSSALSDLFEGTESGITEENLQSRARGVILMAISNKFGAMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KDLYK QV+ L+ WRN +   S LGP  EVIP +I++K+PSAELRP Q DQ+
Sbjct: 422 MNGGFNPIKDLYKMQVYALSRWRNENVPPSALGPSGEVIPQNIIDKAPSAELRPDQKDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLP YP+LDDI++ +VE E +      + ++  TV  VEHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPAYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|150396775|ref|YP_001327242.1| NAD synthetase [Sinorhizobium medicae WSM419]
 gi|150028290|gb|ABR60407.1| NAD+ synthetase [Sinorhizobium medicae WSM419]
          Length = 560

 Score =  527 bits (1357), Expect = e-147,   Method: Composition-based stats.
 Identities = 314/557 (56%), Positives = 400/557 (71%), Gaps = 7/557 (1%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
             L+IA+AQLNP VGDIAGN+ KAR AR  A R+G DL+LFTELF+SGYPPEDLV K +F
Sbjct: 9   STLRIAVAQLNPTVGDIAGNMTKAREARAAAAREGADLLLFTELFLSGYPPEDLVLKPAF 68

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           + AC  A++ L ++T DGG GIV+GFPRQ      NSV +LD G IIAVRDK++LPNY E
Sbjct: 69  LSACEQAVEKLAAETADGGPGIVIGFPRQAAALRHNSVAVLDGGKIIAVRDKVDLPNYGE 128

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F +G    P+ FR +R+GI +CEDIW +  +C+ L + GAE L S N SPYY  
Sbjct: 129 FDEKRVFDAGEMPGPVNFRGVRIGIPVCEDIWGDLGVCETLAESGAEILLSPNGSPYYRG 188

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           KL  RH++V  Q+    LP+IY NQ+GGQDEL+FDGASF F+  + LAFQM  F E   +
Sbjct: 189 KLDVRHQVVLRQVIETGLPMIYANQLGGQDELVFDGASFAFNADKSLAFQMSQFEEAVAV 248

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
           +EW         +     +     +P + EEADY AC+L  RDYV KN F  V++GLSGG
Sbjct: 249 SEW-----RRGADGWVSGNGLKSRVP-EGEEADYRACMLGFRDYVNKNGFRNVVLGLSGG 302

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSA+C A+AVDALG+E V+T+MLPY+YTS +SL+DA ACA+ALGC+YD++ I + V  F
Sbjct: 303 IDSAICTALAVDALGEERVRTVMLPYRYTSRESLQDAEACARALGCRYDIVAIEEPVEGF 362

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            S +S   +   +GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM
Sbjct: 363 LSALSDMFEGTEAGITEENLQSRTRGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDM 422

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGFNP+KDLYK QV+ LA WRN       LGP  EVIP +I++K+PSAELRP QTDQ+S
Sbjct: 423 NGGFNPIKDLYKMQVYALARWRNGTVPPGALGPSGEVIPQNIIDKAPSAELRPDQTDQDS 482

Query: 483 LPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPYP+LDDI++ +VE E S  +   + + + TV  +EHLLY +EYKRRQ+  G KIT K
Sbjct: 483 LPPYPVLDDILECLVEKEMSTEDVVARGHEEATVHRIEHLLYIAEYKRRQSAPGVKITRK 542

Query: 542 SFGRDRLYPISNKFRDH 558
           +FGRDR YPI+N+FRD 
Sbjct: 543 NFGRDRRYPITNRFRDR 559


>gi|217976322|ref|YP_002360469.1| NAD synthetase [Methylocella silvestris BL2]
 gi|217501698|gb|ACK49107.1| NAD+ synthetase [Methylocella silvestris BL2]
          Length = 576

 Score =  526 bits (1356), Expect = e-147,   Method: Composition-based stats.
 Identities = 285/558 (51%), Positives = 365/558 (65%), Gaps = 8/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L I +AQ++  VGDIAGN+A+ R AR EA   G D+++F+ELFI+GYPPEDLV K 
Sbjct: 1   MTDTLVIGLAQIDSTVGDIAGNVARVRAARTEAAGFGADVVMFSELFIAGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++AC +A+D L  DT DGG  I+VG P  +     N+  +LD G + AVR K++LPNY
Sbjct: 61  AFLEACRAALDDLARDTADGGPAILVGVPLVENGLAYNAYALLDGGRVEAVRYKVDLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G    P+  R +R+G+ ICEDIW   +  + + + G E L   N SPY+
Sbjct: 121 GVFDEKRVFAPGPMPGPLTLRGVRIGVPICEDIW-GPDPVECIAETGGEILLVPNGSPYW 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R  IV  ++    LP+IY+NQVGGQDEL+FDGASF  +  + LAFQ+  F+   
Sbjct: 180 RGKADERLAIVAARVVESGLPLIYLNQVGGQDELVFDGASFGLNADRTLAFQLPAFTSVV 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
             T W       + +              Q EEADY+ACV+ LRDYV+KN F  V++GLS
Sbjct: 240 ARTVW------RRGDNGFVCVEGPKAAIEQGEEADYSACVVGLRDYVEKNGFPGVVLGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSALCAA+AVDALG   V  +MLPY+YTS +SL DA  CAKALG +YD+LPI  +V+
Sbjct: 294 GGIDSALCAAMAVDALGAARVHCVMLPYRYTSNESLFDAEGCAKALGVRYDILPIEPIVS 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + +       P G+  ENIQSR+RG  LMA+SN   AML+TT NKSE+SVGY T+YG
Sbjct: 354 GFETTLRPLFAGTPPGLTEENIQSRVRGATLMAISNKFGAMLVTTGNKSELSVGYATIYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNPLKDLYK +VF+L   RN       LGP   VIP +IL K PSAELR +Q DQ
Sbjct: 414 DMNGGFNPLKDLYKMEVFRLCRLRNRWKPKGALGPDGVVIPENILVKPPSAELRENQKDQ 473

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY  LD I++ +VE E    +     +  ETV+ VE LLY +EYKRRQ+  G K+T
Sbjct: 474 DSLPPYEELDAILEGLVEKEMRVSDLIAAGFTAETVKKVERLLYLAEYKRRQSAPGVKVT 533

Query: 540 AKSFGRDRLYPISNKFRD 557
            K+FGRDR YPI NKFRD
Sbjct: 534 KKNFGRDRRYPILNKFRD 551


>gi|158422537|ref|YP_001523829.1| NAD synthetase [Azorhizobium caulinodans ORS 571]
 gi|158329426|dbj|BAF86911.1| NAD+ synthase [Azorhizobium caulinodans ORS 571]
          Length = 566

 Score =  526 bits (1355), Expect = e-147,   Method: Composition-based stats.
 Identities = 269/556 (48%), Positives = 365/556 (65%), Gaps = 9/556 (1%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           + L+IA+AQLNPVVGD+AGN  K R AR+EA  QG DL++F+ELF++GYPPEDLV K +F
Sbjct: 17  ETLRIAVAQLNPVVGDVAGNAEKVRMARDEAALQGADLVVFSELFLAGYPPEDLVLKPAF 76

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
            QAC +A+D L ++T  GG  ++VG P  +   + N V +L+ G I A R K++LPNY  
Sbjct: 77  QQACRAALDELAAETV-GGPALLVGAPWVEDGHLHNGVFLLEGGRIAAKRFKVDLPNYGV 135

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F+ G    PI F+ +RLG+ +CEDIW   ++ + L + GAE L   N SPY  +
Sbjct: 136 FDEKRVFVPGPLPGPIPFKGVRLGVPVCEDIW-GPDVVECLSETGAEILIVPNGSPYRRS 194

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
              +R  I   ++    LP++YVNQVGGQDEL+FDGASF  +  +    Q   F+E+   
Sbjct: 195 VYDERANIAVARVVESGLPLLYVNQVGGQDELVFDGASFALNADRTQVMQFPGFAERVRT 254

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
           T+W       ++        +     L+ + ADY ACVL L+DYV KN F  V++GLSGG
Sbjct: 255 TQW------RRYENGWKCEEAPFADRLEGDRADYAACVLGLKDYVNKNRFPGVVLGLSGG 308

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSA+CAA+AVDALG E V  IMLPY++TS  SL DAA  A+ LG +YD LPI   V   
Sbjct: 309 IDSAICAAMAVDALGPERVHCIMLPYRFTSQDSLSDAADVARRLGVRYDTLPIAPAVEAL 368

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
             +++         +  EN+QSR+RG +LM++SN   AM++TT NKSE+S GY TLYGDM
Sbjct: 369 EGVLAPLFAGRERDVTEENLQSRVRGTLLMSVSNKFGAMVVTTGNKSEMSTGYATLYGDM 428

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GG+NP+KDLYKT+VF+L+  RN+   T  LGP   VIP ++++K P+AELR +Q DQ+S
Sbjct: 429 NGGYNPIKDLYKTEVFRLSRLRNTWKPTGALGPDGIVIPDALIDKPPTAELRENQKDQDS 488

Query: 483 LPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY +LD I+ R+VE E          ++   V+ VE +L  +EYKRRQA  G K+T +
Sbjct: 489 LPPYEVLDAILARLVEAETPVAQLIADGFDPAVVKRVERMLNIAEYKRRQAAPGVKVTTR 548

Query: 542 SFGRDRLYPISNKFRD 557
           +FGRDR YPI+N FRD
Sbjct: 549 NFGRDRRYPITNGFRD 564


>gi|92117038|ref|YP_576767.1| NAD synthetase [Nitrobacter hamburgensis X14]
 gi|91799932|gb|ABE62307.1| NH(3)-dependent NAD(+) synthetase [Nitrobacter hamburgensis X14]
          Length = 583

 Score =  525 bits (1353), Expect = e-147,   Method: Composition-based stats.
 Identities = 274/564 (48%), Positives = 367/564 (65%), Gaps = 14/564 (2%)

Query: 1   ML-KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFK 59
           M     KI + QLNP VGDIAGN AKAR AR +A   G  L+   ELFI+GYPPEDLV K
Sbjct: 1   MTETTFKITLGQLNPTVGDIAGNAAKARVARAQAKADGAALVALPELFIAGYPPEDLVLK 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
            +F  AC  A++TL  +T DGG  +++G P  D   + N+  +LD G + A+R K+NLPN
Sbjct: 61  PAFQAACREAVETLARETSDGGPAVLIGTPWVDDGKLYNAYALLDGGRVAAIRFKVNLPN 120

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWK-----NSNICKHLKKQGAEFLFSL 174
           Y  F EKR F  G    P+  R +R+G+ ICED W        N+ + L + GAE L   
Sbjct: 121 YGVFDEKRVFARGPVGGPLKIRGVRIGVPICEDTWVEESAEYENVVECLAETGAEILLVP 180

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           N SPY   K   R  I   +++   LP++Y+NQVGGQDEL+FDGASF  +  + LA Q+ 
Sbjct: 181 NGSPYAKGKSDIRLSISVARVTESDLPLVYLNQVGGQDELVFDGASFVLNADRSLAAQLP 240

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHK 294
            F E     +W   +  + W          +   +  ++ADY ACVL LRDYV KN F  
Sbjct: 241 AFRESLVTLQWT--KSAAGWRCAG-----PVAPQIDGDKADYAACVLGLRDYVHKNGFPG 293

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
           V++G+SGGIDSALCAAIAVDALG E V+ +MLP+++T+  SL+DAA  AKALG +Y+VLP
Sbjct: 294 VLLGVSGGIDSALCAAIAVDALGAERVRGVMLPFRFTAQVSLDDAATLAKALGIRYEVLP 353

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I   VN F  ++S      P  I  EN+Q+R RG +LMA+SN   AM++TT NKSE+SVG
Sbjct: 354 IAPAVNGFEEVLSGTFAGLPRDITEENLQARARGTLLMAISNKLGAMVVTTGNKSEMSVG 413

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
           Y TLYGDM+GGFNP+KD+YKT+VF+L++ RN+      LGP  EVIP +I+ + P+AELR
Sbjct: 414 YATLYGDMNGGFNPIKDIYKTEVFRLSNLRNAWKPDGALGPSGEVIPVNIITRPPTAELR 473

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAP 533
            +QTDQ+SLPPY +LD I++R++E EE   +     ++ + V  ++ LL  +EYKRRQA 
Sbjct: 474 ENQTDQDSLPPYDVLDAILERLIEREEPLASIVAEGFDRDMVARIDRLLNVAEYKRRQAA 533

Query: 534 VGTKITAKSFGRDRLYPISNKFRD 557
            G K+T ++FGRDR YPI+N+FRD
Sbjct: 534 PGVKVTRRNFGRDRRYPITNRFRD 557


>gi|13470971|ref|NP_102540.1| NAD synthetase [Mesorhizobium loti MAFF303099]
 gi|14021714|dbj|BAB48326.1| NH3-dependent NAD synthetase [Mesorhizobium loti MAFF303099]
          Length = 558

 Score =  525 bits (1353), Expect = e-147,   Method: Composition-based stats.
 Identities = 307/563 (54%), Positives = 395/563 (70%), Gaps = 11/563 (1%)

Query: 1   MLKK---LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           M KK   L+IAIAQLNP VGD+AGN+AKAR AR +A RQG DL+L+TELF++GYPPEDLV
Sbjct: 1   MTKKPDILRIAIAQLNPTVGDVAGNLAKAREARADAARQGADLVLYTELFLAGYPPEDLV 60

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
            K +F++AC  A     +DT DGG G+++G P + + G  NS+++ D G IIA R K++L
Sbjct: 61  LKPAFLKACEKAAQEFAADTSDGGPGVIIGTPLKRKSGTHNSIIVADGGKIIAERYKLDL 120

Query: 118 PNYSEFHEKRTFISGYSND-PIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           PNY EF EKR F +G     P+ FR +R+GI ICEDIW +  IC+ L + GAE L   N 
Sbjct: 121 PNYGEFDEKRVFQAGPEIQGPVNFRGVRIGIPICEDIWGDVGICESLAESGAEILLVPNG 180

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPYY  K+  R+++V  QI    LPI Y NQ+GGQDELIFDGASF     + LAFQM  F
Sbjct: 181 SPYYRAKIDVRYQVVIRQIIECGLPITYANQLGGQDELIFDGASFAIGADKTLAFQMSQF 240

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E   +  W   +    W       +       + EEADY AC+L LRDYV KN F  V+
Sbjct: 241 EEAVDVVTW--KRGEDGWVCSEGPMSKIP----EREEADYRACMLGLRDYVNKNGFKNVV 294

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSA+CAA+AVDALG+E ++ +M+PY+YTS  SL+DA  CA+ALGC+YD++PI 
Sbjct: 295 LGLSGGIDSAICAALAVDALGEERLRAVMMPYRYTSKDSLKDAEDCARALGCRYDIVPIF 354

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
           + V  F   ++Q  +    GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY 
Sbjct: 355 EPVEGFLHALTQLFEGTKEGITEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYA 414

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGFNP+KDLYK QV+ L+ WRNSH     LGP  EVIP +I++K+PSAELR +
Sbjct: 415 TLYGDMNGGFNPIKDLYKMQVYALSRWRNSHVPPGALGPSGEVIPKNIIDKAPSAELREN 474

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           QTDQ+SLPPYP+LDDI++ +VENE    +   + ++  TV  +EHLLY +EYKRRQA  G
Sbjct: 475 QTDQDSLPPYPVLDDILECLVENEMGVDDIVARGHDRATVTRIEHLLYIAEYKRRQAAPG 534

Query: 536 TKITAKSFGRDRLYPISNKFRDH 558
            KIT K+FGRDR YPI+N+FRD 
Sbjct: 535 VKITRKNFGRDRRYPITNRFRDR 557


>gi|163868125|ref|YP_001609329.1| NAD synthetase [Bartonella tribocorum CIP 105476]
 gi|161017776|emb|CAK01334.1| NH3-dependent NAD synthetase [Bartonella tribocorum CIP 105476]
          Length = 553

 Score =  525 bits (1352), Expect = e-147,   Method: Composition-based stats.
 Identities = 293/559 (52%), Positives = 386/559 (69%), Gaps = 8/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    ++A+AQLNP+VGDI GN + A  A ++A  +G DL+LFTELFIS YPPEDLV K 
Sbjct: 1   MKNNFRVAVAQLNPIVGDIGGNFSLAVMAHQKAKEEGADLVLFTELFISAYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F +AC  +++ L   T  GG GI++G P +    + N +++LD G +I    K +LPNY
Sbjct: 61  AFTKACEESVEKLAKITV-GGPGIIIGLPLRRNGNIYNGLMLLDEGRVITESLKFDLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           +EF EKR F  G   +PI +  I+LGI+ICEDIW +S++C  L  +GAE +  LN SPYY
Sbjct: 120 AEFDEKRLFSPGPRPEPIDYHGIKLGIVICEDIWNDSSLCAELCNKGAEMILVLNGSPYY 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK  KR E+V        +PIIY NQVGGQDEL+FDG SF  +GQ ++ FQMKHF    
Sbjct: 180 RNKTLKRIEVVRAHALQFGVPIIYANQVGGQDELVFDGGSFALNGQGKMVFQMKHFESHI 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            ++ W   ++ + W+Y+S  + +     L +  ADY ACVL L+DYV KN F  VI+GLS
Sbjct: 240 SVSHW--QRKTTGWHYVSGPNENL----LTDLAADYQACVLGLKDYVNKNGFKDVILGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSALCAA+AVDALG E V+TIM+PY YTS +SL+DA  CA  LGC+Y+++PI   V 
Sbjct: 294 GGIDSALCAAMAVDALGAERVRTIMMPYHYTSQESLKDAKECADLLGCRYEIIPIAQPVE 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + M+       S +  EN+QSRIRG +LMALSN   +M++TT NKSE++VGY TLYG
Sbjct: 354 AFLNTMAPVFLGLSSDVTEENLQSRIRGTLLMALSNKFGSMVVTTGNKSEMAVGYATLYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNPLKD+YK QV+ LA WRN + +    GP   VIP +I++K+PSAELR +Q D+
Sbjct: 414 DMNGGFNPLKDIYKMQVYALADWRNKNYLHHLKGPEGIVIPSNIIKKAPSAELRENQKDE 473

Query: 481 ESLPPYPILDDIIKRIVENEESFINND-QEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPYPILDDI++ +VEN+ S  +   + Y  ETV  +EHLLY +EYKRRQ+  G KI+
Sbjct: 474 DSLPPYPILDDILQSLVENDMSIGDIVQRGYLRETVEKIEHLLYAAEYKRRQSAPGVKIS 533

Query: 540 AKSFGRDRLYPISNKFRDH 558
            K+FGRDR YPI N FRD 
Sbjct: 534 YKNFGRDRRYPIVNHFRDK 552


>gi|222086207|ref|YP_002544739.1| NAD(+) synthase (glutamine-hydrolysing) protein [Agrobacterium
           radiobacter K84]
 gi|221723655|gb|ACM26811.1| NAD(+) synthase (glutamine-hydrolysing) protein [Agrobacterium
           radiobacter K84]
          Length = 559

 Score =  525 bits (1352), Expect = e-147,   Method: Composition-based stats.
 Identities = 307/558 (55%), Positives = 400/558 (71%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
            + ++IA+AQLNP VGD++GN+ KAR AR EA R+G  L+LFTELFISGYPPEDLV K +
Sbjct: 8   TQTIRIAVAQLNPTVGDVSGNLVKAREARAEAAREGAQLVLFTELFISGYPPEDLVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+AC  A+++L +DT DGG G+++GFPRQD+ G  NSV ++D G +I +RDK++LPNY 
Sbjct: 68  FIRACWKAVESLAADTADGGPGVIIGFPRQDETGRYNSVAVIDGGKVIFIRDKVDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+ FR +R+GI ICE+IW +  IC+ L + GAE L   N SPYY 
Sbjct: 128 EFDEKRVFDEGTIAGPVNFRGVRIGIPICEEIWNDLGICETLAESGAEILLVPNGSPYYR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+  R+++V  Q+    LP+++  QVGGQDE +FDGASF F+  + LAFQM  F     
Sbjct: 188 GKVDVRYQVVLRQVIESGLPLVFAAQVGGQDEYVFDGASFAFNADKSLAFQMSQFETALA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +T W   +    W+      A       + EEADY AC+L  RDYV KN F  V++GLSG
Sbjct: 248 VTTW--KKNGDGWHCSEGPMAHIP----EGEEADYRACLLGFRDYVNKNGFKSVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI + V  
Sbjct: 302 GIDSAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEEPVTG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F S ++   +   SGI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 362 FTSALADLFEGTESGITEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KDLYK QV+ L+ WRN H     LGP  EVIP +I++K+PSAELRP+QTDQ+
Sbjct: 422 MNGGFNPIKDLYKMQVYALSRWRNLHVPPGALGPSGEVIPYNIIDKAPSAELRPNQTDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP LDDI++ +VE E +      + ++  TV  +EHLLY +EYKRRQ+  G +IT 
Sbjct: 482 SLPPYPALDDILECLVEKEMAVDEIVARGHDVATVHRIEHLLYLAEYKRRQSAPGVRITT 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|328544366|ref|YP_004304475.1| NAD synthase family [polymorphum gilvum SL003B-26A1]
 gi|326414108|gb|ADZ71171.1| NAD synthase family [Polymorphum gilvum SL003B-26A1]
          Length = 562

 Score =  525 bits (1351), Expect = e-146,   Method: Composition-based stats.
 Identities = 278/558 (49%), Positives = 375/558 (67%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
             + ++A+AQLNPVVGD+AGN    R+AR  A  +G  L+L +EL ++GYPPEDLV K +
Sbjct: 10  TDRFRLAVAQLNPVVGDVAGNAELVRQARARAAAEGAHLVLCSELVLAGYPPEDLVLKPA 69

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++AC +A + L  +T DGG  ++VG P  D   + N+V++LDAG I AVR K++LPNY 
Sbjct: 70  FLRACRAAAEDLARETADGGPALIVGTPWIDDGKLHNAVLLLDAGRIQAVRYKVDLPNYG 129

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F EKR F  G    P+ FR +RLG+ ICED W +    + L + GAE L   N SPY+ 
Sbjct: 130 VFDEKRVFAPGPMPGPVDFRGVRLGLPICEDAWTDEVC-ECLAETGAEILLVPNGSPYWA 188

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
           NK ++R +++  ++    LP++Y NQ+GGQDEL+FDG SF     ++LAFQM  F     
Sbjct: 189 NKAEERLQVMVARVVESGLPLVYCNQLGGQDELVFDGGSFALQADRRLAFQMPQFRTDLA 248

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +T+W  D    +W       A    I    +EA++ ACV+ LRDYV K+ F  VI+GLSG
Sbjct: 249 VTDWQRDAD-GKWVCAGGPLARLPEI----DEANWLACVVGLRDYVDKSRFPGVILGLSG 303

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+AVDALG E V  +M+PY+YTS  S+ DA ACA+ L  +YD +PI   V  
Sbjct: 304 GIDSAVCAAMAVDALGPERVHGVMMPYRYTSRASIVDAEACARKLAIRYDTVPIEIPVAG 363

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F  ++       P+    EN+QSR RG +LMA+SN    M++TT NKSE+SVGY TLYGD
Sbjct: 364 FTEVLGPLFHGRPADTTEENLQSRSRGVVLMAISNKFGYMVVTTGNKSEMSVGYATLYGD 423

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GG+NP+KDLYKTQV+QLA+WRN++     LGP  EVIP +I+ K PSAELR +QTDQ+
Sbjct: 424 MNGGYNPVKDLYKTQVYQLAAWRNANRPEGVLGPAGEVIPHNIIAKVPSAELRENQTDQD 483

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLP Y +LDDI+  +VENE +      + ++  T+  VE+LLY +EYKRRQAP G KIT 
Sbjct: 484 SLPSYDVLDDILACLVENEMAVSEIEARGHDRATIHRVENLLYVAEYKRRQAPPGVKITR 543

Query: 541 KSFGRDRLYPISNKFRDH 558
           ++FGRDR YPI+N+FRD 
Sbjct: 544 RNFGRDRRYPITNRFRDR 561


>gi|254473458|ref|ZP_05086855.1| glutamine-dependent NAD(+) synthetase [Pseudovibrio sp. JE062]
 gi|211957574|gb|EEA92777.1| glutamine-dependent NAD(+) synthetase [Pseudovibrio sp. JE062]
          Length = 555

 Score =  524 bits (1350), Expect = e-146,   Method: Composition-based stats.
 Identities = 283/558 (50%), Positives = 378/558 (67%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
             + ++A+ Q NP VGDI+GN  K R  R+ A  QG DL+L++ELF++GYP EDLV K S
Sbjct: 3   KDQFRLAVVQANPCVGDISGNAEKVRHHRKLAAEQGADLVLYSELFLAGYPLEDLVRKPS 62

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC   ++ L  +T DGG G++VG P  + E + N+V +LD G +  +R K++LPNY 
Sbjct: 63  FVAACKRELEALAKETADGGPGLLVGLPWAEGEKLYNAVALLDNGKVEGLRFKVDLPNYG 122

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F EKR F +G +  PI FR +RLG+ ICED W +    + L++ GAE L   NASPY  
Sbjct: 123 VFDEKRVFDAGPNPGPISFRGVRLGVPICEDTWTDEVC-ECLEETGAEILVVPNASPYNR 181

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K ++R +++  ++    LP +Y NQVGGQDEL+FDGASF  +  + LA Q+  F+E+  
Sbjct: 182 EKTEERMQLMISRVVETGLPFVYCNQVGGQDELVFDGASFALNHDRSLAMQLGQFTEETG 241

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
              +  D           + A  + +P   +EAD+ ACVL L+DYV KN F  V++GLSG
Sbjct: 242 YLNFKKDAD----ENWLIEPARVVPMP-DTQEADWLACVLGLKDYVNKNGFPGVVLGLSG 296

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+AVDALG E V  IMLPY+YTS +S++DA ACA ALG KYD +PI + V  
Sbjct: 297 GIDSAICAAMAVDALGAERVHCIMLPYRYTSEESIKDAKACADALGVKYDTIPIAEPVEG 356

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F   +S       SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGD
Sbjct: 357 FQKTLSGVFAGTESGITEENLQSRSRGVILMAVSNKFGAMVVTTGNKSEMSVGYATLYGD 416

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KDLYKT+V++L+ WRN H     +GP  EVIP +I+ K+P+AELR +QTDQ+
Sbjct: 417 MNGGFNPIKDLYKTEVYRLSDWRNKHHPAGVMGPAGEVIPNNIIVKAPTAELRENQTDQD 476

Query: 482 SLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLP Y +LDDI+  +VE E S    ++  ++ ET+  VEHLLY +EYKRRQA  G KIT 
Sbjct: 477 SLPEYDVLDDILHCLVEQELSLDEIEKRGHSVETIHRVEHLLYIAEYKRRQAAPGVKITL 536

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 537 KNFGRDRRYPITNRFRDR 554


>gi|319783805|ref|YP_004143281.1| NAD+ synthetase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169693|gb|ADV13231.1| NAD+ synthetase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 558

 Score =  524 bits (1350), Expect = e-146,   Method: Composition-based stats.
 Identities = 308/563 (54%), Positives = 397/563 (70%), Gaps = 11/563 (1%)

Query: 1   MLKKL---KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           M KKL   +IA+AQLNP VGDI+GN+AKAR AR +A RQG DL+L+TELF++GYPPEDLV
Sbjct: 1   MTKKLDILRIAVAQLNPTVGDISGNLAKAREARADAARQGADLVLYTELFLAGYPPEDLV 60

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
            K +F++AC  A     +DT DGG G+++G P + + G  NS++  D G IIA R K++L
Sbjct: 61  LKPAFLKACEKAAQDFAADTADGGPGVIIGTPLKRKSGTHNSIIFADGGKIIAERYKLDL 120

Query: 118 PNYSEFHEKRTFISGYSND-PIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           PNY EF EKR F +G     P+ FR +R+GI ICEDIW + +IC+ L + GAE L   N 
Sbjct: 121 PNYGEFDEKRVFQAGPEIQGPVNFRGVRIGIPICEDIWGDVDICETLAESGAEILLVPNG 180

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPYY  K+  RH++V  Q+    LP+IY NQ+GGQDELIFDGASF     + LAFQM  F
Sbjct: 181 SPYYRAKIDVRHQVVIRQVIECGLPMIYANQLGGQDELIFDGASFAIGADKTLAFQMSQF 240

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E   +T W   +Q   W       +         EEADY AC+L LRDYV KN F  V+
Sbjct: 241 EEAVDVTTW--KRQGDHWVCSEGPMSKIP----DREEADYRACMLGLRDYVNKNGFKNVV 294

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSA+CAA+AVDALG+E ++ +M+PY+YTS  SL+DA  CA+ALGC+YD++PI 
Sbjct: 295 LGLSGGIDSAICAALAVDALGEERLRAVMMPYRYTSKDSLKDAEDCARALGCRYDIVPIF 354

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
           + V  F   ++Q  +    GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY 
Sbjct: 355 EPVEGFLHALTQMFEGTKEGITEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYA 414

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGFNP+KDLYK QV+ L+ WRNSH     LGP  EVIP +I++K+PSAELR +
Sbjct: 415 TLYGDMNGGFNPIKDLYKMQVYALSRWRNSHVPPGALGPSGEVIPKNIIDKAPSAELREN 474

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           QTDQ+SLPPYP+LDDI++ +VENE    +   + ++  TV  +EHLLY +EYKRRQA  G
Sbjct: 475 QTDQDSLPPYPVLDDILECLVENEMGVDDIVARGHDRATVTRIEHLLYIAEYKRRQAAPG 534

Query: 536 TKITAKSFGRDRLYPISNKFRDH 558
            KIT K+FGRDR YPI+N+FRD 
Sbjct: 535 VKITKKNFGRDRRYPITNRFRDR 557


>gi|218663273|ref|ZP_03519203.1| NAD(+) synthase (glutamine-hydrolysing) protein [Rhizobium etli
           IE4771]
          Length = 557

 Score =  524 bits (1350), Expect = e-146,   Method: Composition-based stats.
 Identities = 316/551 (57%), Positives = 397/551 (72%), Gaps = 7/551 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
            +IAI QLNP VGD+AGN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +FI+
Sbjct: 11  FRIAIGQLNPTVGDVAGNLAKAREARADAAREGAHLLVLTELFISGYPPEDLVLKPAFIR 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+++L +DT DGG G+V+GFPRQD+ G  NSV +LD G ++AVRDK++LPNY EF 
Sbjct: 71  ACWKAVESLAADTADGGPGVVIGFPRQDETGRYNSVAVLDGGKVVAVRDKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI ICEDIW    +C+ L + GAE L S N SPYY  K+
Sbjct: 131 EKRVFHQGAMPGPVNFRGVRLGIPICEDIWGELGVCETLAESGAEILLSPNGSPYYRGKV 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RH++V  Q+    LP+IY  Q+GGQDEL+FDGASF F+  + LAFQM  F     +T 
Sbjct: 191 DIRHQVVLKQVIETGLPLIYAAQLGGQDELVFDGASFAFNADRSLAFQMSEFETALAVTT 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   +  S W+      A       ++EEADY AC+L  RDYV KN F  V++GLSGGID
Sbjct: 251 W--KRGESGWHCAEGPMARIP----EDEEADYRACLLGFRDYVNKNGFKTVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAAIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI   V  F S
Sbjct: 305 SAICAAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEQPVTGFSS 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S   +   SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALSDLFEGTESGITEENLQSRARGVILMAISNKFGAMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYK QV+ LA WRN +   S LGP  EVIP +I++K+PSAELRP Q DQ+SLP
Sbjct: 425 GFNPIKDLYKMQVYALARWRNENVPPSALGPSGEVIPQNIIDKAPSAELRPDQKDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VE E +      + ++  TV  VEHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVEKEMAVEEIVARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNK 554
           GRDR YPI+N+
Sbjct: 545 GRDRRYPITNR 555


>gi|121601772|ref|YP_988914.1| NAD synthetase [Bartonella bacilliformis KC583]
 gi|120613949|gb|ABM44550.1| glutamine-dependent NAD(+) synthetase [Bartonella bacilliformis
           KC583]
          Length = 560

 Score =  524 bits (1349), Expect = e-146,   Method: Composition-based stats.
 Identities = 299/565 (52%), Positives = 389/565 (68%), Gaps = 14/565 (2%)

Query: 1   MLKK------LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPE 54
           M+ K       +IA+AQLNP+VGDI GN   A+ A ++A +QG DL+L TELFIS YPPE
Sbjct: 2   MMAKELIKDDFRIAVAQLNPIVGDIEGNFVLAKMAHQKAQQQGADLVLLTELFISAYPPE 61

Query: 55  DLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDK 114
           DLV K +F +AC +AI  L   T + G GI++G P +  + + N VV+LD G +IA   K
Sbjct: 62  DLVLKPAFTKACENAIKKLAKVTKE-GPGIIIGAPIKRGDAIYNGVVLLDNGQVIAEYLK 120

Query: 115 INLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSL 174
            +LPNY EF EKR F  G S +PIV+R I LGI++CEDIW +S+IC   + +GAEF+   
Sbjct: 121 FDLPNYLEFDEKRVFSPGPSPEPIVYRGITLGIVVCEDIWNDSSICTEFRNKGAEFILVS 180

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           N SPY HNK+ KR  IV  +     +P+IY NQVGGQDELIFDG SF  + Q  +AFQMK
Sbjct: 181 NGSPYCHNKILKRMSIVRARAIQAGVPVIYANQVGGQDELIFDGGSFALNEQGTVAFQMK 240

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHK 294
           HF     ++ W   ++   W  +S  +       L    ADY+ACVL LRDYV KN F  
Sbjct: 241 HFESHIAVSHW--QRKSIGWQCVSGPNEKL----LGGLAADYHACVLGLRDYVNKNGFKD 294

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
           VI+GLSGGIDSALCAAIA DALG E V+ IM+PY YTS +SL+DA  CA  L C Y+++P
Sbjct: 295 VILGLSGGIDSALCAAIATDALGAERVRAIMMPYHYTSEESLKDAKDCAHFLNCHYEIIP 354

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I   V +F S+++      PS +  EN+QSR+RG ILMALSN   +M++TT NKSE++VG
Sbjct: 355 IVQPVENFLSIIAPIFSGLPSDVTEENLQSRVRGTILMALSNKFGSMVITTGNKSEMAVG 414

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
           Y TLYGDM+GGFNP+KD+YK QV+ LA WRN + + + LG    VIPP+I++K+PSAELR
Sbjct: 415 YATLYGDMNGGFNPIKDIYKMQVYALAEWRNKNHLLNFLGAEGVVIPPNIIKKAPSAELR 474

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAP 533
            +Q D++SLPPYPILDDI++ +VEN+ S     +  +  ETV  VEHLLY +E+KRRQ+ 
Sbjct: 475 ENQKDEDSLPPYPILDDILQSLVENDMSVDEIVKCGHLRETVEKVEHLLYVAEHKRRQSA 534

Query: 534 VGTKITAKSFGRDRLYPISNKFRDH 558
            G KI++K+FGRDR YPI+N FRD 
Sbjct: 535 PGIKISSKNFGRDRRYPITNYFRDK 559


>gi|226943322|ref|YP_002798395.1| glutamine-dependent NAD+ synthase [Azotobacter vinelandii DJ]
 gi|226718249|gb|ACO77420.1| glutamine-dependent NAD+ synthase [Azotobacter vinelandii DJ]
          Length = 556

 Score =  523 bits (1346), Expect = e-146,   Method: Composition-based stats.
 Identities = 232/559 (41%), Positives = 334/559 (59%), Gaps = 21/559 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANR-QGMDLILFTELFISGYPPEDLVFK 59
           M + L++ +AQLN  VGD+ GN+ +   A   A   +G D+I+F EL + GYPPEDL+ +
Sbjct: 13  MSQTLRVVMAQLNLRVGDVHGNVERIIEAACSARDDRGADVIVFPELALCGYPPEDLLLR 72

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
            S        +  LK +    G  +V+G+P  +     N+  ++  G ++A   K +LPN
Sbjct: 73  SSMQLRIEQGLQRLKDEVR--GIYLVIGYPWLEDGRRFNAAAVIADGELLASYYKQHLPN 130

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           Y  F E+R F  G     +  + I + + ICEDIW    + +  ++ GA  + SLNASP+
Sbjct: 131 YRVFDERRYFEPGSEACLLDIKGIPVALSICEDIWFPGPM-RQAREAGARLMLSLNASPF 189

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           + +K ++R EI+  + S   +P+IYVNQVGGQDEL+FDG S       Q+  +   F E 
Sbjct: 190 HLDKQREREEILVARTSEGGMPVIYVNQVGGQDELVFDGGSCVVAADGQVVQRAPAFVEG 249

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEA-DYNACVLSLRDYVQKNNFHKVIIG 298
            +  +       +     ++ +      PL E EA  Y A VL +RDYV KN F  V++G
Sbjct: 250 LYPVDLGIGDDGAATPRATNCA------PLPELEASVYQALVLGVRDYVCKNGFKGVVLG 303

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL  A+AVDALG E V+ +M+PY YT+  SLEDA A A+ALG  Y VLPI  +
Sbjct: 304 LSGGIDSALTLAVAVDALGAERVEAVMMPYHYTAQMSLEDAEAEARALGVTYRVLPIAPM 363

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V  F   ++   +        EN+Q+R RG +LMA+SN    ++LTT NKSE++VGY TL
Sbjct: 364 VEAFMGTLAPVFEGLGRDTTEENLQARCRGTLLMAISNKKGYLVLTTGNKSEMAVGYATL 423

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGF+ LKD+ KT VF+L  +RN          L  VIP  ++++ PSAEL P Q 
Sbjct: 424 YGDMAGGFDVLKDVPKTLVFRLCDYRNR---------LGAVIPQRVVDRPPSAELAPGQK 474

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           D++SLPPYP+LD+I+K  +E + S        ++++TVR V  L+  +EYKRRQA VG +
Sbjct: 475 DEDSLPPYPVLDEILKLYIEYDLSANAIVAEGFDEDTVRRVLRLVDLNEYKRRQAAVGVR 534

Query: 538 ITAKSFGRDRLYPISNKFR 556
           +T + FGRDR YPI++ +R
Sbjct: 535 VTQRGFGRDRRYPITSGWR 553


>gi|15644009|ref|NP_229058.1| NAD synthetase [Thermotoga maritima MSB8]
 gi|8928238|sp|Q9X0Y0|NADE2_THEMA RecName: Full=Probable glutamine-dependent NAD(+) synthetase;
           AltName: Full=NAD(+) synthase [glutamine-hydrolyzing]
 gi|4981808|gb|AAD36328.1|AE001780_12 NH(3)-dependent NAD(+) synthetase [Thermotoga maritima MSB8]
          Length = 576

 Score =  522 bits (1345), Expect = e-146,   Method: Composition-based stats.
 Identities = 223/584 (38%), Positives = 333/584 (57%), Gaps = 34/584 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K+L++ +AQLNP +GD  GN+ KA  A   A  +G DL++F ELF+ GYPPEDL+ + S
Sbjct: 1   MKRLRVTLAQLNPTLGDFEGNLKKAIEALRVAEDRGSDLLVFPELFLPGYPPEDLMLRLS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++     +      T + G  +++GF   D++   N+  ++  G I+ V  KI+LPNY 
Sbjct: 61  FLRENRKYLQKFAQHTRNLGVTVLMGFIDSDEDA-YNAAAVVKDGEILGVYRKISLPNYG 119

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG-AEFLFSLNASPYY 180
            F E+R F  G     +   +I++G+ ICEDIW        L        + +L+ASPY+
Sbjct: 120 VFDERRYFKPGEELLVVKIGNIKVGVTICEDIWNPVEPSASLSLGEGVHLIANLSASPYH 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R + ++ +    H+ + Y N VGGQDEL+FDG S   D   ++    K F E+ 
Sbjct: 180 VGKPVLRKDYLSMKAYDYHVAMAYCNMVGGQDELVFDGGSMVVDASGEVINYGKLFEEEI 239

Query: 241 FMTEWHYDQQLS------QWNYMSDDSASTMYI-----------------PLQ-EEEADY 276
              +   D+ L       +  YM   +     +                 PL   EE  +
Sbjct: 240 ITVDLDLDENLRVSLVDPRRRYMKTQNYPVKTVEAGNLREKSGHFEPVVNPLPVREEEMF 299

Query: 277 NACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSL 336
            A +  LRDYV+KN F KV+IGLSGG+DS+L A IA +ALGKENV+ +++P  YTS +S+
Sbjct: 300 RALITGLRDYVRKNGFEKVVIGLSGGMDSSLVAVIATEALGKENVKGVLMPSMYTSKESI 359

Query: 337 EDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSN 396
           EDA   AK LG +  ++PI D+ + +   +          I  EN+Q+RIRGN LMALSN
Sbjct: 360 EDAQTLAKNLGIETFIIPITDVFHSYLETLKGVFAGREPDITEENLQARIRGNYLMALSN 419

Query: 397 HSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPL 456
               ++LTT NKSE++ GY TLYGDM+GGF  +KD+YKT V+++  W NS          
Sbjct: 420 KFGWLVLTTGNKSEMATGYATLYGDMAGGFAVIKDVYKTDVYRIGRWYNSWRG------- 472

Query: 457 TEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINND-QEYNDETV 515
            E+IP +I  K P+AELRP QTDQE LPPY +LD+I++  +E          + ++ +TV
Sbjct: 473 KEIIPENIFVKPPTAELRPGQTDQEKLPPYEVLDEILRLYIEEGLDPEEIASKGFDRKTV 532

Query: 516 RYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
             V  ++  +EYKR+QA +G KI+ ++FG+D   PI+N+F++ +
Sbjct: 533 LDVTEMIRKNEYKRKQAAIGVKISTRAFGKDWRMPITNRFKEPL 576


>gi|260463957|ref|ZP_05812153.1| NAD+ synthetase [Mesorhizobium opportunistum WSM2075]
 gi|259030332|gb|EEW31612.1| NAD+ synthetase [Mesorhizobium opportunistum WSM2075]
          Length = 558

 Score =  522 bits (1344), Expect = e-146,   Method: Composition-based stats.
 Identities = 310/563 (55%), Positives = 395/563 (70%), Gaps = 11/563 (1%)

Query: 1   MLKKL---KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           M KKL   +IAIAQLNP VGD+AGN+AKAR AR +A RQG DL+L+TELF++GYPPEDLV
Sbjct: 1   MTKKLDILRIAIAQLNPTVGDVAGNLAKAREARADAARQGADLVLYTELFLAGYPPEDLV 60

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
            K +F++AC  A     +DT DGG G+++G P + + G  NS+V  D G IIA R K++L
Sbjct: 61  LKPAFLKACEKAAQDFAADTADGGPGVIIGTPLKRKSGTHNSIVFADGGKIIAERYKLDL 120

Query: 118 PNYSEFHEKRTFISGYSND-PIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           PNY EF EKR F +G     P+ FR +RLGI ICEDIW    IC+ L + GAE L   N 
Sbjct: 121 PNYGEFDEKRVFQAGPEIQGPVNFRGVRLGIPICEDIWGEVGICETLAESGAEILLVPNG 180

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPYY  K+  RH++V  Q+    LPIIY NQ+GGQDELIFDGASF     + LAFQM  F
Sbjct: 181 SPYYRAKIDVRHQVVIRQVIECGLPIIYANQLGGQDELIFDGASFAIGADKTLAFQMSQF 240

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            +   +T W   +    W       +       + EEADY AC+L LRDYV KN F  V+
Sbjct: 241 EDAVDVTTW--KRTDDGWACAEGPMSKIP----EREEADYRACMLGLRDYVNKNGFKNVV 294

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSA+CAA+AVDALG+E ++ +M+PY+YTS  SL+DA  CA+ALGC+YD++PI 
Sbjct: 295 LGLSGGIDSAICAALAVDALGEERLRAVMMPYRYTSKDSLKDAEDCARALGCRYDIVPIF 354

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
           + V  F   ++Q  +    GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY 
Sbjct: 355 EPVEGFLHALTQLFEGTKEGITEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYA 414

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGFNP+KDLYK QV+ L+ WRNSH     LGP  EVIP +I++K+PSAELR +
Sbjct: 415 TLYGDMNGGFNPIKDLYKMQVYALSRWRNSHVPPGALGPSGEVIPKNIIDKAPSAELREN 474

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           QTDQ+SLPPYP+LDDI++ +VENE    +   + ++  TV  +EHLLY +EYKRRQA  G
Sbjct: 475 QTDQDSLPPYPVLDDILECLVENEMGVDDIVARGHDRATVTRIEHLLYIAEYKRRQAAPG 534

Query: 536 TKITAKSFGRDRLYPISNKFRDH 558
            KIT K+FGRDR YPI+N+FRD 
Sbjct: 535 VKITRKNFGRDRRYPITNRFRDR 557


>gi|153009427|ref|YP_001370642.1| NAD synthetase [Ochrobactrum anthropi ATCC 49188]
 gi|151561315|gb|ABS14813.1| NAD+ synthetase [Ochrobactrum anthropi ATCC 49188]
          Length = 559

 Score =  521 bits (1343), Expect = e-145,   Method: Composition-based stats.
 Identities = 305/555 (54%), Positives = 392/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP++GDIAGN+ KAR AR EA R   DLILFTELFISGYPPEDLV K SF+ 
Sbjct: 11  LRIAVAQLNPIMGDIAGNLTKARAARAEAARMKADLILFTELFISGYPPEDLVLKPSFLA 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L SDT DGG G+++G P   + G+ NS+ +LD G IIA R K++LPNY EF 
Sbjct: 71  ACEKAVRALASDTADGGPGVIIGTPLSRESGLHNSIAVLDGGEIIAERFKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F +G    P+ FR +R+GI ICEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 131 EKRVFQAGPMPGPVNFRGVRIGIPICEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LP++Y NQVGGQDEL+FDG SF F+  + L  Q+  F EQ  +T 
Sbjct: 191 DRRHQVVLKQVIETELPMVYANQVGGQDELVFDGGSFAFNTDRSLCLQLPQFEEQITLTV 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W   ++   W     + A       +  EADY+AC+L LRDYV KN F  V++GLSGGID
Sbjct: 251 WR--RENDGWRCEEGEKAILP----EGLEADYSACMLGLRDYVNKNGFKDVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ IMLPY+YTS +SL+DAA CAKALG +YD++PI   V  F  
Sbjct: 305 SAICAALGVDALGKDRVRCIMLPYRYTSDESLKDAADCAKALGVRYDIVPISAPVEGFLE 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +    +   SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALHPLFEGTESGVTEENLQSRARGTILMAVSNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ ++ WRNSH     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 425 GFNPIKDVYKMQVYAMSEWRNSHVPNGALGPSGEVIPHNIISKAPSAELRENQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINND-QEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVENEMSNTEIAERGHPLETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|209549596|ref|YP_002281513.1| NAD synthetase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535352|gb|ACI55287.1| NAD+ synthetase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 559

 Score =  521 bits (1343), Expect = e-145,   Method: Composition-based stats.
 Identities = 317/558 (56%), Positives = 398/558 (71%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
               +IAI QLNP+VGD+AGN+AKAR AR +A R+G  L++ TELFISGYPPEDLV K +
Sbjct: 8   SDIFRIAIGQLNPMVGDVAGNLAKAREARADAAREGAHLLVLTELFISGYPPEDLVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+AC  A+++L +DT DGG G+++GFPRQDQ G  NSV +LD G +IAVRDKI+LPNY 
Sbjct: 68  FIRACWKAVESLAADTADGGPGVLIGFPRQDQTGRYNSVAVLDGGKVIAVRDKIDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G    P+ FR +R+GI ICEDIW    +C+ L + GAE L S N SPYY 
Sbjct: 128 EFDEKRVFNQGAMPGPVNFRGVRIGIPICEDIWGELGVCETLAESGAEILLSPNGSPYYR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+  RH++V  Q+    LP++Y  Q+GGQDEL+FDGASF F+  + LAFQM  F     
Sbjct: 188 GKVDIRHQVVLKQVIETGLPLVYAAQLGGQDELVFDGASFAFNADKSLAFQMSQFETALA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +T W   +  + W+      A       + EEADY AC+L  RDYV KN F  V++GLSG
Sbjct: 248 VTTW--KRGGAGWHCAEGPMAHIP----EGEEADYRACLLGFRDYVNKNGFKTVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+C AIAVDALG+E V+T+MLPY+YTS  SL+DAA CAKALGC+YD++PI   V  
Sbjct: 302 GIDSAICTAIAVDALGEERVRTVMLPYRYTSEDSLKDAADCAKALGCRYDIVPIEQPVTG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F S +S       SGI  EN+QSR RG ILMA+SN   AM++TT NKSE+SVGY TLYGD
Sbjct: 362 FSSALSDLFAGTESGITEENLQSRARGVILMAISNKFGAMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KDLYK QV+ LA WRN +   S LGP  EVIP +I++K+PSAELRP Q DQ+
Sbjct: 422 MNGGFNPIKDLYKMQVYALARWRNENVPPSALGPSREVIPKNIIDKAPSAELRPDQKDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYPILDDI++ +VE E +      + ++  TV  +EHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPILDDILECLVEKEMAVEEIVARGHDVVTVHRIEHLLYLAEYKRRQSAPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|319899020|ref|YP_004159113.1| NH3-dependent NAD synthetase [Bartonella clarridgeiae 73]
 gi|319402984|emb|CBI76537.1| NH3-dependent NAD synthetase [Bartonella clarridgeiae 73]
          Length = 558

 Score =  521 bits (1342), Expect = e-145,   Method: Composition-based stats.
 Identities = 289/564 (51%), Positives = 382/564 (67%), Gaps = 13/564 (2%)

Query: 1   MLKKL-----KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPED 55
           M +KL     +I IAQLNP++GDI GN   A    ++A  QG DLIL TELFIS YPPED
Sbjct: 1   MTQKLIKDDLRIVIAQLNPIIGDIEGNFTLAEITYQKACEQGADLILLTELFISAYPPED 60

Query: 56  LVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKI 115
           LV K +F +AC  A+  L   T + G GI++G P +    + N +++L+ G +IA R K 
Sbjct: 61  LVLKSAFTKACEDAVKKLAQLTKE-GPGIIIGVPLKRDNSIYNGIMLLNDGQVIAERFKC 119

Query: 116 NLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLN 175
           +LPNY EF EKR F  G   +PIV+R + LG++ICEDIW + +IC  L  +GAE +   N
Sbjct: 120 DLPNYCEFDEKRVFSPGPRPEPIVYRGMTLGVVICEDIWNDPSICAELSHKGAEIILVPN 179

Query: 176 ASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKH 235
            SPY+ NK +KR +IV  Q     +PIIY NQVGGQDEL+FDG SF  D Q Q+AFQMKH
Sbjct: 180 GSPYHRNKTQKRLDIVRAQAVQSCVPIIYANQVGGQDELVFDGGSFALDEQGQIAFQMKH 239

Query: 236 FSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKV 295
           F     ++ W   ++   W  +S  +       L    ADY ACVL L+DYV KN F  V
Sbjct: 240 FESHIALSHWR--RKSIGWQCISGPNEEL----LDGLAADYYACVLGLKDYVNKNRFKDV 293

Query: 296 IIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPI 355
           I+G SGGIDSALCAAIAVDALG E V  +M+PY YTS +SL+DA  CA  LGC+Y+++PI
Sbjct: 294 ILGFSGGIDSALCAAIAVDALGAERVCAVMMPYYYTSQESLKDAKDCAHLLGCRYEMIPI 353

Query: 356 HDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGY 415
              V  F S+M+       + +  EN+QSRIRG++LM LSN   +M++TT NKSE++VGY
Sbjct: 354 LKPVESFLSVMAPIFSGLQTDVTEENLQSRIRGSVLMTLSNKFGSMVITTGNKSEMAVGY 413

Query: 416 GTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRP 475
            TLYGDM+GGFNP+KD+YK QV++LA WRN + + + LGP   +IP +I+EK PSAELR 
Sbjct: 414 ATLYGDMNGGFNPIKDIYKMQVYKLAEWRNKNHLQNLLGPKGIIIPSNIIEKEPSAELRE 473

Query: 476 HQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPV 534
           +Q D++ LPPYPILDDI++ ++E++ S  +   + ++ +TV  VEHLLY +EYKRRQ+  
Sbjct: 474 NQKDEDFLPPYPILDDILQSLIEDDMSVSDIVKRGHSRQTVEKVEHLLYLAEYKRRQSAP 533

Query: 535 GTKITAKSFGRDRLYPISNKFRDH 558
           G KI+ K+FGRDR YPI+N FRD 
Sbjct: 534 GVKISYKNFGRDRRYPITNHFRDK 557


>gi|148270642|ref|YP_001245102.1| NAD synthetase [Thermotoga petrophila RKU-1]
 gi|147736186|gb|ABQ47526.1| NH(3)-dependent NAD(+) synthetase [Thermotoga petrophila RKU-1]
          Length = 576

 Score =  521 bits (1342), Expect = e-145,   Method: Composition-based stats.
 Identities = 223/584 (38%), Positives = 333/584 (57%), Gaps = 34/584 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K+L++ +AQLNP +GD  GN+ KA  A   A  +G DL++F ELF+ GYPPEDL+ + S
Sbjct: 1   MKRLRVTLAQLNPTLGDFEGNLKKAIEALRVAEDRGSDLLVFPELFLPGYPPEDLMLRLS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++     +      T + G  +++GF   D++   N+  ++  G I+ V  KI+LPNY 
Sbjct: 61  FLRENRKYLQKFAQHTRNLGVTVLMGFIDSDEDA-YNAAAVVKGGEILGVYRKISLPNYG 119

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG-AEFLFSLNASPYY 180
            F E+R F  G     +   +I++G+ ICEDIW        L        + +L+ASPY+
Sbjct: 120 VFDERRYFKPGEELLVVKIGNIKVGVTICEDIWNPVEPSASLSLGEGVHLIANLSASPYH 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R + ++ +    H+ + Y N VGGQDEL+FDG S   D   ++    K F E+ 
Sbjct: 180 VGKPVLRKDYLSMKAYDYHVAMAYCNMVGGQDELVFDGGSMVVDASGEVINYGKLFEEEI 239

Query: 241 FMTEWHYDQQLS------QWNYMSDDSASTMYI-----------------PLQ-EEEADY 276
              +   D+ L       +  YM   +     +                 PL   EE  +
Sbjct: 240 ITVDLDLDENLRVSLVDPRRRYMKTQNYPVKTVEAGNLREKSGHFEPVVNPLPVREEEMF 299

Query: 277 NACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSL 336
            A +  LRDYV+KN F KV+IGLSGG+DS+L A IA +ALGKENV+ +++P  YTS +S+
Sbjct: 300 RALITGLRDYVRKNGFEKVVIGLSGGMDSSLVAVIATEALGKENVKGVLMPSMYTSKESI 359

Query: 337 EDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSN 396
           EDA   AK LG +  ++PI D+ + +   +          I  EN+Q+RIRGN LMALSN
Sbjct: 360 EDAQTLAKNLGIETFIIPITDVFHSYLGALEDVFAGREPDITEENLQARIRGNYLMALSN 419

Query: 397 HSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPL 456
               ++LTT NKSE++ GY TLYGDM+GGF  +KD+YKT V+++  W NS          
Sbjct: 420 KFGWLVLTTGNKSEMATGYATLYGDMAGGFAVIKDVYKTDVYRIGRWYNSWRG------- 472

Query: 457 TEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINND-QEYNDETV 515
            E+IP +I  K P+AELRP QTDQE LPPY +LD+I++  +E          + ++ +TV
Sbjct: 473 KEIIPENIFVKPPTAELRPGQTDQEKLPPYEVLDEILRLYIEEGLDPEEIASKGFDRKTV 532

Query: 516 RYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
             V  ++  +EYKR+QA +G KI+ ++FG+D   PI+N+F++ +
Sbjct: 533 LDVTEMIRKNEYKRKQAAIGVKISTRAFGKDWRMPITNRFKEPL 576


>gi|49475433|ref|YP_033474.1| NAD synthetase [Bartonella henselae str. Houston-1]
 gi|49238239|emb|CAF27449.1| NH3-dependent NAD synthetase [Bartonella henselae str. Houston-1]
          Length = 559

 Score =  521 bits (1342), Expect = e-145,   Method: Composition-based stats.
 Identities = 292/559 (52%), Positives = 388/559 (69%), Gaps = 8/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    ++A+AQLNP+VGDI GN + A  A ++A  +G +L+LFTELFIS YPPEDLV K 
Sbjct: 6   MKNDFRVAVAQLNPIVGDIEGNFSLAVMAHQKAKEEGANLVLFTELFISAYPPEDLVLKP 65

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F +AC  A+  L   T  GG GIV+G P +  + + N VV+LD G I+    K +LPNY
Sbjct: 66  AFTKACEDAVKKLAKLTK-GGPGIVIGLPLRHSDNIYNGVVLLDEGRIVTESLKFDLPNY 124

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           +EF EKR F SG   +PIV+  ++LGI+ICEDIW + ++C  L  +GAE +  LN SPY+
Sbjct: 125 AEFDEKRVFSSGPRPEPIVYHGLKLGIVICEDIWNDFSLCAELANKGAEIILVLNGSPYH 184

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK+ KR E+V  Q     L I+Y NQVGGQDEL+FDG SF  +GQ ++ FQMKHF    
Sbjct: 185 RNKILKRIEVVRAQALQSGLSIVYANQVGGQDELVFDGGSFALNGQGKMVFQMKHFENHI 244

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            ++ W   ++ + W  +S  + +     L    ADY ACVL LRDYV KN F  VI+GLS
Sbjct: 245 ALSHW--QKKTAGWQCVSGPNETL----LNGLAADYQACVLGLRDYVNKNRFQNVILGLS 298

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSALC  +AVDALG E V+T+M+PY YTS +SL+DA  CA  LGC+Y+++PI   V 
Sbjct: 299 GGIDSALCTTMAVDALGAEKVRTVMMPYHYTSQESLKDAKECAHLLGCRYEIIPIVQPVE 358

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   M+      PS +  EN+QSR+RG ILMALSN   +M++TT NKSE++VGY TLYG
Sbjct: 359 VFLKTMAPVFLGLPSDVTEENLQSRVRGVILMALSNKFGSMVVTTGNKSEMAVGYATLYG 418

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNPLKD+YKTQV+ LA WRN + + +  GP   VIPP+I+ K+PSAELR +Q D+
Sbjct: 419 DMNGGFNPLKDVYKTQVYALAQWRNQNHLQNLKGPEGVVIPPNIIAKAPSAELRENQKDE 478

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPYPILDDI++ ++E++ S  +   + Y  ETV  +EHL+YG+EYKRRQ+  G KI+
Sbjct: 479 DSLPPYPILDDILQSLIEDDMSVCDIIKRGYLRETVEKIEHLIYGAEYKRRQSAPGVKIS 538

Query: 540 AKSFGRDRLYPISNKFRDH 558
            K+FGRDR YPI N+FR++
Sbjct: 539 YKNFGRDRRYPIVNRFRNN 557


>gi|154245324|ref|YP_001416282.1| NAD synthetase [Xanthobacter autotrophicus Py2]
 gi|154159409|gb|ABS66625.1| NAD+ synthetase [Xanthobacter autotrophicus Py2]
          Length = 569

 Score =  521 bits (1341), Expect = e-145,   Method: Composition-based stats.
 Identities = 275/552 (49%), Positives = 371/552 (67%), Gaps = 9/552 (1%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           IA+AQLNP VGD+AGN+  ARR    A   G DL++F ELFI+GYPPEDLV K +F QAC
Sbjct: 25  IAVAQLNPTVGDVAGNLDLARRTSAGARDAGADLVVFPELFIAGYPPEDLVLKPAFQQAC 84

Query: 67  SSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEK 126
            +AI+TL ++T D G  +++G P  ++  + NSV++L+ G I AVR K++LPNY  F EK
Sbjct: 85  RAAIETLAAETAD-GPALLIGAPWVEEGKLYNSVLLLENGGISAVRHKVDLPNYGVFDEK 143

Query: 127 RTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKK 186
           R F  G    PI F+ +RLG+ ICEDIW  +++ + L + GAE L   N SPY  +   +
Sbjct: 144 RVFTPGPLPGPIPFKGVRLGVPICEDIW-GADVVECLAETGAELLIVPNGSPYRQSVYAE 202

Query: 187 RHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWH 246
           R  +   ++   HLP++YVNQVGGQDEL+FDGASF  +  + LA Q   F E+  +++W 
Sbjct: 203 RENVAVARVVESHLPLLYVNQVGGQDELVFDGASFALNPDRFLALQFPGFMERVRISKW- 261

Query: 247 YDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSA 306
                 ++        + +   ++ +EADY ACVL LRDYV KN F  V++GLSGGIDSA
Sbjct: 262 -----QRFENGWKCLGANLADRIEGDEADYAACVLGLRDYVNKNRFPGVVLGLSGGIDSA 316

Query: 307 LCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLM 366
           +CAA+AVDALG E V  IMLPY+YTS +SL DAAA A+AL  +YDVLPI   V    + +
Sbjct: 317 ICAAMAVDALGPERVHCIMLPYRYTSEESLADAAAVAQALFVRYDVLPIVAGVEGMEAAL 376

Query: 367 SQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGF 426
           +   +     +  EN+QSR+RG +LM++SN   AM++TT NKSE+S GY TLYGDM+GG+
Sbjct: 377 APLFEGTQRDVTEENLQSRVRGALLMSVSNKFGAMVVTTGNKSEMSTGYATLYGDMNGGY 436

Query: 427 NPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPY 486
           NP+KDLYKTQV +L+  RN       LGP   VIP S+++K P+AELR +Q D++SLPPY
Sbjct: 437 NPIKDLYKTQVTRLSRLRNRWKPADALGPDGVVIPDSLIDKPPTAELRENQKDEDSLPPY 496

Query: 487 PILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGR 545
            +LD I++R+VE E S        +N  TV  VE LL  +EYKRRQA  G K+T ++FGR
Sbjct: 497 AVLDAILERLVEREHSVAQIIADGFNAATVTRVERLLNIAEYKRRQAAPGVKVTGRNFGR 556

Query: 546 DRLYPISNKFRD 557
           DR YPI+N+FR+
Sbjct: 557 DRRYPITNRFRE 568


>gi|154249452|ref|YP_001410277.1| NAD+ synthetase [Fervidobacterium nodosum Rt17-B1]
 gi|154153388|gb|ABS60620.1| NAD+ synthetase [Fervidobacterium nodosum Rt17-B1]
          Length = 583

 Score =  521 bits (1341), Expect = e-145,   Method: Composition-based stats.
 Identities = 226/592 (38%), Positives = 337/592 (56%), Gaps = 40/592 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + K+++A+AQ+N  VGDI GN  K      +A    +D+++F EL I+GYPPEDL+FK  
Sbjct: 1   MNKVRLALAQINATVGDIEGNKNKIIEYINKALENDVDIVIFPELSITGYPPEDLLFKSH 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++    AI+ +          +VVGF  ++ + + N+  +++ G + A   K  LPNY 
Sbjct: 61  FVRKNKEAIEEIARHVPK-SLVVVVGFVDEEGD-IFNAAAVINDGKVQAKYRKNYLPNYG 118

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKK-QGAEFLFSLNASPYY 180
            F E R F  G     ++  D+R+GI ICEDIW      +       A+ + +L+ASPYY
Sbjct: 119 VFDEMRYFQKGTKALVVLLEDVRVGITICEDIWYPGGPARLESLLGDAQLIVNLSASPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K+  R  +++ + +     + YVN VGGQDELIFDGAS   + + ++  + K F E  
Sbjct: 179 VEKIAWRERMLSVRANDNIATVAYVNCVGGQDELIFDGASLVVNEKGEIIGRAKQFEEDL 238

Query: 241 FMTEWHY---------------DQQLSQWNYMSDDSASTMYI--------------PLQE 271
            + +                  D+Q+      + +     +                L +
Sbjct: 239 LIVDVDLIDIDKTCVKDPRRRQDKQIMDEERKNLEIVKLPFESKPKRTKITNRVEKTLPK 298

Query: 272 EEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYT 331
               YNA VL+ RDY++KN   K +IGLSGG+DS L A IAVDALG ENV  + +P  ++
Sbjct: 299 VAEVYNALVLATRDYIRKNGMKKAVIGLSGGMDSTLVACIAVDALGAENVVGVSMPGPFS 358

Query: 332 SPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNIL 391
           S  S EDA   A+ LG K+  +PI +  N F ++     ++ P  I  EN+Q+RIRG IL
Sbjct: 359 SEHSKEDAKILAENLGIKFLTIPIMEAYNSFLNMFKPVFEDRPFDITEENLQARIRGVIL 418

Query: 392 MALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITS 451
           MALSN    ++LTT NKSEIS GY TLYGD +GG+  +KD+YKT V++LA + N      
Sbjct: 419 MALSNKFGWIVLTTGNKSEISTGYSTLYGDTAGGYAVIKDVYKTFVYELAEYVNQKYGR- 477

Query: 452 GLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEY 510
                 E+IP  + EK+PSAELR +QTDQ+ LPPY ILD+I+K  VE + S  +  ++ +
Sbjct: 478 ------EIIPRRVFEKAPSAELRENQTDQDKLPPYEILDEILKLYVEEDYSVSDIVERGF 531

Query: 511 NDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHISEE 562
           ++ETV+ V  ++  +EYKRRQ P G KIT ++FG+DR  PI+N F++ + ++
Sbjct: 532 DEETVKKVAWMVDINEYKRRQMPPGPKITHRAFGKDRRLPITNAFKEWLEKK 583


>gi|115524006|ref|YP_780917.1| NAD synthetase [Rhodopseudomonas palustris BisA53]
 gi|115517953|gb|ABJ05937.1| NH(3)-dependent NAD(+) synthetase [Rhodopseudomonas palustris
           BisA53]
          Length = 587

 Score =  520 bits (1340), Expect = e-145,   Method: Composition-based stats.
 Identities = 274/557 (49%), Positives = 371/557 (66%), Gaps = 13/557 (2%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           + +AQLNP VGDIAGN AKAR AR +A   G DLI+F ELF+SGYPPEDLV K +F  AC
Sbjct: 12  VTLAQLNPTVGDIAGNAAKARVARAQARDDGADLIVFPELFLSGYPPEDLVLKPAFQAAC 71

Query: 67  SSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEK 126
            +A++ L  +T DGG  +++G P  D   + N+  +LDAG I ++R K+NLPNY  F EK
Sbjct: 72  RAAVEELARETADGGPAMLIGSPWVDDGRLYNACALLDAGAIASIRYKVNLPNYGVFDEK 131

Query: 127 RTFISGYSNDPIVFRDIRLGILICEDIWK-----NSNICKHLKKQGAEFLFSLNASPYYH 181
           R F  G  + P+  R +R+G+ ICED W        N+ + L + GAE L   N SPY  
Sbjct: 132 RVFARGPVSGPMTIRGVRVGVPICEDTWMEESADYENVVECLAETGAELLIVPNGSPYAR 191

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K   R  +   +++   LP++Y+NQVGGQDEL+FDGASF  +    LA Q+  F E   
Sbjct: 192 GKNDIRLAVQVARVTESDLPLVYLNQVGGQDELVFDGASFVLNADCSLAAQLPGFRES-- 249

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +    +++  + W      +       L  +E DY ACVL LRDYV+KN F  V++G+SG
Sbjct: 250 VVTLRWNKTNTGWRCEGPVAPL-----LDGDEGDYAACVLGLRDYVRKNGFPGVLLGVSG 304

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSALCAAIAVDALG + ++ +MLP++YT+  SL+DAA  A ALG  Y VLPI   V  
Sbjct: 305 GIDSALCAAIAVDALGADKLRGVMLPFRYTAQVSLDDAAKLAAALGFNYAVLPIAQAVEG 364

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F +++++  +  P  I  EN+Q+R RG +LMA+SN + AM++TT NKSE+SVGY TLYGD
Sbjct: 365 FEAILAETFKGLPRDITEENLQARTRGTLLMAISNKTGAMVVTTGNKSEMSVGYATLYGD 424

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YKT+VF+L+S RN       LGP  EVIP +I+ + P+AELR +QTDQ+
Sbjct: 425 MNGGFNPIKDIYKTEVFRLSSLRNRWKPDDALGPSGEVIPENIITRPPTAELRENQTDQD 484

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPY ILD I++R+VE E+   +     ++ +TV  ++ LL  +EYKRRQA  G K+T 
Sbjct: 485 SLPPYDILDGILERLVEREQPLADIVAAGFDRDTVARIDRLLNVAEYKRRQAAPGVKVTR 544

Query: 541 KSFGRDRLYPISNKFRD 557
           K+FGRDR YPI+N+FRD
Sbjct: 545 KNFGRDRRYPITNRFRD 561


>gi|170289348|ref|YP_001739586.1| NAD+ synthetase [Thermotoga sp. RQ2]
 gi|281412952|ref|YP_003347031.1| NAD+ synthetase [Thermotoga naphthophila RKU-10]
 gi|170176851|gb|ACB09903.1| NAD+ synthetase [Thermotoga sp. RQ2]
 gi|281374055|gb|ADA67617.1| NAD+ synthetase [Thermotoga naphthophila RKU-10]
          Length = 576

 Score =  520 bits (1340), Expect = e-145,   Method: Composition-based stats.
 Identities = 223/584 (38%), Positives = 333/584 (57%), Gaps = 34/584 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K+L++ +AQLNP +GD  GN+ KA  A   A  +G DL++F ELF+ GYPPEDL+ + S
Sbjct: 1   MKRLRVTLAQLNPTLGDFEGNLKKAIEALRVAEDRGSDLLVFPELFLPGYPPEDLMLRLS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++     +      T + G  +++GF   D++   N+  ++  G I+ V  KI+LPNY 
Sbjct: 61  FLRENRKYLQKFAQHTRNLGVTVLMGFIDSDEDA-YNAAAVVKGGEILGVYRKISLPNYG 119

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG-AEFLFSLNASPYY 180
            F E+R F  G     +   +I++G+ ICEDIW        L        + +L+ASPY+
Sbjct: 120 VFDERRYFKPGEELLVVKIGNIKVGVTICEDIWNPVEPSASLSLGEGVHLIANLSASPYH 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R + ++ +    H+ + Y N VGGQDEL+FDG S   D   ++    K F E+ 
Sbjct: 180 VGKPVLRKDYLSMKAYDYHVAMAYCNMVGGQDELVFDGGSMVVDASGEVINYGKLFEEEI 239

Query: 241 FMTEWHYDQQLS------QWNYMSDDSASTMYI-----------------PLQ-EEEADY 276
              +   D+ L       +  YM   +     +                 PL   EE  +
Sbjct: 240 ITVDLDLDENLRVSLVDPRRRYMKTQNYPVKTVEAGNLREKSGHFEPVVNPLPVREEEMF 299

Query: 277 NACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSL 336
            A +  LRDYV+KN F KV+IGLSGG+DS+L A IA +ALGKENV+ +++P  YTS +S+
Sbjct: 300 RALITGLRDYVRKNGFEKVVIGLSGGMDSSLVAVIATEALGKENVKGVLMPSMYTSKESI 359

Query: 337 EDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSN 396
           EDA   AK LG +  ++PI D+ + +   +          I  EN+Q+RIRGN LMALSN
Sbjct: 360 EDAQTLAKNLGIETFIIPITDVFHSYLETLKGVFAGREPDITEENLQARIRGNYLMALSN 419

Query: 397 HSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPL 456
               ++LTT NKSE++ GY TLYGDM+GGF  +KD+YKT V+++  W NS          
Sbjct: 420 KFGWLVLTTGNKSEMATGYATLYGDMAGGFAVIKDVYKTDVYRIGRWYNSWRG------- 472

Query: 457 TEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINND-QEYNDETV 515
            E+IP +I  K P+AELRP QTDQE LPPY +LD+I++  +E          + ++ +TV
Sbjct: 473 KEIIPENIFVKPPTAELRPGQTDQEKLPPYEVLDEILRLYIEEGLDPEEIASKGFDRKTV 532

Query: 516 RYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
             V  ++  +EYKR+QA +G KI+ ++FG+D   PI+N+F++ +
Sbjct: 533 LDVTEMIRKNEYKRKQAAIGVKISTRAFGKDWRMPITNRFKEPL 576


>gi|161618967|ref|YP_001592854.1| NAD synthetase [Brucella canis ATCC 23365]
 gi|163843283|ref|YP_001627687.1| NAD synthetase [Brucella suis ATCC 23445]
 gi|225627493|ref|ZP_03785530.1| NAD+ synthetase [Brucella ceti str. Cudo]
 gi|260566446|ref|ZP_05836916.1| NAD+ synthase [Brucella suis bv. 4 str. 40]
 gi|261218645|ref|ZP_05932926.1| NAD+ synthetase [Brucella ceti M13/05/1]
 gi|261222183|ref|ZP_05936464.1| NAD+ synthetase [Brucella ceti B1/94]
 gi|261314259|ref|ZP_05953456.1| NAD+ synthetase [Brucella pinnipedialis M163/99/10]
 gi|261321857|ref|ZP_05961054.1| NAD+ synthetase [Brucella ceti M644/93/1]
 gi|261752317|ref|ZP_05996026.1| NAD+ synthetase [Brucella suis bv. 5 str. 513]
 gi|261754975|ref|ZP_05998684.1| NAD+ synthetase [Brucella suis bv. 3 str. 686]
 gi|261758202|ref|ZP_06001911.1| NAD(+) synthase [Brucella sp. F5/99]
 gi|265998147|ref|ZP_06110704.1| NAD+ synthetase [Brucella ceti M490/95/1]
 gi|294852395|ref|ZP_06793068.1| NAD+ synthase [Brucella sp. NVSL 07-0026]
 gi|161335778|gb|ABX62083.1| NAD+ synthetase [Brucella canis ATCC 23365]
 gi|163674006|gb|ABY38117.1| NAD+ synthetase [Brucella suis ATCC 23445]
 gi|225617498|gb|EEH14543.1| NAD+ synthetase [Brucella ceti str. Cudo]
 gi|260155964|gb|EEW91044.1| NAD+ synthase [Brucella suis bv. 4 str. 40]
 gi|260920767|gb|EEX87420.1| NAD+ synthetase [Brucella ceti B1/94]
 gi|260923734|gb|EEX90302.1| NAD+ synthetase [Brucella ceti M13/05/1]
 gi|261294547|gb|EEX98043.1| NAD+ synthetase [Brucella ceti M644/93/1]
 gi|261303285|gb|EEY06782.1| NAD+ synthetase [Brucella pinnipedialis M163/99/10]
 gi|261738186|gb|EEY26182.1| NAD(+) synthase [Brucella sp. F5/99]
 gi|261742070|gb|EEY29996.1| NAD+ synthetase [Brucella suis bv. 5 str. 513]
 gi|261744728|gb|EEY32654.1| NAD+ synthetase [Brucella suis bv. 3 str. 686]
 gi|262552615|gb|EEZ08605.1| NAD+ synthetase [Brucella ceti M490/95/1]
 gi|294820984|gb|EFG37983.1| NAD+ synthase [Brucella sp. NVSL 07-0026]
          Length = 559

 Score =  520 bits (1340), Expect = e-145,   Method: Composition-based stats.
 Identities = 305/555 (54%), Positives = 388/555 (69%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 11  LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 71  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 131 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 191 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 251 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 305 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 425 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|261317648|ref|ZP_05956845.1| NAD+ synthetase [Brucella pinnipedialis B2/94]
 gi|265988683|ref|ZP_06101240.1| NAD+ synthetase [Brucella pinnipedialis M292/94/1]
 gi|261296871|gb|EEY00368.1| NAD+ synthetase [Brucella pinnipedialis B2/94]
 gi|264660880|gb|EEZ31141.1| NAD+ synthetase [Brucella pinnipedialis M292/94/1]
          Length = 559

 Score =  520 bits (1339), Expect = e-145,   Method: Composition-based stats.
 Identities = 305/555 (54%), Positives = 389/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 11  LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 71  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW   ++ + L + GAE L   N SPY+  K+
Sbjct: 131 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELDVAETLAESGAEILLVPNGSPYHRAKM 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 191 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 251 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 305 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 425 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|23501895|ref|NP_698022.1| NAD synthetase [Brucella suis 1330]
 gi|254701766|ref|ZP_05163594.1| NAD synthetase [Brucella suis bv. 5 str. 513]
 gi|254704307|ref|ZP_05166135.1| NAD synthetase [Brucella suis bv. 3 str. 686]
 gi|254706790|ref|ZP_05168618.1| NAD synthetase [Brucella pinnipedialis M163/99/10]
 gi|254714100|ref|ZP_05175911.1| NAD synthetase [Brucella ceti M644/93/1]
 gi|254716843|ref|ZP_05178654.1| NAD synthetase [Brucella ceti M13/05/1]
 gi|256159733|ref|ZP_05457480.1| NAD synthetase [Brucella ceti M490/95/1]
 gi|256254996|ref|ZP_05460532.1| NAD synthetase [Brucella ceti B1/94]
 gi|256369438|ref|YP_003106946.1| NAD(+) synthase [Brucella microti CCM 4915]
 gi|260168725|ref|ZP_05755536.1| NAD synthetase [Brucella sp. F5/99]
 gi|23347836|gb|AAN29937.1| NH(3)-dependent NAD+ synthetase [Brucella suis 1330]
 gi|255999598|gb|ACU47997.1| NAD(+) synthase [Brucella microti CCM 4915]
          Length = 550

 Score =  520 bits (1339), Expect = e-145,   Method: Composition-based stats.
 Identities = 305/555 (54%), Positives = 388/555 (69%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|254710099|ref|ZP_05171910.1| NAD synthetase [Brucella pinnipedialis B2/94]
 gi|256031595|ref|ZP_05445209.1| NAD synthetase [Brucella pinnipedialis M292/94/1]
          Length = 550

 Score =  520 bits (1339), Expect = e-145,   Method: Composition-based stats.
 Identities = 305/555 (54%), Positives = 389/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW   ++ + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELDVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|265984081|ref|ZP_06096816.1| NAD+ synthetase [Brucella sp. 83/13]
 gi|306838375|ref|ZP_07471220.1| NAD+ synthetase [Brucella sp. NF 2653]
 gi|264662673|gb|EEZ32934.1| NAD+ synthetase [Brucella sp. 83/13]
 gi|306406515|gb|EFM62749.1| NAD+ synthetase [Brucella sp. NF 2653]
          Length = 559

 Score =  520 bits (1338), Expect = e-145,   Method: Composition-based stats.
 Identities = 303/555 (54%), Positives = 387/555 (69%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 11  LRIAVAQLNPTMGDIAGNLAKARAARSEAARMQADLILFTELFISGYPPEDMVLKPAFVA 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 71  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 131 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG +F F+  + L  QM  F+EQ  +TE
Sbjct: 191 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGTFVFNADKSLCLQMPQFAEQIALTE 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W       AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 251 WQRDGD--GWRCGDGKKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CA+ALG +YD++PI + V  F +
Sbjct: 305 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCARALGVRYDIVPIAEPVEGFMN 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 425 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVENEMSNAEIVARGHTLETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|254503440|ref|ZP_05115591.1| NAD synthase family [Labrenzia alexandrii DFL-11]
 gi|222439511|gb|EEE46190.1| NAD synthase family [Labrenzia alexandrii DFL-11]
          Length = 555

 Score =  520 bits (1338), Expect = e-145,   Method: Composition-based stats.
 Identities = 271/561 (48%), Positives = 376/561 (67%), Gaps = 10/561 (1%)

Query: 1   ML-KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFK 59
           M     ++A+AQLNP VGD+AGN    R+AR +A  Q  DL+L +EL ++GYPPEDLV K
Sbjct: 1   MTINSFRLAVAQLNPTVGDVAGNAELVRQARADAKAQQSDLVLTSELMLAGYPPEDLVLK 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQ-EGVLNSVVILDAGNIIAVRDKINLP 118
            +F++ C      L  +T DGG  +++G P       + N+V+++D G + AVR K +LP
Sbjct: 61  PAFVRECMETARALAEETGDGGPAVILGTPWYSDAGDLHNAVLLIDQGEVKAVRYKSDLP 120

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           NY  F EKR F +G    P+ FR +R+G+ ICEDIW +    + L++ GAE L   N SP
Sbjct: 121 NYGVFDEKRVFKAGPLPGPVDFRGVRIGLPICEDIWNDEVC-ECLEETGAEILLVPNGSP 179

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y+ N+ ++R ++V  ++    LP++Y NQ+GGQDEL+FDG SF     + LAFQM  F  
Sbjct: 180 YWENRAEERLQVVVARVVQTDLPLVYCNQLGGQDELVFDGGSFALQADRSLAFQMPQFET 239

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
              +++W  D +   W   S   A         +EA++ ACVL L DYV KN F  V++G
Sbjct: 240 ALGISDWKRDGEA--WTCTSGSVAKLP----DLDEANWRACVLGLGDYVTKNGFPGVVLG 293

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSA+CAA+AVDALG + V +IMLP++YTS +S++DAA CAKALG +YD +PI + 
Sbjct: 294 LSGGIDSAVCAAMAVDALGADKVHSIMLPFRYTSEESIKDAADCAKALGLRYDTVPIAEP 353

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V  F   +        +G+  EN+QSR RG ILMA+SN    M++TT NKSE+SVGY TL
Sbjct: 354 VEGFTKALDGLFAGTEAGVTEENLQSRTRGVILMAVSNKFGHMVMTTGNKSEMSVGYATL 413

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GG+NP+KDLYKTQV+ L++WRN++     LGP  EVIP +I+ K P+AELR +QT
Sbjct: 414 YGDMNGGYNPIKDLYKTQVYHLSAWRNANKPAGLLGPDGEVIPSNIITKVPTAELRENQT 473

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLP Y +LDDI++ +VE E S  + ++  ++ + +  +EHLLY +EYKRRQAP G K
Sbjct: 474 DQDSLPAYDVLDDILECLVEKEMSVGDIEKRGHSRDLIHRIEHLLYIAEYKRRQAPPGVK 533

Query: 538 ITAKSFGRDRLYPISNKFRDH 558
           IT ++FGRDR YPI+N+FRD 
Sbjct: 534 ITERNFGRDRRYPITNRFRDR 554


>gi|254719091|ref|ZP_05180902.1| NAD synthetase [Brucella sp. 83/13]
          Length = 550

 Score =  519 bits (1337), Expect = e-145,   Method: Composition-based stats.
 Identities = 303/555 (54%), Positives = 387/555 (69%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARAARSEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG +F F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGTFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W       AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDGD--GWRCGDGKKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CA+ALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCARALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHTLETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|319408420|emb|CBI82075.1| NH3-dependent NAD synthetase [Bartonella schoenbuchensis R1]
          Length = 558

 Score =  519 bits (1337), Expect = e-145,   Method: Composition-based stats.
 Identities = 297/557 (53%), Positives = 381/557 (68%), Gaps = 8/557 (1%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
              +IA+AQLNPV+GDI GN A A  A ++A  QG DL+L TELFIS YPPEDLV K +F
Sbjct: 8   NDFRIAVAQLNPVIGDIEGNFALAIMAHQKAQEQGADLVLLTELFISAYPPEDLVLKPAF 67

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           I+AC +A+  L   T   G GIV+G P +  + + N V++L+ G I+A R K +LPNY+E
Sbjct: 68  IKACENAVQRLAKVTK-NGPGIVIGVPLRRDDAIYNGVMLLNDGQIVAERLKFDLPNYAE 126

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F S    +PIV+R I LGI+ICEDIW +S+IC  L  +GAE +   N SPY  +
Sbjct: 127 FDEKRVFSSDPFLEPIVYRGITLGIVICEDIWSDSSICAQLSNKGAEIILVPNGSPYTRH 186

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K  KR +IV  Q     +PIIY NQVGGQDEL+FDG SF  +GQ ++AFQMKHF     +
Sbjct: 187 KTLKRLDIVRAQAIQSGVPIIYANQVGGQDELVFDGGSFALNGQGKMAFQMKHFESHIAL 246

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
           + W   +Q   W  +S  +       L    ADY ACVL LRDYV KN F  VI+GLSGG
Sbjct: 247 SHW--QRQSIGWQCISGPNEEL----LSGLAADYQACVLGLRDYVNKNCFQDVILGLSGG 300

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSALCA +AVDALG E V+T+M+PY YTS +SL DA  CA+ LGC Y+V+PI   V  F
Sbjct: 301 IDSALCATMAVDALGAERVRTVMMPYHYTSQESLRDAEDCARFLGCHYEVIPIIQPVEGF 360

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            + ++    +    +  EN+QSR RG ILMALSN   +M++TT NKSE++VGY TLYGDM
Sbjct: 361 LNALAPAFSQLKPDLTEENLQSRTRGTILMALSNKFGSMVITTGNKSEMAVGYATLYGDM 420

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGFNP+KD+YK QV+ LA WRN + + + LG    VIP +I+ K+PSAELR +Q D++S
Sbjct: 421 NGGFNPIKDIYKMQVYALAKWRNKNHLQNLLGAKGVVIPSNIIMKAPSAELRENQKDEDS 480

Query: 483 LPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPYPILDDI++ +VE++ S     Q  +  ETV  +EHLLY +EYKRRQ+  G KI++K
Sbjct: 481 LPPYPILDDILQSLVEDDMSVGEIVQCGHLRETVEKIEHLLYLAEYKRRQSAPGVKISSK 540

Query: 542 SFGRDRLYPISNKFRDH 558
           SFGRDR YPI N+FRD 
Sbjct: 541 SFGRDRRYPIINRFRDK 557


>gi|182677746|ref|YP_001831892.1| NAD synthetase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633629|gb|ACB94403.1| NAD+ synthetase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 557

 Score =  519 bits (1337), Expect = e-145,   Method: Composition-based stats.
 Identities = 277/557 (49%), Positives = 369/557 (66%), Gaps = 8/557 (1%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
            +L IA+AQ+N  VGDI GN+A+ R AR +A+  G DL++F+ELFISGYPPEDLV K SF
Sbjct: 8   DRLVIALAQINSTVGDIDGNLARIREARAKAHGFGADLVMFSELFISGYPPEDLVLKPSF 67

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
             AC  A + L  +T DGG  I+VG P  +     N+  +L  G I A+R K++LPNY  
Sbjct: 68  QDACRVACENLARETADGGPAILVGLPWGELGACYNAYALLAHGRIEAMRFKVDLPNYGV 127

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F +G    PI+F+ +R+GI ICEDIW   +  + + + G E L   N SPY+ +
Sbjct: 128 FDEKRVFRAGPLQGPIIFKGVRIGIPICEDIW-GPDPVECIAETGGEILLVPNGSPYWES 186

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K  +R  +V  +IS  HLP+IY+NQ+GGQDEL+FDGA+F  +    LA Q+  F      
Sbjct: 187 KSSERLSVVKARISETHLPLIYLNQLGGQDELVFDGATFALNADGTLACQLPAFEAIIAK 246

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
           T W    +     ++  ++  T  I   +  ADY AC+L LRDYV+K  F  V++GLSGG
Sbjct: 247 TVW----ERRGDTFVCVEAPKTQVIEGDD--ADYTACMLGLRDYVEKIGFPGVVLGLSGG 300

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           +DSALCAA+AVDALG+E V  +MLPY+YTS +SL DA ACA ALG +YD++PI   V  F
Sbjct: 301 VDSALCAALAVDALGREKVHAVMLPYRYTSQESLIDAKACATALGLRYDIVPIAPAVEGF 360

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            +L++        G+  EN+QSR RG +LM++SN   +ML+TT NKSE+SVGY T+YGDM
Sbjct: 361 ETLLAPMFAGTAPGLTEENLQSRTRGTVLMSISNKFGSMLVTTGNKSEMSVGYATIYGDM 420

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGFNP+KD+YKTQVF+L   RN       LGP  EVIP +I+ K PSAELR +Q DQ+S
Sbjct: 421 NGGFNPIKDIYKTQVFRLCHLRNRWKPKGALGPDGEVIPYNIIVKPPSAELRENQKDQDS 480

Query: 483 LPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY ILD I++ +VE ++   +     Y + T+R VE LLY +EYKRRQ+  G K+T +
Sbjct: 481 LPPYDILDGILEGLVEKDQGVADLVAAGYEEPTIRRVERLLYLAEYKRRQSAPGVKVTRR 540

Query: 542 SFGRDRLYPISNKFRDH 558
           +FGRDR YPI N FRD 
Sbjct: 541 NFGRDRRYPIVNGFRDR 557


>gi|261325107|ref|ZP_05964304.1| NAD+ synthetase [Brucella neotomae 5K33]
 gi|261301087|gb|EEY04584.1| NAD+ synthetase [Brucella neotomae 5K33]
          Length = 559

 Score =  519 bits (1336), Expect = e-145,   Method: Composition-based stats.
 Identities = 302/555 (54%), Positives = 387/555 (69%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 11  LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G +IA R K++LPNY EF 
Sbjct: 71  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEVIAERFKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G     + FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 131 EKRVFEPGPMPGQVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 191 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 251 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 305 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 425 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ ++ENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLIENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|325293042|ref|YP_004278906.1| NH3-dependent NAD synthetase [Agrobacterium sp. H13-3]
 gi|325060895|gb|ADY64586.1| NH3-dependent NAD synthetase [Agrobacterium sp. H13-3]
          Length = 559

 Score =  518 bits (1335), Expect = e-145,   Method: Composition-based stats.
 Identities = 310/558 (55%), Positives = 400/558 (71%), Gaps = 7/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
              L+IA+ Q NP VGD+AGN+A+AR AR +A  QG DL+L TELFISGYPPEDLV K +
Sbjct: 8   KNHLRIAVGQFNPTVGDVAGNLARAREARADAATQGADLLLLTELFISGYPPEDLVLKPA 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++AC  A++ L ++T DGG G+V+GFPRQ + G  NSV +LD G IIA+RDKI+LPNY 
Sbjct: 68  FLKACLKAVEELAAETADGGPGVVIGFPRQGETGRHNSVALLDGGKIIALRDKIDLPNYG 127

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G  + P  FR +R+GI ICE+IW +  +C+ L + GAE L   N SPYY 
Sbjct: 128 EFDEKRVFAEGSISGPYNFRGVRIGIPICEEIWNDMGVCETLAESGAEILLVPNGSPYYR 187

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            KL  RH++   Q+    LP+++ NQ+GGQDEL+FDGASF F+  + LAFQM  F     
Sbjct: 188 GKLDVRHQVALKQVIESGLPLVFANQLGGQDELVFDGASFGFNADKTLAFQMSQFEATLA 247

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +T+W   +    W   S   +       + EEADY AC+L  RDYV KN F  V++GLSG
Sbjct: 248 VTDW--KRTAEGWRCESGPFSKIP----EGEEADYRACMLGFRDYVNKNGFKSVVLGLSG 301

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+CAA+AVDALG+E V+ IMLPY+YTS  SL+DAA CA+ALGC+YD++PI + V+ 
Sbjct: 302 GIDSAICAALAVDALGEERVRCIMLPYRYTSEDSLKDAADCARALGCRYDIVPIAEPVDG 361

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F S +S+  +    GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGD
Sbjct: 362 FLSALSEMFEGTEEGITEENLQSRTRGTILMAVSNKFGSMVVTTGNKSEMSVGYATLYGD 421

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KDLYK QV+ ++SWRNSH     LGP  EVIP +I+ K+PSAELRP+QTDQ+
Sbjct: 422 MNGGFNPIKDLYKMQVYAISSWRNSHVPPGALGPSGEVIPANIISKAPSAELRPNQTDQD 481

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPYP+LDDI++ +VE E S      + ++  TV  +EHLLY +EYKRRQ+  G KIT 
Sbjct: 482 SLPPYPVLDDILECLVEKEMSVEEILARGHDIATVHRIEHLLYLAEYKRRQSAPGVKITK 541

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N+FRD 
Sbjct: 542 KNFGRDRRYPITNRFRDR 559


>gi|306843889|ref|ZP_07476484.1| NAD+ synthetase [Brucella sp. BO1]
 gi|306275644|gb|EFM57368.1| NAD+ synthetase [Brucella sp. BO1]
          Length = 559

 Score =  518 bits (1335), Expect = e-145,   Method: Composition-based stats.
 Identities = 305/555 (54%), Positives = 388/555 (69%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 11  LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 71  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 131 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 191 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 251 WQRDGG--GWRCGDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CA+ALG +YD++PI + V  F +
Sbjct: 305 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCARALGVRYDIVPIAEPVEGFMN 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN H     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 425 GFNPIKDVYKMQVYALSQWRNHHLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|256061106|ref|ZP_05451260.1| NAD synthetase [Brucella neotomae 5K33]
          Length = 550

 Score =  518 bits (1335), Expect = e-145,   Method: Composition-based stats.
 Identities = 302/555 (54%), Positives = 387/555 (69%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G +IA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEVIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G     + FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGQVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ ++ENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLIENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|110633816|ref|YP_674024.1| NAD synthetase [Mesorhizobium sp. BNC1]
 gi|110284800|gb|ABG62859.1| NH(3)-dependent NAD(+) synthetase [Chelativorans sp. BNC1]
          Length = 572

 Score =  518 bits (1333), Expect = e-144,   Method: Composition-based stats.
 Identities = 305/562 (54%), Positives = 398/562 (70%), Gaps = 6/562 (1%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
              +IA+AQLNP VGDI GN+AKAR AR +A R+G DL+LFTELFI+GYPPEDLV K +F
Sbjct: 10  DIFRIAVAQLNPTVGDIPGNLAKAREARADAARKGADLVLFTELFIAGYPPEDLVLKPAF 69

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           + AC  A+  L ++T DGG G+++G P + + GV N+VV+LD G +IA R K++LPNY E
Sbjct: 70  VAACEKAVLELAAETADGGPGVIIGTPLKRESGVHNAVVVLDDGKVIAERYKLDLPNYGE 129

Query: 123 FHEKRTFISGYS-NDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           F EKR F +  S   P+ FR +R+GI ICEDIW   ++C+ L + GAE L   N SPYY 
Sbjct: 130 FDEKRVFDAAPSMPGPVNFRGVRIGIPICEDIWGKLDVCETLAESGAEILLVPNGSPYYR 189

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K++ R ++V  Q+    LPI+Y N +GGQDEL+FDGASF     + LAFQM  F E   
Sbjct: 190 GKVEVRQQVVIVQVIESGLPIVYANMLGGQDELVFDGASFAIQADKSLAFQMSQFEEAVA 249

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPL----QEEEADYNACVLSLRDYVQKNNFHKVII 297
           +T W   +  +      DD       P+    ++EEADY AC+L LRDYV KN F  V++
Sbjct: 250 VTTWRRGRDAAGAQRGKDDEWVCAEGPMAIIPEKEEADYRACMLGLRDYVNKNGFKNVVL 309

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGG+DSALCAA+AVDALG+E V+ +MLPY+YTS +SL DA ACA+ALGC+YD++PI++
Sbjct: 310 GLSGGVDSALCAALAVDALGEERVRAVMLPYRYTSKESLRDAEACARALGCRYDIVPINE 369

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
            V  F + + Q  +    GI  EN+QSR RG +LMA+SN   +M++TT NKSE+SVGY T
Sbjct: 370 PVEGFRNALGQLFEGTEEGITEENLQSRARGTLLMAISNKFGSMVVTTGNKSEMSVGYAT 429

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGFNP+KDLYK QV+ L  WRN+H   + LGP  EVIP SI++K+PSAELR +Q
Sbjct: 430 LYGDMNGGFNPIKDLYKMQVYALCRWRNAHVPPTALGPSGEVIPASIIDKAPSAELRENQ 489

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           TDQ+SLPPY +LDDI++ +VENE        + ++ + V  +EHLLY +EYKRRQA  G 
Sbjct: 490 TDQDSLPPYAVLDDILECLVENELGVDEIVARGHDRDLVHRIEHLLYVAEYKRRQAAPGV 549

Query: 537 KITAKSFGRDRLYPISNKFRDH 558
           KIT K+FGRDR YPI+NKFRD 
Sbjct: 550 KITKKNFGRDRRYPITNKFRDR 571


>gi|240850328|ref|YP_002971721.1| NH3-dependent NAD synthetase [Bartonella grahamii as4aup]
 gi|240267451|gb|ACS51039.1| NH3-dependent NAD synthetase [Bartonella grahamii as4aup]
          Length = 558

 Score =  517 bits (1332), Expect = e-144,   Method: Composition-based stats.
 Identities = 295/559 (52%), Positives = 385/559 (68%), Gaps = 8/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    +++IAQLNP+VGDI GN + A  A ++A  +G DL+LFTELFIS YPPEDLV K 
Sbjct: 6   MKNDFRVSIAQLNPIVGDIEGNFSLAAMAHQKAKEEGADLVLFTELFISAYPPEDLVLKP 65

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F + C   +  L   T  GG GIV+G P +    + N V++LD G +IA   K +LPNY
Sbjct: 66  AFTKTCEETVKKLAKITV-GGPGIVIGLPLRRNGNIYNGVMLLDEGRVIAESLKFDLPNY 124

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           +EF EKR F SG   +P+++R + LGI+ICEDIW +S++C  L  +GAE +  LN SPY 
Sbjct: 125 AEFDEKRLFSSGPRPEPLIYRGVGLGIVICEDIWNDSSLCAELGNKGAEIILVLNGSPYD 184

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK  KR ++V  Q     +PIIY NQVGGQDEL+FDG SF  +G+ +  FQMKHF    
Sbjct: 185 RNKTLKRIDVVHTQALRSGVPIIYANQVGGQDELVFDGGSFALNGEGKKIFQMKHFDSHI 244

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            ++ W   +  + W+ +S  + S     L    ADY ACVL LRDYV KN F  VI+GLS
Sbjct: 245 ALSHW--QKITTGWHCISGPNESL----LNGLAADYQACVLGLRDYVNKNRFKDVILGLS 298

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSALCAA+AVDALG E V+TIM+PY YTS +SL+DA  CA+ LGC Y+++PI   V 
Sbjct: 299 GGVDSALCAAMAVDALGSERVRTIMMPYHYTSQESLKDAKECAQLLGCHYEIIPIEQPVE 358

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + M+      PS +  EN+QSR+RG ILMALSN   +M++TT NKSE++VGY TLYG
Sbjct: 359 AFLNAMAPVFLGLPSDVTEENLQSRVRGTILMALSNKFGSMVVTTGNKSEMAVGYATLYG 418

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNPLKD+YK QV+ LA WRN + + +  GP   VIP +I+EK+PSAELR +Q D+
Sbjct: 419 DMNGGFNPLKDIYKMQVYALAEWRNKNHLHNLKGPEGIVIPSNIIEKAPSAELRENQKDE 478

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPYPILDDI++ ++EN+ S  +   + Y+ ETV  VE LLYG+EYKRRQ+  G KI+
Sbjct: 479 DSLPPYPILDDILQSLIENDMSICDIIKRGYSRETVEKVEQLLYGAEYKRRQSAPGVKIS 538

Query: 540 AKSFGRDRLYPISNKFRDH 558
            K+FGRDR YPI N FRD 
Sbjct: 539 YKNFGRDRRYPIVNHFRDK 557


>gi|49474273|ref|YP_032315.1| NAD synthetase [Bartonella quintana str. Toulouse]
 gi|49239777|emb|CAF26167.1| NH3-dependent NAD synthetase [Bartonella quintana str. Toulouse]
          Length = 558

 Score =  517 bits (1332), Expect = e-144,   Method: Composition-based stats.
 Identities = 292/559 (52%), Positives = 381/559 (68%), Gaps = 8/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    ++A+AQLNPVVGDI GN + A  A ++A  +G DL+LFTELFIS YPPEDLV K 
Sbjct: 6   MKNDFRVAVAQLNPVVGDIEGNFSLAVMAYQKAREEGADLVLFTELFISAYPPEDLVLKP 65

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +FI+ C  A+  L   T  GG GIV+G P +  + + N V++LD G II+   K +LPNY
Sbjct: 66  AFIKTCEGAVKELAKLT-TGGPGIVIGLPLRYNDKIFNGVMLLDEGRIISESLKFDLPNY 124

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           +EF E+R F SG   +PIV+  IRLGI+ICEDIW + + C  L+ +GAE +  LN SPY+
Sbjct: 125 AEFDERRLFSSGPRPEPIVYHGIRLGIVICEDIWNDFSFCAELRNKGAEIILVLNGSPYH 184

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK  KR E+V  Q     LPIIY NQVGGQDEL+FDG SF  +GQ ++ FQMKHF    
Sbjct: 185 RNKTLKRIEVVRAQALQSGLPIIYANQVGGQDELVFDGGSFALNGQGKMVFQMKHFESHI 244

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            ++ W   ++++ W  +S  + +          ADY ACVL L DYV KN F  VI+GLS
Sbjct: 245 ALSHW--QKKMTGWQCISGPNENL----FNGLAADYQACVLGLGDYVNKNGFKDVILGLS 298

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSALC A+AVDALG + V+T+M+PY YTS +SL+DA  CA  LGC Y ++PI   V 
Sbjct: 299 GGIDSALCTAMAVDALGAKRVRTVMMPYHYTSQESLKDAKECAHLLGCDYQIIPIIKPVE 358

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F S ++         +  EN+QSR+RG +LMALSN   +M++TT NKSE++VGY TLYG
Sbjct: 359 VFLSTLAPVFLGLTPDVTEENLQSRVRGTLLMALSNKFGSMVVTTGNKSEMAVGYATLYG 418

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNPLKD+YKTQV+ LA WRN + + +  G    VIPP+I+ K+PSAEL  +Q D+
Sbjct: 419 DMNGGFNPLKDIYKTQVYALAEWRNKNHLQNWEGSEGVVIPPNIIAKAPSAELSENQKDE 478

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPYPILDDI++ ++EN+ S  +   + Y  ETV  +EHLLY +EYKRRQ+  G KI+
Sbjct: 479 DSLPPYPILDDILQSLIENDMSVCDIVKRGYLRETVEKIEHLLYVAEYKRRQSAPGVKIS 538

Query: 540 AKSFGRDRLYPISNKFRDH 558
            K+FGRDR YPI N FRD 
Sbjct: 539 YKNFGRDRRYPIVNHFRDK 557


>gi|319404346|emb|CBI77943.1| NH3-dependent NAD synthetase [Bartonella rochalimae ATCC BAA-1498]
          Length = 558

 Score =  517 bits (1331), Expect = e-144,   Method: Composition-based stats.
 Identities = 295/564 (52%), Positives = 389/564 (68%), Gaps = 13/564 (2%)

Query: 1   MLKKL-----KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPED 55
           M +KL     +I IAQLNP++GDI GN + A+ A ++A  Q  DL+L TELFIS YPPED
Sbjct: 1   MTQKLIKDDLRIVIAQLNPIIGDIKGNFSLAKMAYQKAYEQNADLVLLTELFISAYPPED 60

Query: 56  LVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKI 115
           LV K SF +AC  A+  L   T + G GI++G P +    + N +++LD G +I  R K 
Sbjct: 61  LVLKSSFTKACEDAVRKLAQLTKE-GPGIIIGVPLKRDNSLYNGIMLLDDGQVITERFKC 119

Query: 116 NLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLN 175
           +LPNY EF EKR F SG   +PIV+R I LG++ICEDIW + +IC  L  +GAE +   N
Sbjct: 120 DLPNYCEFDEKRVFSSGPRPEPIVYRGITLGVVICEDIWNDPSICAELSHKGAEIILVSN 179

Query: 176 ASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKH 235
            SPYY NK++KR EIV  Q     +PIIY NQVGGQDEL+FDG SF  D   Q+ FQMKH
Sbjct: 180 GSPYYRNKMQKRLEIVRAQAIQSCVPIIYANQVGGQDELVFDGGSFALDEHGQIVFQMKH 239

Query: 236 FSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKV 295
           F  Q  ++ W   ++  +W  +S  +       L    ADY+ACVL L+DYV KN F  V
Sbjct: 240 FESQIALSHW--QRKSIRWQCISGPNEEL----LDGIAADYHACVLGLKDYVNKNRFKDV 293

Query: 296 IIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPI 355
           ++G SGGIDSALCAAIAVDALG E V  +M+PY YTS +SL+DA  CA  LGC+Y+++PI
Sbjct: 294 LLGFSGGIDSALCAAIAVDALGAERVHAVMMPYYYTSQESLKDAKDCAHLLGCRYEIIPI 353

Query: 356 HDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGY 415
             LV  F S+M+       + +  EN+QSR+RG+ILMALSN   +M++TT NKSE++VGY
Sbjct: 354 FKLVESFLSIMAPIFSGLKADVTEENLQSRVRGSILMALSNKFDSMVITTGNKSEMAVGY 413

Query: 416 GTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRP 475
            TLYGDM+GGFNP+KD+YKTQV++LA WRN + + + LGP   VIP +I  K+PSAELR 
Sbjct: 414 ATLYGDMNGGFNPIKDIYKTQVYKLAEWRNKNYLQNLLGPKGIVIPSNITTKAPSAELRD 473

Query: 476 HQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPV 534
           +Q D++SLPPYP+LDDI++ +VE++ S  +   + ++ +TV  VEHLLY +EYKRRQ+  
Sbjct: 474 NQKDEDSLPPYPVLDDILQFLVEDDMSVCDILKRGHSRQTVEKVEHLLYLAEYKRRQSAP 533

Query: 535 GTKITAKSFGRDRLYPISNKFRDH 558
           G KI+ K+FGRDR YPI+N FRD 
Sbjct: 534 GVKISYKNFGRDRRYPITNYFRDK 557


>gi|189024180|ref|YP_001934948.1| NAD synthetase [Brucella abortus S19]
 gi|237815439|ref|ZP_04594437.1| NAD+ synthetase [Brucella abortus str. 2308 A]
 gi|260545314|ref|ZP_05821055.1| NAD+ synthetase [Brucella abortus NCTC 8038]
 gi|260754749|ref|ZP_05867097.1| NAD+ synthetase [Brucella abortus bv. 6 str. 870]
 gi|260757972|ref|ZP_05870320.1| NAD+ synthetase [Brucella abortus bv. 4 str. 292]
 gi|260761795|ref|ZP_05874138.1| NAD+ synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883770|ref|ZP_05895384.1| NAD+ synthetase [Brucella abortus bv. 9 str. C68]
 gi|297248338|ref|ZP_06932056.1| NAD+ synthase [Brucella abortus bv. 5 str. B3196]
 gi|189019752|gb|ACD72474.1| NAD(+) synthase [Brucella abortus S19]
 gi|237790276|gb|EEP64486.1| NAD+ synthetase [Brucella abortus str. 2308 A]
 gi|260096721|gb|EEW80596.1| NAD+ synthetase [Brucella abortus NCTC 8038]
 gi|260668290|gb|EEX55230.1| NAD+ synthetase [Brucella abortus bv. 4 str. 292]
 gi|260672227|gb|EEX59048.1| NAD+ synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674857|gb|EEX61678.1| NAD+ synthetase [Brucella abortus bv. 6 str. 870]
 gi|260873298|gb|EEX80367.1| NAD+ synthetase [Brucella abortus bv. 9 str. C68]
 gi|297175507|gb|EFH34854.1| NAD+ synthase [Brucella abortus bv. 5 str. B3196]
          Length = 559

 Score =  517 bits (1331), Expect = e-144,   Method: Composition-based stats.
 Identities = 304/555 (54%), Positives = 388/555 (69%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 11  LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 71  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 131 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQD+L+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 191 DRRHQVVLKQVIETGLPIVYANQVGGQDDLVFDGGSFVFNADKSLCLQMPQFAEQIALTE 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 251 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 305 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 425 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|319405818|emb|CBI79448.1| NH3-dependent NAD synthetase [Bartonella sp. AR 15-3]
          Length = 558

 Score =  516 bits (1330), Expect = e-144,   Method: Composition-based stats.
 Identities = 286/558 (51%), Positives = 381/558 (68%), Gaps = 8/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
              L+I IAQLNP++GDI GN+A A    ++A  Q  DL+L TELFIS YPPEDLV K +
Sbjct: 7   KDNLRIVIAQLNPIIGDIEGNLALAEMTYQKAYEQDADLVLLTELFISAYPPEDLVLKYA 66

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F +AC  A+  L   T + G GI++G P +    + N +++LD G +IA R K +LPNY 
Sbjct: 67  FTKACEDAVKKLAQLTKE-GPGIIIGIPLKRDNDLYNGIMLLDDGQVIAERFKCDLPNYC 125

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
           EF EKR F  G   +P+V+R + LG++ICEDIW + +IC  L  +GAE +   N SPY  
Sbjct: 126 EFDEKRVFSPGPRPEPVVYRGMTLGVVICEDIWNDPSICAELSHKGAEIILVPNGSPYQR 185

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
           NK +KR +IV  Q    ++PIIY NQVGGQDEL+FDG SF  D   Q+ FQMKHF     
Sbjct: 186 NKTQKRLDIVRAQAVQSYVPIIYANQVGGQDELVFDGGSFAVDEHGQIVFQMKHFENHIS 245

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           ++ W   ++   W  +S  +       L    ADY+ACVL L+DYV KN F  V++G SG
Sbjct: 246 LSHW--QRKSIGWQCISGPNEEL----LDGIAADYHACVLGLKDYVNKNRFKDVLLGFSG 299

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSALCAAIAVDALG E V+ +M+PY YTS +SL+DA  CA  LGC+Y+V+PI   V  
Sbjct: 300 GIDSALCAAIAVDALGAERVRAVMMPYCYTSQESLKDAKHCAHLLGCRYEVIPIFKPVES 359

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F S+M+       + +  EN+QSRIRG++LMALSN   +M++TT NKSE++VGY TLYGD
Sbjct: 360 FLSIMAPIFAGLQTDVTEENLQSRIRGSVLMALSNKFDSMVITTGNKSEMAVGYATLYGD 419

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGFNP+KD+YK QV++LA WRN + + + LGP   +IP +I+EK+PSAELR +Q D++
Sbjct: 420 MNGGFNPIKDIYKMQVYKLAEWRNKNYLQNLLGPKGIIIPSNIIEKAPSAELRENQKDED 479

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
            LPPYPILDDI++ +VE++ S  +   + +  +TV  VEHLLY +EYKRRQ+  G KI+ 
Sbjct: 480 FLPPYPILDDILQSLVEDDMSVCDIVKRGHLRQTVEKVEHLLYLAEYKRRQSAPGVKISY 539

Query: 541 KSFGRDRLYPISNKFRDH 558
           K+FGRDR YPI+N FRD 
Sbjct: 540 KNFGRDRRYPITNHFRDK 557


>gi|17987252|ref|NP_539886.1| NAD synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|225852520|ref|YP_002732753.1| NAD synthetase [Brucella melitensis ATCC 23457]
 gi|260564019|ref|ZP_05834505.1| NAD+ synthase [Brucella melitensis bv. 1 str. 16M]
 gi|265991097|ref|ZP_06103654.1| NAD+ synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265999470|ref|ZP_05466523.2| NAD(+) synthase [Brucella melitensis bv. 2 str. 63/9]
 gi|17982927|gb|AAL52150.1| glutamine-dependent nad(+) synthetase [Brucella melitensis bv. 1
           str. 16M]
 gi|225640885|gb|ACO00799.1| NAD+ synthetase [Brucella melitensis ATCC 23457]
 gi|260154035|gb|EEW89127.1| NAD+ synthase [Brucella melitensis bv. 1 str. 16M]
 gi|263001881|gb|EEZ14456.1| NAD+ synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094135|gb|EEZ18057.1| NAD(+) synthase [Brucella melitensis bv. 2 str. 63/9]
 gi|326538745|gb|ADZ86960.1| NAD+ synthetase [Brucella melitensis M5-90]
          Length = 559

 Score =  516 bits (1330), Expect = e-144,   Method: Composition-based stats.
 Identities = 305/555 (54%), Positives = 388/555 (69%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 11  LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 71  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 131 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 191 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 251 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 305 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 425 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|62289938|ref|YP_221731.1| NAD synthetase [Brucella abortus bv. 1 str. 9-941]
 gi|82699865|ref|YP_414439.1| NAD synthetase [Brucella melitensis biovar Abortus 2308]
 gi|254689244|ref|ZP_05152498.1| NAD synthetase [Brucella abortus bv. 6 str. 870]
 gi|254697379|ref|ZP_05159207.1| NAD synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730277|ref|ZP_05188855.1| NAD synthetase [Brucella abortus bv. 4 str. 292]
 gi|256257494|ref|ZP_05463030.1| NAD synthetase [Brucella abortus bv. 9 str. C68]
 gi|62196070|gb|AAX74370.1| NadE, NH(3)-dependent NAD+ synthetase [Brucella abortus bv. 1 str.
           9-941]
 gi|82615966|emb|CAJ10989.1| Nitrilase/cyanide hydratase and apolipoprotein
           N-acyltransferase:NAD+ synthase [Brucella melitensis
           biovar Abortus 2308]
          Length = 550

 Score =  516 bits (1330), Expect = e-144,   Method: Composition-based stats.
 Identities = 304/555 (54%), Positives = 388/555 (69%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQD+L+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDDLVFDGGSFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|256044673|ref|ZP_05447577.1| NAD synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|326409035|gb|ADZ66100.1| NAD synthetase [Brucella melitensis M28]
          Length = 550

 Score =  516 bits (1329), Expect = e-144,   Method: Composition-based stats.
 Identities = 305/555 (54%), Positives = 388/555 (69%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|15888965|ref|NP_354646.1| NAD synthetase [Agrobacterium tumefaciens str. C58]
 gi|15156746|gb|AAK87431.1| NAD (+) synthetase [Agrobacterium tumefaciens str. C58]
          Length = 559

 Score =  516 bits (1328), Expect = e-144,   Method: Composition-based stats.
 Identities = 311/565 (55%), Positives = 403/565 (71%), Gaps = 13/565 (2%)

Query: 1   MLKK------LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPE 54
           M  +      L+IA+ Q NP VGD+AGN+A+AR AR +A  QG DL+L TELFISGYPPE
Sbjct: 1   MSDRHDIQNHLRIAVGQFNPTVGDVAGNLARAREARADAATQGADLLLLTELFISGYPPE 60

Query: 55  DLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDK 114
           DLV K +F++AC  A++ L ++T DGG G+V+GFPRQ + G  NSV +LD G IIA+RDK
Sbjct: 61  DLVLKPAFLKACLKAVEELAAETADGGPGVVIGFPRQGETGRHNSVALLDGGKIIALRDK 120

Query: 115 INLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSL 174
           I+LPNY EF EKR F  G  + P  FR +R+GI ICE+IW +  +C+ L + GAE L   
Sbjct: 121 IDLPNYGEFDEKRVFEEGSISGPYNFRGVRIGIPICEEIWNDMGVCETLAESGAEILLVP 180

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           N SPYY  KL  RH++   Q+    LP+++ NQ+GGQDEL+FDGASF F+  + LAFQM 
Sbjct: 181 NGSPYYRGKLDVRHQVALRQVIESGLPLVFANQLGGQDELVFDGASFGFNADKTLAFQMS 240

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHK 294
            F     +T+W   +    W+  S   +       + EEADY AC+L  RDYV KN F  
Sbjct: 241 QFEATLAVTDW--KRTADGWHCDSGPFSKIP----EGEEADYRACMLGFRDYVNKNGFKS 294

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
           V++GLSGGIDSA+CAA+AVDALG+E V+ IMLPY+YTS +SL+DAA CA+ALGC+YD++P
Sbjct: 295 VVLGLSGGIDSAICAALAVDALGEERVRCIMLPYRYTSEESLKDAADCARALGCRYDIVP 354

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I + V  F S +S+  +    GI  EN+QSR RG ILMA+SN   +M++TT NKSE+SVG
Sbjct: 355 IVEPVEGFLSALSELFEGTEEGITEENLQSRTRGTILMAVSNKFGSMVVTTGNKSEMSVG 414

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
           Y TLYGDM+GGFNP+KDLYK QV+ ++SWRN+H     LGP  EVIP +I+ K+PSAELR
Sbjct: 415 YATLYGDMNGGFNPIKDLYKMQVYAISSWRNAHVPPGALGPSGEVIPANIIAKAPSAELR 474

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAP 533
           P+QTDQ+SLPPYP+LDDI++ +VE E S      + ++  TV  VEHLLY +EYKRRQ+ 
Sbjct: 475 PNQTDQDSLPPYPVLDDILECLVEKEMSVEEILARGHDVATVHRVEHLLYLAEYKRRQSA 534

Query: 534 VGTKITAKSFGRDRLYPISNKFRDH 558
            G KIT K+FGRDR YPI+N+FRD 
Sbjct: 535 PGVKITKKNFGRDRRYPITNRFRDR 559


>gi|261214001|ref|ZP_05928282.1| NAD+ synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|260915608|gb|EEX82469.1| NAD+ synthetase [Brucella abortus bv. 3 str. Tulya]
          Length = 559

 Score =  516 bits (1328), Expect = e-144,   Method: Composition-based stats.
 Identities = 305/555 (54%), Positives = 389/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 11  LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 71  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 131 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM+ F+EQ  +TE
Sbjct: 191 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMQQFAEQIALTE 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 251 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 305 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 425 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|265994934|ref|ZP_06107491.1| NAD+ synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|262766047|gb|EEZ11836.1| NAD+ synthetase [Brucella melitensis bv. 3 str. Ether]
          Length = 559

 Score =  516 bits (1328), Expect = e-144,   Method: Composition-based stats.
 Identities = 305/555 (54%), Positives = 388/555 (69%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 11  LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 70

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 71  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 130

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 131 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 190

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 191 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 250

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 251 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 304

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 305 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 364

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 365 ALQPLFSGTDSGVTEENLQSRARGAILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 424

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 425 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 484

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 485 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITKKNF 544

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 545 GRDRRYPITNRFRDR 559


>gi|270308329|ref|YP_003330387.1| glutamine-dependent NAD(+) synthetase [Dehalococcoides sp. VS]
 gi|270154221|gb|ACZ62059.1| glutamine-dependent NAD(+) synthetase [Dehalococcoides sp. VS]
          Length = 566

 Score =  516 bits (1328), Expect = e-144,   Method: Composition-based stats.
 Identities = 225/572 (39%), Positives = 325/572 (56%), Gaps = 28/572 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + KL++A+AQ++ VVGD+AGN A      ++A   G D+I F EL I GYPPEDL+ K  
Sbjct: 1   MGKLRLAMAQIDSVVGDLAGNTACIVGNIQKARSLGADVIAFPELAICGYPPEDLLHKPR 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++    A+DT+   +   G  ++VG+       + NS  ++  G +I    KI LPNY 
Sbjct: 61  FVEENLHALDTVIKASQ--GITVIVGYVNSSDG-LHNSAAVIHNGCLIDSYHKIFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F+ G          +++G+ ICEDIW  S        +GAE + +++ASPY+ 
Sbjct: 118 VFDENRYFMPGNRCPVYTICGLQVGVNICEDIWFTSGPSTAQASKGAELIINISASPYHL 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K  +R ++++ +     + I Y N VGGQDEL+FDGAS  FD    L  + K F E   
Sbjct: 178 GKRNQREKMLSNRARENRVYIAYTNMVGGQDELVFDGASNIFDYNGNLVLRGKQFQEDLL 237

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMY-----------------IPLQEEEADYNACVLSLR 284
           + +        Q +  ++   S                    +PL  +   Y A +L  +
Sbjct: 238 VLDLDIPISPVQRDMNTEIPDSIFVSASGLSEPKLPVENSDSVPLDADAEVYQALLLGTK 297

Query: 285 DYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAK 344
           DY+ KN F KV+IGLSGGIDS+L AAIA DALG +NV  +++P +Y+S  S+ D+   A+
Sbjct: 298 DYINKNGFKKVVIGLSGGIDSSLVAAIATDALGSDNVVGVIMPSRYSSAGSISDSLRLAE 357

Query: 345 ALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLT 404
            L  K   +PI  +   F S +S+      +    ENIQ+RIRGN+LMALSN    ++L 
Sbjct: 358 NLRIKTLQIPIDPIFKSFLSTLSEVFAGTETDTTEENIQARIRGNLLMALSNKFHWLVLN 417

Query: 405 TSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSI 464
           TSNKSE ++GY TLYGDM+GGF  +KD+ K  V++LA  RN            E+IP ++
Sbjct: 418 TSNKSETAIGYSTLYGDMAGGFAIIKDVPKVLVYRLAHNRNKSAGF-------ELIPHNV 470

Query: 465 LEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLY 523
           L K PSAEL+P+Q D +SLPPY +LD I++  VE ++S        + +  V+ V  ++ 
Sbjct: 471 LTKPPSAELKPNQFDTDSLPPYEVLDPILEAYVEQDKSIDQIVALGFEESIVKRVVKMVD 530

Query: 524 GSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
            SEYKRRQAP G KIT K+FGRDR  PI+N++
Sbjct: 531 RSEYKRRQAPPGIKITPKAFGRDRRLPITNRY 562


>gi|256113567|ref|ZP_05454387.1| NAD synthetase [Brucella melitensis bv. 3 str. Ether]
          Length = 550

 Score =  515 bits (1327), Expect = e-144,   Method: Composition-based stats.
 Identities = 305/555 (54%), Positives = 388/555 (69%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGAILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|254693729|ref|ZP_05155557.1| NAD synthetase [Brucella abortus bv. 3 str. Tulya]
          Length = 550

 Score =  515 bits (1327), Expect = e-144,   Method: Composition-based stats.
 Identities = 305/555 (54%), Positives = 389/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM+ F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMQQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSTPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRRYPITNRFRDR 550


>gi|187478133|ref|YP_786157.1| NAD synthetase [Bordetella avium 197N]
 gi|115422719|emb|CAJ49246.1| glutamine-dependent NAD synthetase [Bordetella avium 197N]
          Length = 542

 Score =  515 bits (1327), Expect = e-144,   Method: Composition-based stats.
 Identities = 226/558 (40%), Positives = 331/558 (59%), Gaps = 20/558 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  +++ IAQ+N  VGD+AGN A+  +A  EA  +G D++L  EL ++GYPPEDL+ +  
Sbjct: 1   MSVVRVGIAQINACVGDLAGNAARVLKAAREAYGRGADILLTPELVLTGYPPEDLLLRPL 60

Query: 62  FIQACSSAIDTLKSDTHDG-GAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           FI+   + +  L +D     G  ++VG   + +  + N+  +L  G ++    K  LPNY
Sbjct: 61  FIERQQAVLAQLAADLAGLPGLHVLVGHVERREGHLYNAASVLCEGRVLGSYRKRELPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F E+R F+S         + +R+G+ ICEDIW +          GA+ L   NASPY 
Sbjct: 121 SVFDEQRYFLSDTQPLVFEVKGVRVGVNICEDIWFDRAPQ-AAADAGAQVLLVPNASPYN 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R  +    ++     ++Y N VGGQDEL+FDGASF  D + +L+ ++  F+E  
Sbjct: 180 LGKPTERLTVARRVVAATGCSLVYANLVGGQDELVFDGASFALDREGRLSARLPDFAEGL 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + +             +  +++ +   L EEE  +NA VL  RDY+ KN F   IIGLS
Sbjct: 240 SLVDVDA--------RGAVGASAVVAPSLSEEEQVWNALVLGTRDYLGKNRFPGAIIGLS 291

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+  AIAVDA+G +NV+ +M+P +YT+  SL DA   A+ LG +YD + I  +V+
Sbjct: 292 GGIDSAVVLAIAVDAVGADNVRAVMMPSRYTADISLTDARDMAQRLGVRYDEIVIGPIVD 351

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + ++      P     ENIQ+R RG +LMALSN +  ++LTT NKSE+S GY TLYG
Sbjct: 352 AFETALAPQFAGLPVDATEENIQARARGTLLMALSNKTGQLVLTTGNKSEMSTGYCTLYG 411

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  +KD+ KT V++LA WRN+          +++IP  I+ + PSAELRP QTDQ
Sbjct: 412 DMAGGFAVIKDVPKTLVYRLAVWRNTK---------SDIIPERIITRPPSAELRPDQTDQ 462

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LD I+ R +E   S  +   + Y    V  V  L+  +EYKRRQAP G ++T
Sbjct: 463 DSLPSYDVLDGIVLRHMEQNASAADLLAEGYPPAAVEQVLRLIRINEYKRRQAPPGPRVT 522

Query: 540 AKSFGRDRLYPISNKFRD 557
           A++FGRD  YP++N FRD
Sbjct: 523 ARAFGRDWRYPVTNGFRD 540


>gi|239831980|ref|ZP_04680309.1| NAD+ synthetase [Ochrobactrum intermedium LMG 3301]
 gi|239824247|gb|EEQ95815.1| NAD+ synthetase [Ochrobactrum intermedium LMG 3301]
          Length = 561

 Score =  515 bits (1326), Expect = e-144,   Method: Composition-based stats.
 Identities = 308/555 (55%), Positives = 394/555 (70%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNPV+GDIAGN+AKAR AR EA R   DLILFTELFISGYPPEDLV K SF+ 
Sbjct: 13  LRIAVAQLNPVMGDIAGNLAKARAARAEAARMQADLILFTELFISGYPPEDLVLKPSFLA 72

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P   + G+ NS+ +LD G +IA R K++LPNY EF 
Sbjct: 73  ACEKAVRDLANDTADGGPGVIIGTPLSRESGLHNSIAVLDGGEVIAERFKVDLPNYGEFD 132

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F SG    P+ FR +R+GI ICEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 133 EKRVFQSGPMPGPVNFRGVRIGIPICEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 192

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LP++Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +T 
Sbjct: 193 DRRHQVVLKQVIETELPMVYANQVGGQDELVFDGGSFAFNADRSLCLQMPQFAEQIVLTV 252

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           WH  +    W     + A       +  EADY+AC+L LRDYV KN F  V++GLSGGID
Sbjct: 253 WH--RNNDGWRCEEGEKADLP----EGLEADYSACMLGLRDYVNKNGFKDVVLGLSGGID 306

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ IMLPY+YTS +SL+DAA CAKALG +YD++PI   V  F  
Sbjct: 307 SAICAALGVDALGKDRVRCIMLPYRYTSDESLKDAADCAKALGVRYDIVPIAAPVEGFLE 366

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 367 ALYPLFSGTESGVTEENLQSRARGTILMAVSNKFGSMVVTTGNKSEMSVGYATLYGDMNG 426

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ ++ WRN+H  T  LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 427 GFNPIKDVYKMQVYAMSEWRNNHVPTGALGPSGEVIPQNIISKAPSAELRENQTDQDSLP 486

Query: 485 PYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S        ++ ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 487 PYPVLDDILECLVENEMSNTEIAARGHSLETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 546

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 547 GRDRRYPITNRFRDR 561


>gi|148560440|ref|YP_001258955.1| NAD synthetase [Brucella ovis ATCC 25840]
 gi|148371697|gb|ABQ61676.1| NH(3)-dependent NAD+ synthetase [Brucella ovis ATCC 25840]
          Length = 550

 Score =  514 bits (1325), Expect = e-143,   Method: Composition-based stats.
 Identities = 305/555 (54%), Positives = 388/555 (69%), Gaps = 7/555 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQLNP +GDIAGN+AKAR AR EA R   DLILFTELFISGYPPED+V K +F+ 
Sbjct: 2   LRIAVAQLNPTMGDIAGNLAKARTARAEAARMQADLILFTELFISGYPPEDMVLKPAFVA 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L +DT DGG G+++G P     G  N+V +LD G IIA R K++LPNY EF 
Sbjct: 62  ACEKAVRMLAADTADGGPGVIIGTPLHRDSGSHNAVAVLDGGEIIAERFKVDLPNYGEFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G    P+ FR +RLGI +CEDIW    + + L + GAE L   N SPY+  K+
Sbjct: 122 EKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGELGVAETLAESGAEILLVPNGSPYHRAKM 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RH++V  Q+    LPI+Y NQVGGQDEL+FDG SF F+  + L  QM  F+EQ  +TE
Sbjct: 182 DRRHQVVLKQVIETGLPIVYANQVGGQDELVFDGGSFVFNADKSLCLQMPQFAEQIALTE 241

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W  D     W     + AS      +   ADY AC+L LRDYV KN F  V++GLSGGID
Sbjct: 242 WQRDGD--GWRCRDGEKASLP----EGLAADYAACMLGLRDYVNKNGFKDVVLGLSGGID 295

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+CAA+ VDALGK+ V+ +MLPY+YTS +SL DAA CAKALG +YD++PI + V  F +
Sbjct: 296 SAICAALGVDALGKDRVRCVMLPYRYTSEESLADAADCAKALGVRYDIVPIAEPVEGFMN 355

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        SG+  EN+QSR RG ILMA+SN   +M++TT NKSE+SVGY TLYGDM+G
Sbjct: 356 ALQPLFSGTDSGVTEENLQSRARGTILMAISNKFGSMVVTTGNKSEMSVGYATLYGDMNG 415

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KD+YK QV+ L+ WRN +     LGP  EVIP +I+ K+PSAELR +QTDQ+SLP
Sbjct: 416 GFNPIKDVYKMQVYALSQWRNQNLPQGALGPAGEVIPQNIISKAPSAELRENQTDQDSLP 475

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PYP+LDDI++ +VENE S      + +  ETV+ +EHLLY +EYKRRQ+  G KIT K+F
Sbjct: 476 PYPVLDDILECLVENEMSNAEIVARGHALETVQRIEHLLYLAEYKRRQSAPGVKITKKNF 535

Query: 544 GRDRLYPISNKFRDH 558
           GRDR YPI+N+FRD 
Sbjct: 536 GRDRHYPITNRFRDR 550


>gi|57234088|ref|YP_181837.1| glutamine-dependent NAD(+) synthetase [Dehalococcoides ethenogenes
           195]
 gi|57224536|gb|AAW39593.1| glutamine-dependent NAD(+) synthetase [Dehalococcoides ethenogenes
           195]
          Length = 566

 Score =  514 bits (1325), Expect = e-143,   Method: Composition-based stats.
 Identities = 227/572 (39%), Positives = 328/572 (57%), Gaps = 28/572 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + KL++A+AQ++ VVGD+AGN A   R  +EA   G D+I+F EL I GYPPEDL+ K  
Sbjct: 1   MGKLRLAMAQIDSVVGDLAGNTACIIRHIQEARSLGADVIVFPELAICGYPPEDLLHKPR 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++    ++D++   +   G  ++VG+       + NS  I+   ++I    KI LPNY 
Sbjct: 61  FVEGNLHSLDSVIKASE--GITVIVGYVDSHNG-LHNSAAIIHNASLIDSYHKIFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F+ G          +R+G+ ICEDIW  S        +GAE + +++ASPY+ 
Sbjct: 118 VFDENRYFLPGNRCPVYTICGLRVGVNICEDIWFASGPSTAQSNKGAELIINISASPYHF 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K  +R ++++ +     + I Y N VGGQDEL+FDGAS  FD    L  + K F E   
Sbjct: 178 GKRNQREKMLSDRARENRVYIAYTNMVGGQDELVFDGASNVFDYTGNLVLRGKQFQEDLL 237

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMY-----------------IPLQEEEADYNACVLSLR 284
           + +        Q +  ++   S                    +PL  +   Y A +L  +
Sbjct: 238 VLDLDIPALTRQGDMSTEIPDSIFVSASGLSEPKLPFENSDSVPLDADAEVYQALLLGTK 297

Query: 285 DYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAK 344
           DY+ KN F KV+IGLSGGIDS+L AAIA DALG +NV  +++P +Y+S  S+ D+   A+
Sbjct: 298 DYINKNGFKKVVIGLSGGIDSSLVAAIATDALGADNVVGVIMPSRYSSAGSISDSLRLAE 357

Query: 345 ALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLT 404
            LG K   +PI  +   F S +S+      +    ENIQ+RIRGN+LMALSN    ++L 
Sbjct: 358 NLGIKTLQIPIDPIFKSFLSTLSEVFAGTETDTTEENIQARIRGNLLMALSNKFHWLVLN 417

Query: 405 TSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSI 464
           TSNKSE ++GY TLYGDM+GGF  +KD+ K  V++LA  RN            E+IP ++
Sbjct: 418 TSNKSETAIGYSTLYGDMAGGFAIIKDVPKVLVYRLAHNRNKSAGF-------ELIPHNV 470

Query: 465 LEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLY 523
           L K PSAEL+P+Q D +SLPPY +LD I++  VE ++S        + +  V+ V  ++ 
Sbjct: 471 LTKPPSAELKPNQLDTDSLPPYELLDPILEAYVEQDKSIDQIVALGFEESIVKRVVKMVD 530

Query: 524 GSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
            SEYKRRQAP G KIT K+FGRDR  PI+N++
Sbjct: 531 RSEYKRRQAPPGIKITPKAFGRDRRLPITNRY 562


>gi|147669591|ref|YP_001214409.1| NH(3)-dependent NAD(+) synthetase [Dehalococcoides sp. BAV1]
 gi|146270539|gb|ABQ17531.1| NH(3)-dependent NAD(+) synthetase [Dehalococcoides sp. BAV1]
          Length = 566

 Score =  514 bits (1324), Expect = e-143,   Method: Composition-based stats.
 Identities = 223/572 (38%), Positives = 323/572 (56%), Gaps = 28/572 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + KL++A+AQ++ VVGD+AGN A      ++A   G D+I F EL I GYPPEDL+ K  
Sbjct: 1   MGKLRLAMAQIDSVVGDLAGNTACIVSHVQKARSLGADVIAFPELAICGYPPEDLLHKPR 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++    A+D +   +   G  ++VG+       + N+  I+  G++I    KI LPNY 
Sbjct: 61  FVEENLQALDAVIKASQ--GITVIVGYVDSHDG-LRNAAAIIHNGSLIDSYHKIFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F+ G          +++G+ ICEDIW  S        +GAE + +++ASPY+ 
Sbjct: 118 VFDENRYFLPGNRCPVYTICGLQVGVNICEDIWFTSGPSTAQANKGAELIINISASPYHF 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K  +R ++++ +     + I Y N VGGQDEL+FDGAS  FD    L  + K F E   
Sbjct: 178 GKRNQREKMLSDRARENRVYIAYTNMVGGQDELVFDGASDVFDYNGNLLIRGKQFQEDLV 237

Query: 242 MTEWHYDQ-----------------QLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLR 284
           + +                        + +  +     +  + PL+ +   Y A +L  R
Sbjct: 238 VLDLDIPVLPRQADTNANVPDSIFVSSAGFETLKPPIENIAFTPLEADAEVYQALLLGTR 297

Query: 285 DYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAK 344
           DY+ KN F KV+IGLSGGIDS+L A IA DALG ENV  +++P +Y+S  S+ D+   A 
Sbjct: 298 DYINKNGFKKVVIGLSGGIDSSLVATIAADALGPENVVGVIMPSRYSSAGSISDSLHLAG 357

Query: 345 ALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLT 404
            LG K   +PI  L   F + +S       +    ENIQ+RIRGN+LMALSN    ++L 
Sbjct: 358 NLGIKTLQIPIDPLFQSFLNTLSDVFAGTEANTTEENIQARIRGNLLMALSNKFHWLVLN 417

Query: 405 TSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSI 464
           TSNKSE ++GY TLYGDM+GGF  +KD+ K  V++LA  RN            ++IP ++
Sbjct: 418 TSNKSETAIGYSTLYGDMAGGFAIIKDVPKVLVYRLAHNRNRLAGF-------DLIPDNV 470

Query: 465 LEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLY 523
           L K PSAEL+P+Q D +SLPPY +LD I++  VE ++S        +  + V+ V  ++ 
Sbjct: 471 LTKPPSAELKPNQLDTDSLPPYEVLDPILEAYVEQDKSIDQIVALGFAADIVKRVVKMVD 530

Query: 524 GSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
            SEYKRRQAP G KIT K+FGRDR  PI+N++
Sbjct: 531 RSEYKRRQAPPGIKITPKAFGRDRRLPITNRY 562


>gi|289432851|ref|YP_003462724.1| NAD+ synthetase [Dehalococcoides sp. GT]
 gi|288946571|gb|ADC74268.1| NAD+ synthetase [Dehalococcoides sp. GT]
          Length = 566

 Score =  514 bits (1324), Expect = e-143,   Method: Composition-based stats.
 Identities = 223/572 (38%), Positives = 323/572 (56%), Gaps = 28/572 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + KL++A+AQ++ VVGD+AGN A      ++A   G D+I F EL I GYPPEDL+ K  
Sbjct: 1   MGKLRLAMAQIDSVVGDLAGNTACIVSHVQKARSLGADVIAFPELAICGYPPEDLLHKPR 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++    A+D +   +   G  ++VG+       + N+  I+  G++I    KI LPNY 
Sbjct: 61  FVEENLQALDAVIKASQ--GITVIVGYVDSHDG-LRNAAAIIHNGSLIDSYHKIFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F+ G          +++G+ ICEDIW  S        +GAE + +++ASPY+ 
Sbjct: 118 VFDENRYFLPGNRCPVYTICGLQVGVNICEDIWFTSGPSTAQANKGAELIINISASPYHF 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K  +R ++++ +     + I Y N VGGQDEL+FDGAS  FD    L  + K F E   
Sbjct: 178 GKRNQREKMLSDRARENRVYIAYTNMVGGQDELVFDGASDVFDYNGNLLIRGKQFQEDLV 237

Query: 242 MTEWHYDQ-----------------QLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLR 284
           + +                        + +  +     +  + PL+ +   Y A +L  R
Sbjct: 238 VLDLDIPVLPRQADTNANVPDSIFVSSAGFETLKPPIENIAFTPLEADAEVYQALLLGTR 297

Query: 285 DYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAK 344
           DY+ KN F KV+IGLSGGIDS+L A IA DALG ENV  +++P +Y+S  S+ D+   A 
Sbjct: 298 DYINKNGFKKVVIGLSGGIDSSLVATIAADALGPENVVGVIMPSRYSSAGSISDSLHLAG 357

Query: 345 ALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLT 404
            LG K   +PI  L   F + +S       +    ENIQ+RIRGN+LMALSN    ++L 
Sbjct: 358 NLGIKTLQIPIDPLFQSFLNTLSDVFAGTEANTTEENIQARIRGNLLMALSNKFHWLVLN 417

Query: 405 TSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSI 464
           TSNKSE ++GY TLYGDM+GGF  +KD+ K  V++LA  RN            ++IP ++
Sbjct: 418 TSNKSETAIGYSTLYGDMAGGFAIIKDVPKVLVYRLAHNRNKLAGF-------DLIPDNV 470

Query: 465 LEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLY 523
           L K PSAEL+P+Q D +SLPPY +LD I++  VE ++S        +  + V+ V  ++ 
Sbjct: 471 LTKPPSAELKPNQLDTDSLPPYEVLDPILEAYVEQDKSIDQIVALGFAADIVKRVVKMVD 530

Query: 524 GSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
            SEYKRRQAP G KIT K+FGRDR  PI+N++
Sbjct: 531 RSEYKRRQAPPGIKITPKAFGRDRRLPITNRY 562


>gi|319407350|emb|CBI80995.1| NH3-dependent NAD synthetase [Bartonella sp. 1-1C]
          Length = 558

 Score =  514 bits (1323), Expect = e-143,   Method: Composition-based stats.
 Identities = 298/564 (52%), Positives = 391/564 (69%), Gaps = 13/564 (2%)

Query: 1   MLKKL-----KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPED 55
           M +KL     +I IAQLNPV+GDI GN   A+ A ++A  QG DL+L TELFIS YPPED
Sbjct: 1   MKQKLIKDDFRIVIAQLNPVIGDIGGNFTLAKMAYQKAYEQGADLVLLTELFISAYPPED 60

Query: 56  LVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKI 115
           LV K SF +AC  A+  L   T + G GI++G P +    + N ++ILD G +IA   K 
Sbjct: 61  LVLKSSFTEACEDAVRKLAQLTKE-GPGIIIGVPLKRNNNLYNGIMILDDGQVIAECFKY 119

Query: 116 NLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLN 175
           +LPNY EF EKR F SG   +PIV+R I LG+LICEDIW + +IC +L  +GAE +   N
Sbjct: 120 DLPNYCEFDEKRVFASGPRPEPIVYRGITLGVLICEDIWNDPSICANLSHKGAEIILVSN 179

Query: 176 ASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKH 235
            SPY+ NK +KR +IV  +     +PIIY NQVGGQDEL+FDG SF  D   Q+AFQMKH
Sbjct: 180 GSPYHRNKTQKRLDIVRSRAVQSCVPIIYANQVGGQDELVFDGGSFALDEHGQIAFQMKH 239

Query: 236 FSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKV 295
           F  Q  ++ W   ++   W  +S          L    ADY+ACVL L+DYV KN F  V
Sbjct: 240 FESQITLSHW--QRKSIGWQCISGPDEKL----LDGVAADYHACVLGLKDYVNKNRFKDV 293

Query: 296 IIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPI 355
           ++G SGGIDSALCAAIAVDALG E V  +M+PY YTS +SL+DA  CA+ LGC+Y+++PI
Sbjct: 294 LLGFSGGIDSALCAAIAVDALGAERVCAVMMPYYYTSQESLKDAKDCARLLGCRYEIIPI 353

Query: 356 HDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGY 415
             LV  F S+M+       + +  EN+QSRIRG++LMALSN   +M++TT NKSE++VGY
Sbjct: 354 FKLVESFLSIMAPIFSGLKTDVTEENLQSRIRGSVLMALSNKFDSMVITTGNKSEMAVGY 413

Query: 416 GTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRP 475
            TLYGDM+GGFNP+KD+YKTQV++LA WRN + + + LGP   VIP +I+ K+PSAELR 
Sbjct: 414 ATLYGDMNGGFNPIKDIYKTQVYKLAEWRNKNYLQNLLGPKRIVIPNNIITKAPSAELRD 473

Query: 476 HQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPV 534
           +Q D++SLPPYPILDDI++ +VE++ S  +   + ++ +TV  VEHLLY +EYKRRQ+ +
Sbjct: 474 NQKDEDSLPPYPILDDILQSLVEDDMSVCDILKRGHSRQTVEKVEHLLYLAEYKRRQSAL 533

Query: 535 GTKITAKSFGRDRLYPISNKFRDH 558
           G KI+ K+FGRDR YPI+N FRD 
Sbjct: 534 GVKISYKNFGRDRRYPITNHFRDK 557


>gi|90423585|ref|YP_531955.1| NAD synthetase [Rhodopseudomonas palustris BisB18]
 gi|90105599|gb|ABD87636.1| NH(3)-dependent NAD(+) synthetase [Rhodopseudomonas palustris
           BisB18]
          Length = 587

 Score =  513 bits (1320), Expect = e-143,   Method: Composition-based stats.
 Identities = 283/565 (50%), Positives = 372/565 (65%), Gaps = 15/565 (2%)

Query: 1   MLKK--LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVF 58
           M ++   KI +AQLNP VGDIAGN   AR AR  A   G  LI+F ELFISGYPPEDLV 
Sbjct: 4   MTEQADFKITLAQLNPTVGDIAGNAGLARAARARAAADGAQLIVFPELFISGYPPEDLVL 63

Query: 59  KKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLP 118
           K +F  AC +A++ L  DT DGG  ++VG P  D   + N+  +LDAG I A+R K+NLP
Sbjct: 64  KPAFQAACRAAVEDLARDTADGGPAMLVGSPWVDGGKLYNACALLDAGAIAAIRFKVNLP 123

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWK-----NSNICKHLKKQGAEFLFS 173
           NY  F EKR F  G  + P+  R +R+G+ ICED W        N+ + L + GAE L  
Sbjct: 124 NYGVFDEKRVFCRGPVSGPVTIRGVRVGVPICEDTWMEESADYENVVECLAETGAEILIV 183

Query: 174 LNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQM 233
            N SPY   K   R  +   +++   LP+IYVNQVGGQDEL+FDGASF  +  + LA Q+
Sbjct: 184 PNGSPYARGKADLRLSVQVARVTESDLPLIYVNQVGGQDELVFDGASFALNADRTLAAQL 243

Query: 234 KHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFH 293
             F +    T   +    S W          +   ++++EADY ACVL LRDYV KN F 
Sbjct: 244 PAFEQSL--TTLRWVNGDSGWRC-----DGAIAPVIEDDEADYAACVLGLRDYVNKNGFP 296

Query: 294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVL 353
            V++G+SGGIDSALCAAIAVDALG E V+ +MLP+++T+  SL+DAA  A ALG KY+VL
Sbjct: 297 GVLLGISGGIDSALCAAIAVDALGVERVRGVMLPFRFTAQVSLDDAAKLAGALGFKYEVL 356

Query: 354 PIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISV 413
           PI   VN F  +++   +  P  I  EN+Q+R RG +LMA+SN + AM++TT NKSE+SV
Sbjct: 357 PIAQAVNGFEEILAGTFRGLPRDITEENLQARTRGTLLMAISNKTGAMVVTTGNKSEMSV 416

Query: 414 GYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAEL 473
           GY TLYGDM+GGFNP+KD+YKT+VF+L + RN+      LGP  EVIP +I+ + P+AEL
Sbjct: 417 GYATLYGDMNGGFNPIKDIYKTEVFRLCTLRNAWKPDGALGPSGEVIPVNIITRPPTAEL 476

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQA 532
           R +QTDQ+SLPPY ILD I++R+VE E+         ++ +TV  ++ LL  +EYKRRQA
Sbjct: 477 RENQTDQDSLPPYDILDGILERLVEREQPLAEIVAAGFDRDTVVRIDRLLNIAEYKRRQA 536

Query: 533 PVGTKITAKSFGRDRLYPISNKFRD 557
             G K+T K+FGRDR YPI+N+FRD
Sbjct: 537 APGVKVTRKNFGRDRRYPITNRFRD 561


>gi|260428890|ref|ZP_05782867.1| glutamine-dependent NAD(+) synthetase [Citreicella sp. SE45]
 gi|260419513|gb|EEX12766.1| glutamine-dependent NAD(+) synthetase [Citreicella sp. SE45]
          Length = 552

 Score =  512 bits (1319), Expect = e-143,   Method: Composition-based stats.
 Identities = 245/559 (43%), Positives = 335/559 (59%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ IAQLNPV+GD+AGN A+AR A E+    G D++   E+FI+GY P+DL  K 
Sbjct: 1   MADRFRLTIAQLNPVLGDLAGNAAQARDAWEQGKAAGADMVALPEMFIAGYSPQDLPSKN 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F   C +A+  L  D  D G  + +G P  +   + N+ VI   G I     K +LPNY
Sbjct: 61  AFTLDCMAAVRQLAEDCAD-GPTLAIGTPWVEGTELYNAYVICRGGKITTQVFKHHLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R + SG    P    + R+G  +CED W      + L + GAEFL   N SPY+
Sbjct: 120 EVFDELRIYDSGPIGGPYAVGNTRVGSPVCEDAWYEDV-AETLAETGAEFLLVPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K + R   +  ++    LP+IYVN  GGQD+ IFDG SF  +   Q+A Q+  F E  
Sbjct: 179 RDKYETRLNKMVARVIETGLPLIYVNMTGGQDDQIFDGGSFVLNPHGQVAVQLPVFEE-- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +      +  S W  +  D            E DYNA V++LRDY +K  F KV++GLS
Sbjct: 237 VVAHVDLGRTESGWRALEGDFTRHP----DSMEQDYNAMVVALRDYCRKTGFGKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL A IAVDALG  NV+ +MLP +YTS  SLEDA ACA+ALGC YD +PI    +
Sbjct: 293 GGIDSALVATIAVDALGAGNVRCVMLPSEYTSEHSLEDAKACAEALGCHYDFVPITPGRD 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++   +     +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITATLAPLFEGLKPDLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF +  WRN++      GP    IP  I+ K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFDICRWRNANHRGWMSGPGAAPIPERIITKPPSAELRADQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I+K +V+++ S  +     Y+    + VEHLLY SEYKR Q+  G +++
Sbjct: 473 DSLPDYPVLDGILKILVDDDGSIADCVAAGYDRADAKKVEHLLYISEYKRFQSAPGARLS 532

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++F  DR YPI N++RD+
Sbjct: 533 KRAFWLDRRYPIVNRWRDN 551


>gi|73748831|ref|YP_308070.1| glutamine-dependent NAD(+) synthetase [Dehalococcoides sp. CBDB1]
 gi|73660547|emb|CAI83154.1| glutamine-dependent NAD(+) synthetase [Dehalococcoides sp. CBDB1]
          Length = 566

 Score =  512 bits (1319), Expect = e-143,   Method: Composition-based stats.
 Identities = 222/572 (38%), Positives = 322/572 (56%), Gaps = 28/572 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + KL++A+AQ++ VVGD+AGN A      ++A   G D+I F EL I GYPPEDL+ K  
Sbjct: 1   MGKLRLAMAQIDSVVGDLAGNTACIVSHVQKARSLGADVIAFPELAICGYPPEDLLHKPR 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++    A+D +   +   G  ++VG+       + N+  I+  G++I    KI LPNY 
Sbjct: 61  FVEENLQALDAVIKASQ--GITVIVGYVDSHDG-LRNAAAIIHNGSLIDSYHKIFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F+ G          +++G+ ICEDIW  S        +GAE + +++ASPY+ 
Sbjct: 118 VFDENRYFLPGNRCPVYTICGLQVGVNICEDIWFTSGPSTAQANKGAELIINISASPYHF 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K  +R ++++ +     + I Y N VGGQDEL+FDGAS  FD    L  + K F E   
Sbjct: 178 GKRNQREKMLSDRARENRVYIAYTNMVGGQDELVFDGASDVFDYNGNLLIRGKQFQEDLV 237

Query: 242 MTEWHYDQ-----------------QLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLR 284
           + +                        + +  +     +  + PL+ +   Y A +L  R
Sbjct: 238 VLDLDIPVLPRQADTNANVPDSIFVSSAGFETLKPPIENIAFTPLEADAEVYQALLLGTR 297

Query: 285 DYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAK 344
           DY+ KN F KV+IGLSGGIDS+L A IA DALG ENV  +++P +Y+S  S+ D+   A 
Sbjct: 298 DYINKNGFKKVVIGLSGGIDSSLVATIAADALGPENVVGVIMPSRYSSEGSISDSLHLAG 357

Query: 345 ALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLT 404
            LG K   +PI  L   F + +S       +    ENIQ+RIRGN+LMALSN    ++L 
Sbjct: 358 NLGIKTLQIPIDPLFQSFLNTLSDVFAGTEANTTEENIQARIRGNLLMALSNKFHWLVLN 417

Query: 405 TSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSI 464
           TSNKSE ++GY TLYGDM+GGF  +KD+ K  V++L   RN            ++IP ++
Sbjct: 418 TSNKSETAIGYSTLYGDMAGGFAIIKDVPKVLVYRLVHNRNKLAGF-------DLIPNNV 470

Query: 465 LEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLY 523
           L K PSAEL+P+Q D +SLPPY +LD I++  VE ++S        +  + V+ V  ++ 
Sbjct: 471 LAKPPSAELKPNQLDTDSLPPYEVLDPILEAYVEQDKSIDQIVALGFAADIVKRVVKMVD 530

Query: 524 GSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
            SEYKRRQAP G KIT K+FGRDR  PI+N++
Sbjct: 531 RSEYKRRQAPPGIKITPKAFGRDRRLPITNRY 562


>gi|217077779|ref|YP_002335497.1| NAD synthetase [Thermosipho africanus TCF52B]
 gi|217037634|gb|ACJ76156.1| glutamine-dependent NAD+ synthetase [Thermosipho africanus TCF52B]
          Length = 576

 Score =  512 bits (1318), Expect = e-143,   Method: Composition-based stats.
 Identities = 221/582 (37%), Positives = 339/582 (58%), Gaps = 36/582 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++  +AQLN  +GD  GN+ K   A E A     + ++F ELF++GYPPEDL+ + SF++
Sbjct: 3   IRTTVAQLNSTLGDFEGNMKKIISAIEIAENNNSEFLIFPELFLTGYPPEDLILRTSFLK 62

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
                ++ + + +      I++GF   + +   NS+ ++  G ++    K++LPNYS F 
Sbjct: 63  KNIEYLEKIINFSRGKNVIILLGFIDIEDDA-YNSLAVIRDGKLLGKYHKMHLPNYSVFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E R F SG     I + +I++GI ICEDIW       +    GA+ + + +ASPY+H K 
Sbjct: 122 ENRYFKSGNEIVIINYNNIKIGINICEDIWSPLGPMFYQAINGAQLILNASASPYFHGKR 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           + R   ++ +    H PI+Y N VGGQDE++FDG S       ++ F+ K F E+ F  +
Sbjct: 182 ELRKNYLSKKSYDHHCPIVYCNMVGGQDEVVFDGGSVVTSSDGKIIFEGKPFEEEIFTID 241

Query: 245 WHY---------DQQLSQWNYMSDDSASTMYIPLQ------------------EEEADYN 277
                       D +    N ++D   + +++  +                  +EE  + 
Sbjct: 242 IPIEDNLRTNLHDPRRRYINIVNDKPINYIFVKSENINKLKPINYKNKNYTLTKEEEIFR 301

Query: 278 ACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLE 337
           A  L L+DY+QKN F KV+IGLSGG+DS+L AAIAV+ALG +NV  I++P  Y+S  S+E
Sbjct: 302 AITLGLKDYIQKNGFKKVLIGLSGGMDSSLVAAIAVEALGNKNVVGILMPSMYSSSHSIE 361

Query: 338 DAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNH 397
           DA   A+ L  +Y ++ I D+   F + +    +     I  EN+Q+RIRG +LMA+SN 
Sbjct: 362 DAKKLAENLEIEYHIIKISDIYYSFKNSLKDIFKGTSEDITEENLQARIRGTLLMAVSNK 421

Query: 398 SKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLT 457
              ++L T NKSEI+ GY TLYGDM GGF+P+KD+YKT V+++A W N            
Sbjct: 422 FGYIVLATGNKSEIATGYSTLYGDMVGGFSPIKDIYKTDVYKIARWYNKF-------KGK 474

Query: 458 EVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVR 516
           E+IP ++  K PSAELRP Q DQ++LPPY ILD+I+K  +E E S     ++ ++ +TV+
Sbjct: 475 EIIPENVFIKPPSAELRPDQKDQDTLPPYEILDEILKMYIEKELSVDEIINKGFDKDTVK 534

Query: 517 YVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
           YV  L+  +EYKRRQ  +G K++ +SFG+DR  PI+NK+R+ 
Sbjct: 535 YVAKLVDRNEYKRRQGVIGVKVSERSFGKDRRMPITNKYREW 576


>gi|46201454|ref|ZP_00055021.2| COG0171: NAD synthase [Magnetospirillum magnetotacticum MS-1]
          Length = 548

 Score =  512 bits (1318), Expect = e-143,   Method: Composition-based stats.
 Identities = 256/550 (46%), Positives = 346/550 (62%), Gaps = 10/550 (1%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           IA+AQ+NPVVGDI GN+   R AR EA   G DL++F EL + GYPPEDLV K +F+ AC
Sbjct: 4   IALAQINPVVGDIVGNMGLIRAARAEAKALGADLVVFGELTLCGYPPEDLVLKGAFLDAC 63

Query: 67  SSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEK 126
            +A++ L ++T D G  ++VG P + ++ + N+ ++LD G I A R K +LPNY  F E 
Sbjct: 64  EAAVNELAAETAD-GPALLVGAPWRVKDKLHNAALLLDHGRIAATRLKHHLPNYGVFDEV 122

Query: 127 RTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKK 186
           R F  G    P+ FR +RLG+LICED+W      + L + GAE L   N SP+  +K  K
Sbjct: 123 RVFQPGPLPGPVSFRGVRLGVLICEDMWYADV-AETLGESGAEILVVPNGSPFEMDKPTK 181

Query: 187 RHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWH 246
           R +    ++    LP++YVNQVGGQDEL+FDGASF   G  ++A  +  +  Q  +T W 
Sbjct: 182 RLDHARARVEETGLPLVYVNQVGGQDELVFDGASFVLGGDAKIAASIAPWQSQVVLTTWT 241

Query: 247 YDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSA 306
             ++   W      +      P    E  Y A V  LRDYV KN F  V++GLSGGIDSA
Sbjct: 242 --RESDGWRCEGPKA-----PPASRLEGVYQALVTGLRDYVGKNRFPGVVLGLSGGIDSA 294

Query: 307 LCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLM 366
           +CAAIA DALG + V  +M+P  YTS +SLEDAA CA+ LG + D + I   +  F S++
Sbjct: 295 ICAAIAADALGPDKVWCVMMPSPYTSEESLEDAALCAQMLGVRLDTVNIGPAMAAFGSML 354

Query: 367 SQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGF 426
           +   +   S I  EN+QSR RG  LM LSN    M+L+T NKSE+S GY TLYGDM GG+
Sbjct: 355 APIFEGRDSDITEENLQSRSRGLTLMGLSNKFGPMVLSTGNKSEMSCGYATLYGDMCGGY 414

Query: 427 NPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPY 486
             LKD+YKT VF L+SWRN H     LGP+  V+P  ++ K PSAEL+P Q DQ++LPPY
Sbjct: 415 AVLKDVYKTTVFALSSWRNGHRPPGCLGPVGAVMPERVITKPPSAELKPDQKDQDTLPPY 474

Query: 487 PILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGR 545
             LD +++ ++E E+S      + + +  VR V  +L  +EYKRRQAP G KI+++SFG+
Sbjct: 475 DELDAMLEAMIEEEKSVSEIVAKGFEEAVVRRVWRMLDRAEYKRRQAPPGVKISSRSFGK 534

Query: 546 DRLYPISNKF 555
           DR YPI+N F
Sbjct: 535 DRRYPITNAF 544


>gi|288940531|ref|YP_003442771.1| NAD+ synthetase [Allochromatium vinosum DSM 180]
 gi|288895903|gb|ADC61739.1| NAD+ synthetase [Allochromatium vinosum DSM 180]
          Length = 536

 Score =  512 bits (1318), Expect = e-143,   Method: Composition-based stats.
 Identities = 235/551 (42%), Positives = 330/551 (59%), Gaps = 19/551 (3%)

Query: 6   KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQA 65
           +I I Q+NP+VGD+AGN  +   A   A+  G+DL++  EL ++GYPPEDL+ +  FI  
Sbjct: 4   RIEILQMNPLVGDVAGNAERLIAAARRAHASGIDLLVCPELALTGYPPEDLLLRPEFIAR 63

Query: 66  CSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHE 125
             +A++ L+S+    G  +V G+PR    G+ N   ++  G +IA   K +LPNYS F E
Sbjct: 64  VETALERLQSEIR--GITLVFGYPRASVGGLFNVAGVIRDGTLIAEYAKQHLPNYSVFDE 121

Query: 126 KRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLK 185
           KR F  G          +R G+ +CEDIW      +   + GA+ L +LNASP++  K+ 
Sbjct: 122 KRYFQPGTGATVFEQCGLRFGLSVCEDIWWEEPT-REAAEAGAQVLLNLNASPFHGGKIA 180

Query: 186 KRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEW 245
           +R  +V  +     L I+Y N VGGQDEL+FDGASF  D   ++  +   F+E     + 
Sbjct: 181 EREALVARRARAHGLTILYANLVGGQDELVFDGASFVVDPDGRITHRAGLFTETTLALKL 240

Query: 246 HYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDS 305
             D                +     EEE  Y A VL +RDYV+KN F   ++GLSGGIDS
Sbjct: 241 DAD------GVPVRAGTEPLTDWPGEEETIYEALVLGVRDYVRKNGFEGAVLGLSGGIDS 294

Query: 306 ALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSL 365
           AL  AIAVDALG + V+ +++P +YT+  S EDA   A+ LG    V+PI    + F  +
Sbjct: 295 ALTLAIAVDALGADRVEAVLMPSRYTADMSNEDALEQARRLGVSTRVIPIEPAFHAFLDM 354

Query: 366 MSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGG 425
           +      +P  +  ENIQ+R RG ILMA+SN S  +LLTT NKSE++VGY TLYGDM+GG
Sbjct: 355 LEPVFAGQPVDVTEENIQARCRGIILMAISNKSGRILLTTGNKSEMAVGYATLYGDMAGG 414

Query: 426 FNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPP 485
           F P+KD+ K  V++LA +RN             VIP  ++E++PSAELRP QTDQ+SLPP
Sbjct: 415 FAPIKDVPKMLVYRLARYRNGRSP---------VIPERVIERAPSAELRPDQTDQDSLPP 465

Query: 486 YPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFG 544
           Y +LD I+KR +E++ES  +   Q Y  + VR V  L+  +EYKRRQAP G +I+ ++FG
Sbjct: 466 YDLLDAILKRYIEDDESVEDIVAQGYPADVVRRVARLVDRNEYKRRQAPPGVRISRRAFG 525

Query: 545 RDRLYPISNKF 555
           RDR YPI++ F
Sbjct: 526 RDRRYPITSGF 536


>gi|256822303|ref|YP_003146266.1| NAD+ synthetase [Kangiella koreensis DSM 16069]
 gi|256795842|gb|ACV26498.1| NAD+ synthetase [Kangiella koreensis DSM 16069]
          Length = 539

 Score =  512 bits (1318), Expect = e-143,   Method: Composition-based stats.
 Identities = 224/558 (40%), Positives = 333/558 (59%), Gaps = 20/558 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IAIAQ N  VGDI  N+   + + ++A     D+++F+EL + GYPPEDL+ +     
Sbjct: 1   MRIAIAQNNYTVGDIQRNLELIKSSVKQAELDNADIVVFSELSLCGYPPEDLLLRPDLYT 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
              +A++ L +   D    +V+G P ++ EG+ N   ++  G ++    K  LPNYS F 
Sbjct: 61  IIDNAVEDLLAL--DSQVAMVIGHPIKEAEGLFNVATVIHRGQLLVQYKKQLLPNYSVFD 118

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F SG  +    F+ ++LG+L+CED+W      +     GA+ L S NASPY + K 
Sbjct: 119 EKRYFESGSEDCVFEFKGLKLGLLVCEDLWYPEPTARVKAL-GADILLSPNASPYCYGKG 177

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R   +  +     LPI+YVNQ+GGQDELIFDG S  ++ + Q  FQM   +E     +
Sbjct: 178 TLRSAEMGSRARENELPIVYVNQIGGQDELIFDGCSAVYNEEGQRIFQMAEMAEDFAYID 237

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           +       +        +         EE  + A VL +RDY  KN F   ++GLSGGID
Sbjct: 238 FDPKTGAIK-------PSKPYLNQFHGEEEIWQALVLGVRDYAHKNGFKGALLGLSGGID 290

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+  A+AVDALGKENV  +M+P++YT+  S+EDA   AKALG ++DV+ I  +   F S
Sbjct: 291 SAVTLAVAVDALGKENVNAVMMPFRYTASMSIEDAEEEAKALGIEFDVISIEPMYEAFMS 350

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S   ++  + +  +NIQ+R RG +LMALSN    ++LTT NKSE++VGY TLYGDM+G
Sbjct: 351 QLSHQFKDTEADLTEQNIQARCRGTLLMALSNKFGRLVLTTGNKSEVAVGYCTLYGDMAG 410

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           G + LKD+ KT V++LA +RN+         +++VIP  ++ + PSAEL P Q D+++LP
Sbjct: 411 GLDVLKDVSKTMVYRLARYRNT---------VSQVIPERVITRPPSAELAPDQKDEDNLP 461

Query: 485 PYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY ILD I++  VE ++S  +     +++E VR V  L+  +E+KRRQAP G +IT ++F
Sbjct: 462 PYDILDAILEAYVEQDKSLDDIIALGHDEEVVRRVIRLVDINEHKRRQAPPGIRITQRAF 521

Query: 544 GRDRLYPISNKFRDHISE 561
           GRDR YPI++ F      
Sbjct: 522 GRDRRYPITSGFGRQFKS 539


>gi|260431460|ref|ZP_05785431.1| glutamine-dependent NAD(+) synthetase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415288|gb|EEX08547.1| glutamine-dependent NAD(+) synthetase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 570

 Score =  511 bits (1317), Expect = e-142,   Method: Composition-based stats.
 Identities = 250/559 (44%), Positives = 338/559 (60%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    +I +AQLNP+VGDIAGN AKAR A E+    G DL+   E+FI+GY  +DLV K 
Sbjct: 19  MADHFRITLAQLNPIVGDIAGNAAKARSAWEQGRAAGADLVALPEMFITGYNTQDLVQKP 78

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F QA   A+  L +D  D G  + +G P  + + + N+ +IL+ G I++   K +LPN 
Sbjct: 79  VFHQAAMDAVRQLATDCAD-GPALAIGGPWAEGDKLYNAYLILNQGRIVSKVFKHHLPNE 137

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W      + L + GAEFL   N SPY+
Sbjct: 138 TVFDEVRLFDAGPLGGPYAVGNTRVGSPICEDGWHEDV-AETLAETGAEFLLIPNGSPYF 196

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK   R   +  ++    LP+IY+N VGGQD+ +FDG SF  +    LAF+M  F E  
Sbjct: 197 RNKYDIRLNQMVARVVETGLPVIYLNMVGGQDDQVFDGGSFGLNPGGALAFRMPVFDEA- 255

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T     +    W  +    A          E DY A V +LRDY+ K  F K ++GLS
Sbjct: 256 -VTHVDLQRGEQGWTIVPGAVAEQP----DAWEQDYRAMVQALRDYMAKTGFSKALLGLS 310

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL A IAVDALG ENV+ +MLP +YTS  SLEDA A AKALG +YD +PI     
Sbjct: 311 GGVDSALVATIAVDALGAENVRCVMLPSEYTSAASLEDAEAVAKALGVQYDYVPISQSRA 370

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++       + I  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 371 AVTETLAPLFAGRRADITEENIQSRLRGLLLMAISNKFGEMLLTTGNKSEVAVGYATIYG 430

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++      GP  EVI PS+++K PSAELR  Q D 
Sbjct: 431 DMNGGYNPIKDLYKTRVFETCRWRNANHRDWMKGPAGEVIRPSVIDKPPSAELREDQKDS 490

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I++ +V+ + S  +     +++   R VEHL+Y SEYKR Q+  GT++T
Sbjct: 491 DSLPDYPVLDGILEILVDRDGSIADCVAAGFDEADARRVEHLIYISEYKRFQSAPGTRLT 550

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++F  DR YPI N++RD 
Sbjct: 551 NRAFWLDRRYPIVNRWRDR 569


>gi|163857180|ref|YP_001631478.1| NAD synthetase [Bordetella petrii DSM 12804]
 gi|163260908|emb|CAP43210.1| putative NAD synthetase [Bordetella petrii]
          Length = 544

 Score =  511 bits (1317), Expect = e-142,   Method: Composition-based stats.
 Identities = 229/554 (41%), Positives = 324/554 (58%), Gaps = 18/554 (3%)

Query: 6   KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQA 65
           ++AIAQ+N  VGDI GN A+  ++   A++QG D+++  EL ++GYPPEDL+ +  F++ 
Sbjct: 5   RVAIAQINACVGDIKGNAARVLQSAHSAHQQGADVLVTPELVLTGYPPEDLLLRPHFVET 64

Query: 66  CSSAIDTLKSDTHDG-GAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
             +A+D L+ DT    G  ++VG        + N+  +L  G ++ V  K  LPNYS F 
Sbjct: 65  QEAALDQLRRDTAGLAGLHLLVGHVLARGGKLYNAATVLCEGRVVGVYCKRELPNYSVFD 124

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E+R F           + +R G+ ICED+W          + GA+ L   NASPY   K 
Sbjct: 125 EQRYFAEADQPLVFEVKGVRFGVNICEDMWFERAPR-AAAQAGAQVLLVPNASPYNTGKQ 183

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +R  +           ++Y N VGGQDEL+FDGASF  D Q Q A ++  ++E   + E
Sbjct: 184 DERLRVARRCAQDTGCAVVYANLVGGQDELVFDGASFALDAQGQPAARLPDYTEGVDVVE 243

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
                 +   +  +D        P   EE  +NA VLS+RDY+ KN F   IIGLSGGID
Sbjct: 244 VDAAGAVRPLSRHAD------VAPYCLEEQVWNALVLSVRDYLGKNGFPGAIIGLSGGID 297

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+  A+AVDALG  NV+T+M+P +YT+  S  DA   A+ LG ++D + I   V+ F +
Sbjct: 298 SAVVLAVAVDALGAANVRTVMMPSRYTADISQTDAGDMAQRLGVRHDDIAIGPAVDAFEA 357

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
           +++      P     ENIQ+R+RG +LMALSN +  ++LTT NKSE++ GY TLYGDM+G
Sbjct: 358 MLAPQFAGLPVDATEENIQARVRGTLLMALSNKTGHLVLTTGNKSELTTGYCTLYGDMAG 417

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF  +KD+ KT V++LA WRN            EVIP  I+ + PSAELRP QTDQ+SLP
Sbjct: 418 GFAVIKDVPKTLVYRLAEWRNREH---------EVIPRRIITRPPSAELRPDQTDQDSLP 468

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY ILD I++R +E  +S        +    V  V  L+  +EYKRRQAP G +IT ++F
Sbjct: 469 PYDILDGIMERYMERNQSAAEIVAAGFPRPAVEQVVRLIRINEYKRRQAPPGPRITPRAF 528

Query: 544 GRDRLYPISNKFRD 557
           GRD  YP++N FR+
Sbjct: 529 GRDWRYPVTNGFRE 542


>gi|254466900|ref|ZP_05080311.1| glutamine-dependent NAD(+) synthetase [Rhodobacterales bacterium
           Y4I]
 gi|206687808|gb|EDZ48290.1| glutamine-dependent NAD(+) synthetase [Rhodobacterales bacterium
           Y4I]
          Length = 552

 Score =  511 bits (1316), Expect = e-142,   Method: Composition-based stats.
 Identities = 251/558 (44%), Positives = 344/558 (61%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGD+AGN AKAR A EE  + G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MADRFRVTLAQLNPTVGDLAGNAAKARTAWEEGRKAGADLVALPEMFITGYNTQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F QA  + ++ L +D  D G  + VG P  +   + N+ +IL  G I +   K +LPN 
Sbjct: 61  VFHQAAIAEVEKLAADCAD-GPALAVGGPWVEGGRLYNAYLILKDGKIASRSLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W      + L + GAEFL   N SPY+
Sbjct: 120 TVFDEVRLFEAGPLGGPYSVSNTRIGSPICEDGWHEDV-AETLAETGAEFLLIPNGSPYF 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK++ R  ++  +    HLP+IY+N VGGQD+ +FDG SF  +    LA QM  F E  
Sbjct: 179 RNKMEVRFNMMVARAVETHLPVIYLNMVGGQDDQVFDGGSFALNPGGALAVQMPLFDE-- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T+    +    W     + A        E E DY   V SLRDY+ K  F KV++GLS
Sbjct: 237 CITQVDLIRTGDGWRVEEGEKAHLP----DEWEQDYRVMVDSLRDYMGKTGFKKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ AAIAVDALG ENV+ +MLP +YTS +SL+DA A AKALG +YD +PI +   
Sbjct: 293 GGVDSAIVAAIAVDALGAENVRCVMLPSEYTSRESLDDAEAVAKALGVRYDYVPISEARA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              S ++       + I  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITSTLAPLFAGLDADITEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++      GP  EVI P++++K PSAELR +Q D 
Sbjct: 413 DMNGGYNPIKDLYKTRVFETCRWRNANHRPWMKGPAGEVIRPNVIDKPPSAELRENQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD I++ +V+ E S  +     ++ +  + VEHLLY SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPELDAILEILVDLEGSIADCVAAGFSRDVAKRVEHLLYISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 PRAFWLDRRYPIVNRWRD 550


>gi|298290916|ref|YP_003692855.1| NAD+ synthetase [Starkeya novella DSM 506]
 gi|296927427|gb|ADH88236.1| NAD+ synthetase [Starkeya novella DSM 506]
          Length = 557

 Score =  509 bits (1312), Expect = e-142,   Method: Composition-based stats.
 Identities = 272/552 (49%), Positives = 368/552 (66%), Gaps = 8/552 (1%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           IA AQLNPVVGDIAGN+ KAR AR +A  QG +L+LFTELFI+GYP EDLV K +F  AC
Sbjct: 11  IAFAQLNPVVGDIAGNLIKAREARAQAAEQGAELVLFTELFIAGYPLEDLVLKPAFQAAC 70

Query: 67  SSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEK 126
            +A++ L  DT DGG  +++G P  D + + N+V++LD G ++  R K++LPNY  F EK
Sbjct: 71  RAAVEELAKDTADGGPAVLIGSPWADGDKLYNAVLLLDGGKVVTARYKVDLPNYGVFDEK 130

Query: 127 RTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKK 186
           R F  G    PI F+ +R+G+ +CEDIW + ++ + L + G+E L   N SPY      +
Sbjct: 131 RVFAPGPMPGPIPFKGVRIGVPVCEDIW-SQDVIECLAETGSELLLIPNGSPYRRTVYDE 189

Query: 187 RHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWH 246
           R  +   ++    LP+ YVNQVGGQDEL+FDGASF  +  + LA QM +F E+  +T W 
Sbjct: 190 RMNVAVARVVESGLPLAYVNQVGGQDELVFDGASFVLNADRSLAVQMPNFQERIRLTRWE 249

Query: 247 YDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSA 306
                 +W              L ++EADY ACV+ LRDYV+KN F  V++GLSGG+DSA
Sbjct: 250 ------RWAEGWRCEEGARSPLLLDDEADYAACVMGLRDYVEKNRFPGVVLGLSGGVDSA 303

Query: 307 LCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLM 366
           L AA+AVDALG E V  +MLPY+YTS +SL DAAA A+ALG +YD++PI + V     ++
Sbjct: 304 LVAAMAVDALGAERVHCVMLPYRYTSNESLSDAAAVAEALGVRYDIVPIAESVEALEKVL 363

Query: 367 SQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGF 426
           +      P  +  EN+QSR+RG +LM++SN   +M++TT NKSE+S GY TLYGDM+GG+
Sbjct: 364 APMFDGRPRDVTEENLQSRVRGTLLMSISNKFGSMVVTTGNKSEMSTGYATLYGDMNGGY 423

Query: 427 NPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPY 486
           NPLKDLYKTQVF+L   RN       LGP   V+P +++ K P+AELR +Q DQ+SLPPY
Sbjct: 424 NPLKDLYKTQVFRLCHLRNRWKPAYALGPSGAVMPENVIVKPPTAELRENQKDQDSLPPY 483

Query: 487 PILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGR 545
            +LD I+ R+VE E    +     Y+   V  VE +L  +EYKRRQA  G K+TA++FGR
Sbjct: 484 DVLDAILLRLVEREMPVADIVAEGYDATLVARVERMLNIAEYKRRQAAPGVKVTARNFGR 543

Query: 546 DRLYPISNKFRD 557
           DR YPI+N+FR+
Sbjct: 544 DRRYPITNRFRE 555


>gi|163736854|ref|ZP_02144272.1| NAD+ synthetase [Phaeobacter gallaeciensis BS107]
 gi|161389458|gb|EDQ13809.1| NAD+ synthetase [Phaeobacter gallaeciensis BS107]
          Length = 552

 Score =  509 bits (1312), Expect = e-142,   Method: Composition-based stats.
 Identities = 243/558 (43%), Positives = 333/558 (59%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGD+AGN  KAR A       G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MADRFRVTLAQLNPTVGDLAGNANKAREAWAAGRDAGADLVALPEMFITGYNTQDLVQKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F QA  + ++ L +D  D G  + VG P      + N+ +IL  G I     K +LPN 
Sbjct: 61  VFHQAAIAEVERLAADCAD-GPALAVGSPWVADGKLFNAYLILKGGKITTQVLKHHLPNA 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W      + L + GAEFL   N SPY+
Sbjct: 120 TVFDEVRIFDAGPLGGPYAVGNTRIGSPICEDGWYEDV-AETLAETGAEFLLIPNGSPYF 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK+  R   +  +     LP+IY+N VGGQD+ +FDG SF  +    LA QM  F E  
Sbjct: 179 RNKMDVRFNHMVARAVETDLPVIYLNMVGGQDDQVFDGGSFVLNPGGALALQMPVFDEAI 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                  ++    W  +    AS       E E DY+   LSLRDY++K  F KV++GLS
Sbjct: 239 Q--HLDLERTAEGWRAVEGPKASLP----DEWEQDYHVMTLSLRDYMRKTGFKKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ A IAVDALG ENV+ +MLP +YTS +SL+DA A AKALG  YD +PI +   
Sbjct: 293 GGVDSAIVATIAVDALGAENVRCVMLPSEYTSQESLDDAEAVAKALGVHYDYVPIAEGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++        G+  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITNTLAPLFAGLDEGLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN +     +GP  EVI P++++K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFETCRWRNDNHRDWMMGPEGEVIRPNVIDKPPSAELRDDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD +++ +V+ + S  +     ++ E  + VEHL+Y SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPELDALLEILVDRDGSIADCVAAGFSRENAKRVEHLIYISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 PRAFWLDRRYPIVNRWRD 550


>gi|56695341|ref|YP_165689.1| NAD synthetase [Ruegeria pomeroyi DSS-3]
 gi|56677078|gb|AAV93744.1| glutamine-dependent NAD(+) synthetase [Ruegeria pomeroyi DSS-3]
          Length = 552

 Score =  509 bits (1310), Expect = e-142,   Method: Composition-based stats.
 Identities = 245/558 (43%), Positives = 338/558 (60%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I +AQLNP VGD+AGN AKAR A E     G DL+   E+F++GY  +DLV K 
Sbjct: 1   MADRFRITLAQLNPTVGDLAGNAAKARMAWEHGREAGADLVALPEMFVTGYNTQDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F  A  + I+ L  +  D G  + +G P  ++  + N+ +IL  G I++   K +LPN 
Sbjct: 61  VFHDAAIAMIEALAEECAD-GPALAIGGPLVEEGKLYNAYLILKGGKIVSRSLKTHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W      + L + GAEFL   N SPYY
Sbjct: 120 TVFDEVRIFDAGPLGGPYSVGNTRIGSPICEDAWHEDV-AETLAETGAEFLLVPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K   R   +  ++    LP+IY+N VGGQD+ +FDG +F  +    LAF+M  F E  
Sbjct: 179 RDKYDMRINQMVARVVETGLPLIYLNMVGGQDDQVFDGGTFGLNPGGALAFRMPVFDEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T    ++    W  +  + A          E DY   V SLRDY++K  F KV++GLS
Sbjct: 238 -ITHVDLERGSEGWQIVQGEVAPLP----DAWEQDYRVMVESLRDYMRKTGFAKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL AAIA DALG ENV+ +MLP +YTS  SL+DA A A+ALG +YD +PI +   
Sbjct: 293 GGVDSALVAAIATDALGPENVRCVMLPSEYTSRSSLDDAEAVAQALGVRYDYVPISESRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++        G+  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AVTNTLAPLFAGTEPGLTEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVI PS+++K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFETCRWRNANHRLWMMGPAGEVIRPSVIDKPPSAELREDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD I+  +V+ + S  +     ++ +  R VEHL+Y SEYKR QA  G ++T
Sbjct: 473 DSLPDYPELDAILDILVDQDGSIADCVAAGFDRDVARRVEHLIYISEYKRYQAAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 PRAFWLDRRYPIVNRWRD 550


>gi|224826930|ref|ZP_03700029.1| NAD+ synthetase [Lutiella nitroferrum 2002]
 gi|224600917|gb|EEG07101.1| NAD+ synthetase [Lutiella nitroferrum 2002]
          Length = 530

 Score =  509 bits (1310), Expect = e-142,   Method: Composition-based stats.
 Identities = 222/554 (40%), Positives = 319/554 (57%), Gaps = 26/554 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IA+AQ NPVVGDIAGN  K      +A  QG D+++  EL ++GY PEDL+ +  F +
Sbjct: 1   MRIALAQFNPVVGDIAGNTRKILDLARQAMAQGADVLVTPELALTGYSPEDLLLRDHFYR 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
            CS A+D L       G  +VVG P +      N+  ++  GN +    K+ LPN   F 
Sbjct: 61  ECSKALDELLEL---DGITLVVGHPVKLGNERFNAATVMRDGNRLGQYHKMLLPNNEVFD 117

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E R F  G +        + +G+LICED+W + +        GA+ +  LNASP++ NK+
Sbjct: 118 ECRYFTPGGAPLVFPQDGVNVGVLICEDVW-SLDPAAEAADAGADVVVVLNASPFHRNKI 176

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           + RHE V  ++    LP  YVN  GGQDEL+FDGASF  +   ++  Q   + ++  + +
Sbjct: 177 ETRHETVRYRVEETGLPFAYVNLTGGQDELVFDGASFALNKAGEVVAQAAAYDDELLIVQ 236

Query: 245 -WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
               D Q +    +               E+ Y   V+ +RDY+ KN F  V++GLSGGI
Sbjct: 237 MADGDLQPAGKATLPC-----------PLESVYRTLVIGVRDYIGKNGFPGVLLGLSGGI 285

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL  AIA DALG + V  +M+P +YT+  S++D+    + LG KY+ + I  +   F 
Sbjct: 286 DSALTLAIAYDALGADKVHAVMMPSRYTADISVDDSRDMVERLGVKYEEIAIWPMYESFM 345

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           + ++   +        EN+Q+RIRG +LMALSN +  ++LTT NKSE++ GY TLYGDM+
Sbjct: 346 AALAPSFEGLAEDTTEENLQARIRGTLLMALSNKTGKLVLTTGNKSEMTTGYCTLYGDMA 405

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF  LKD+ KT V+QL  WRN+          +E+IP  I+ + PSAELRP Q DQ+SL
Sbjct: 406 GGFAVLKDVAKTLVYQLCHWRNAQ---------SEIIPLRIITRPPSAELRPDQKDQDSL 456

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           PPY +LD I+ R VE   S      + + +  VR V  LL  +EYKRRQAPVG ++T + 
Sbjct: 457 PPYDVLDAIMARYVEENLSAAEIIAEGFAEADVRRVVRLLKINEYKRRQAPVGPRVTHRG 516

Query: 543 FGRDRLYPISNKFR 556
           FG+D  YPI+N+F 
Sbjct: 517 FGKDWRYPITNRFS 530


>gi|225849058|ref|YP_002729222.1| glutamine-dependent NAD(+) synthetase (NAD(+)
           synthase[glutamine-hydrolyzing]) [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225644679|gb|ACN99729.1| glutamine-dependent NAD(+) synthetase (NAD(+)
           synthase[glutamine-hydrolyzing]) [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 574

 Score =  509 bits (1310), Expect = e-142,   Method: Composition-based stats.
 Identities = 230/585 (39%), Positives = 334/585 (57%), Gaps = 41/585 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           ++K+++A+ Q+NP+VGD   N+ K     ++A    +D+I F EL ++GYPPEDL+ K S
Sbjct: 1   MRKIRVALGQINPIVGDFDYNLQKILDYIKKAKDLQVDIIAFPELALTGYPPEDLILKPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+     I  L  +  D    ++VGF  + ++ + N+  I+   NIIA   K  LPNY 
Sbjct: 61  FIEKNLQYIKKLTENVED--IVVIVGFIDKKED-IYNAAAIIHNKNIIATYHKQFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F  G           + G+ ICEDIW   N       +G E +F++NASPY  
Sbjct: 118 VFDENRYFQKGNGLTVFEIEGYKFGVSICEDIWYPENPINTYAVEGCEVIFNINASPYSE 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+KKR E++  +     + I YVN VGGQDEL+FDG SF  +   ++  + + F E   
Sbjct: 178 GKVKKREELLKVRSRDNLVSIAYVNLVGGQDELVFDGNSFFVNPNGEILGKGESFKEDLV 237

Query: 242 MTEWHYDQQLS----------------------------QWNYMSDDSASTMYIPLQEEE 273
           + +   D+                               Q    + +    + +   + E
Sbjct: 238 VADIDLDEIFRYQLKDNRLKNLRSEYRRSDKVNYIKVDYQIKEKTVNIEQKIVLDKPDIE 297

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             YN  VL LRDY+ KN F KV+IGLSGG+DS+L A IAVDALG ENV+ +++P  YTS 
Sbjct: 298 NTYNTLVLGLRDYITKNGFKKVVIGLSGGVDSSLVATIAVDALGNENVKGVLMPSPYTSK 357

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMA 393
           +S+EDA   AK L  +  ++PI ++   +     +  +        EN+Q+RIRGNILMA
Sbjct: 358 ESIEDALELAKNLNIETFIIPITNIFQTYLDEFKEIFKGLKPDTTEENLQARIRGNILMA 417

Query: 394 LSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGL 453
           LSN    ++L T NKSE+SVGY TLYGDM GGF  +KD+ KT+V+QL  +RNS       
Sbjct: 418 LSNKFGWIVLATGNKSEMSVGYSTLYGDMVGGFAVIKDVLKTKVYQLCEYRNS------- 470

Query: 454 GPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYND 512
             +++VIP  +L K PSAELRP+QTD+  L PY ILD+IIK  VE + S        +++
Sbjct: 471 --ISKVIPDRVLIKPPSAELRPNQTDEAELAPYHILDEIIKMYVEQDCSVEEIIKAGFDE 528

Query: 513 ETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           +TV+ +  L+  +EYKRRQ+P+G KIT ++FG+DR  PI+N+F++
Sbjct: 529 KTVKKIVKLIDTNEYKRRQSPIGIKITERAFGKDRRMPITNRFKE 573


>gi|209964282|ref|YP_002297197.1| NAD synthetase [Rhodospirillum centenum SW]
 gi|209957748|gb|ACI98384.1| glutamine-dependent NAD(+) synthase [Rhodospirillum centenum SW]
          Length = 559

 Score =  508 bits (1309), Expect = e-142,   Method: Composition-based stats.
 Identities = 259/556 (46%), Positives = 354/556 (63%), Gaps = 8/556 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L IA+AQ+NP VG +  N+ + R AR EA  +G DL++ +EL +SGYPPEDLV K 
Sbjct: 1   MTDSLTIALAQINPTVGALRANLDRIRTARAEAAARGADLVVLSELVVSGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F+     A++ L +DT DGG G+++G P ++     N+ ++LD G + AVR K +LPNY
Sbjct: 61  FFLDTVQQAVEELAADTGDGGPGLLLGAPWREAGRTHNAALLLDGGRVAAVRFKHDLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G    P+ FR +RLGI+ICED+W      + L + GAE L   N SP+ 
Sbjct: 121 GPFDEKRVFDPGPLPGPVSFRGVRLGIVICEDMWTPDV-AETLAETGAEILIVPNGSPFE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K  +R  +   +++   LP+ YVNQVGGQDEL+FDG SF  +  + LA Q+  F E  
Sbjct: 180 TDKADRRLSLAVARVTETGLPLAYVNQVGGQDELVFDGGSFVLNADRGLAAQLPSFEEHV 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T W      ++ +     +++ M  P +  EA Y A VL LRDYV+KN F  VI+GLS
Sbjct: 240 AITHW------TRGDGGWTCTSTEMTAPAEGLEAIYRAMVLGLRDYVRKNRFPGVILGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL AA+AVDALG + V  +M+P  YTS +SLEDAA CA+ LGC+ D + I   + 
Sbjct: 294 GGIDSALSAAVAVDALGADRVHCVMMPSPYTSRESLEDAAECAELLGCRIDTISIEPAMK 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F  ++     +    I  EN+QSR RG  LMALSN    M+L+T NKSE+SVGY TLYG
Sbjct: 354 AFEHMLEPAFADREPDITEENLQSRARGVTLMALSNKFGGMVLSTGNKSEMSVGYATLYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GG++ LKD+YKT V++L+ WRN        GP   VIP  I+ K+P+AEL+P QTDQ
Sbjct: 414 DMCGGYSVLKDVYKTTVYRLSHWRNRTLPRQAHGPAGRVIPERIITKAPTAELKPDQTDQ 473

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           ++LPPY ILDDI++ +VE +        + ++ ETV  V  +L  +EYKRRQAP G K+T
Sbjct: 474 DTLPPYEILDDILECLVEKDLGLAAIVARGHDRETVSRVWRMLDRAEYKRRQAPPGVKVT 533

Query: 540 AKSFGRDRLYPISNKF 555
           ++SFG+DR YPI++ F
Sbjct: 534 SRSFGKDRRYPITSGF 549


>gi|259416895|ref|ZP_05740815.1| glutamine-dependent NAD+ synthetase [Silicibacter sp. TrichCH4B]
 gi|259348334|gb|EEW60111.1| glutamine-dependent NAD+ synthetase [Silicibacter sp. TrichCH4B]
          Length = 552

 Score =  508 bits (1309), Expect = e-142,   Method: Composition-based stats.
 Identities = 241/558 (43%), Positives = 337/558 (60%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    +I +AQLNP VGD+AGN AKA  A +E    G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MADSFRITLAQLNPTVGDLAGNAAKALSAWQEGRESGADLVALPEMFITGYNTQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F QA  + ++ L + T + G  + +G P  +   + N+ +IL  G I +   K +LPN 
Sbjct: 61  AFHQAAIAEVEALAAATAE-GPALAIGSPWVEDGKLFNAYLILKGGKIASKCLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W      + L++ GAEFL   N SPYY
Sbjct: 120 TVFDEVRIFDAGPLGGPYSVGNTRIGSPICEDGWHEDV-AETLEETGAEFLLIPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K++ R+  +  +     LP+IY+N VGGQD+ +FDG +F  +    LA QM  F E  
Sbjct: 179 RGKMETRYNHMVARAVETGLPVIYLNMVGGQDDQVFDGGTFALNPHGALAVQMPVFDE-- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + +   ++    W     + A          E DY   VLSLRDY+ K  F K ++GLS
Sbjct: 237 CIAQLDLERTADGWRIKEGEKAHLP----DAWEQDYRTMVLSLRDYMGKTGFKKALLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ AAIAVDALG +NV+ +MLP +YTS  SLEDA A AKALG  YD +PI +   
Sbjct: 293 GGVDSAIVAAIAVDALGAQNVRCVMLPSEYTSKDSLEDAEAVAKALGVHYDYVPISEGRE 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++       + +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITNTLAPLFAGRDADLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVI P++++K PSAELR  Q D 
Sbjct: 413 DMNGGYNPIKDLYKTRVFETCRWRNANHRDWMMGPSGEVIRPNVIDKPPSAELREDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD I+  +V+ + S  +     ++ +  + VEHLLY SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPELDAILDILVDQDGSIADCVAAGFDRDVAKRVEHLLYISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 KRAFWLDRRYPIVNRWRD 550


>gi|99082118|ref|YP_614272.1| NAD synthetase [Ruegeria sp. TM1040]
 gi|99038398|gb|ABF65010.1| NAD+ synthetase [Ruegeria sp. TM1040]
          Length = 553

 Score =  508 bits (1309), Expect = e-142,   Method: Composition-based stats.
 Identities = 243/558 (43%), Positives = 335/558 (60%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    +I +AQLNP VGD+AGN AKA  A +E      DL+   E+FI+GY  +DLV K 
Sbjct: 2   MADSFRITLAQLNPTVGDLAGNAAKALSAWQEGRAADADLVALPEMFITGYNTQDLVMKP 61

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F QA  + ++ L   T + G  + +G P  +   + N+ +IL  G I +   K +LPN 
Sbjct: 62  AFHQAAIAEVEALAKATAE-GPALAIGSPWVEDGKLYNAYLILKGGKIASKCLKHHLPNE 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W      + L++ GAEFL   N SPYY
Sbjct: 121 TVFDEVRIFDAGPLGGPYSVGNTRIGSPICEDGWHEDV-AETLEETGAEFLLIPNGSPYY 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K++ R   +  +     LP+IY+N VGGQD+ +FDG SF  +    LA QM  F E  
Sbjct: 180 RGKMETRINHMVARAVETGLPVIYLNMVGGQDDQVFDGGSFALNPHGALAVQMPVFDE-- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + +   ++    W     + A          E DY   VLSLRDY+ K  F K ++GLS
Sbjct: 238 CIAQLDLERTADGWRIKEGEKAHLP----DAWEQDYRTMVLSLRDYMGKTGFKKALLGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ AAIAVDALG ENV+ +MLP +YTS +SLEDA A AKALG  YD +PI +   
Sbjct: 294 GGVDSAIVAAIAVDALGAENVRCVMLPSEYTSKESLEDAEAVAKALGVHYDYVPISEGRE 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++       + +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 354 AITNTLAPLFAGRDADLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVI P++++K PSAELR  Q D 
Sbjct: 414 DMNGGYNPIKDLYKTRVFETCRWRNANHRDWMMGPEGEVIRPNVIDKPPSAELREDQKDS 473

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD I+  +V+ E S  +     ++ +  + VEHLLY SEYKR Q+  G ++T
Sbjct: 474 DSLPDYPELDAILDILVDQEGSIADCVAAGFDRDVAKRVEHLLYISEYKRFQSAPGARLT 533

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 534 KRAFWLDRRYPIVNRWRD 551


>gi|150021282|ref|YP_001306636.1| NAD synthetase [Thermosipho melanesiensis BI429]
 gi|149793803|gb|ABR31251.1| NAD+ synthetase [Thermosipho melanesiensis BI429]
          Length = 574

 Score =  508 bits (1309), Expect = e-142,   Method: Composition-based stats.
 Identities = 226/581 (38%), Positives = 338/581 (58%), Gaps = 34/581 (5%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           K+++ I QLN  +GD  GN+ K   A + A +   D ++F ELF++GYPPEDLV + SF+
Sbjct: 2   KIRVTIVQLNAHLGDFDGNLKKIYNAIDIAEKNQSDFVVFPELFLTGYPPEDLVLRTSFL 61

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +     I+ + S + D    I++G+   + +   NS+ I+  G  +    K  LPNYS F
Sbjct: 62  KKNIEYINKIVSYSKDKKTVILIGYIDVEDDA-FNSLAIIHNGKFLGKYHKHLLPNYSVF 120

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E R F SG     I + +I++GI ICEDIW       +    G + + + +ASPY++ K
Sbjct: 121 DEHRYFKSGNEITIIEYNNIKIGINICEDIWSPIGPLHYQVLNGTQLIINSSASPYFYGK 180

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
            K R + ++ +    H PI+Y N VGGQDE++FDG S     +  + ++ K F E+    
Sbjct: 181 RKLRKKYLSTKSYDYHCPIVYCNLVGGQDEVVFDGGSIVTTSEGNIMYECKPFEEEIVTL 240

Query: 244 EWHYDQQLS--------------------------QWNYMSDDSASTMYIPLQEEEADYN 277
           +   ++ L                           +    +  + ST    L+ EE  + 
Sbjct: 241 DIPIEENLRTNLQDPRRRHISSTKIPNINIIKISNKIERKTKINVSTKNFSLKREEEIFK 300

Query: 278 ACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLE 337
           A  L LRDY+ KN F KV+IGLSGG+DS+L AAIAV+ALGK+NV  I++P  Y+S  S+E
Sbjct: 301 AVTLGLRDYIIKNGFKKVVIGLSGGMDSSLVAAIAVEALGKDNVLGILMPSMYSSSHSIE 360

Query: 338 DAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNH 397
           DA   A+ LG KY ++ I ++   F + + +        I  EN+Q+RIRG ILMA+SN 
Sbjct: 361 DAKNLAENLGIKYYIIKIENIYYSFVNELKEIFSNTKEDITEENLQARIRGTILMAISNK 420

Query: 398 SKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLT 457
              ++L T NKSEI+ GY TLYGDM GGF+P+KD+YKT V+++A W N            
Sbjct: 421 FGHIVLATGNKSEIATGYSTLYGDMVGGFSPIKDVYKTDVYKMAKWYNKF-------KGK 473

Query: 458 EVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQEYNDETVRY 517
           E+IP ++  K PSAELRP+Q DQ++LPPY ILD+I+K  +E E S     ++++ ETV+Y
Sbjct: 474 EIIPQNVFVKPPSAELRPNQKDQDTLPPYEILDEILKLYIEKELSVEEISEKFDKETVKY 533

Query: 518 VEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
           V  L+  +EYKRRQ  +G K++ +SFG+DR  PI++K+++ 
Sbjct: 534 VAKLVDKNEYKRRQGVIGVKVSERSFGKDRRMPITSKYKEW 574


>gi|163743987|ref|ZP_02151356.1| NAD synthetase [Phaeobacter gallaeciensis 2.10]
 gi|161382747|gb|EDQ07147.1| NAD synthetase [Phaeobacter gallaeciensis 2.10]
          Length = 552

 Score =  508 bits (1309), Expect = e-142,   Method: Composition-based stats.
 Identities = 243/558 (43%), Positives = 334/558 (59%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGD+AGN  KAR A       G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MADRFRVTLAQLNPTVGDLAGNANKAREAWAAGRDAGADLVALPEMFITGYNTQDLVQKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F QA  + ++ L +D  D G  + VG P      + N+ +IL  G I     K +LPN 
Sbjct: 61  VFHQAAIAEVERLAADCAD-GPALAVGSPWVADGKLFNAYLILKGGKITTQVLKHHLPNA 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W      + L + GAEFL   N SPY+
Sbjct: 120 TVFDEVRIFDAGPLGGPYAVGNTRIGSPICEDGWYEDV-AETLAETGAEFLLIPNGSPYF 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK+  R   +  +     LP+IY+N VGGQD+ +FDG SF  +    LA QM  F E  
Sbjct: 179 RNKMDVRFNHMVARAVETDLPVIYLNMVGGQDDQVFDGGSFVLNPGGALALQMPVFDEAI 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                  ++    W  +    AS       E E DY+   LSLRDY++K  F KV++GLS
Sbjct: 239 Q--HLDLERTAEGWRAVDGAKASLP----DEWEQDYHVMTLSLRDYMRKTGFKKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ A IAVDALG ENV+ +MLP +YTS +SL+DA A AKALG  YD +PI +   
Sbjct: 293 GGVDSAIVATIAVDALGAENVRCVMLPSEYTSQESLDDAEAVAKALGVHYDYVPIAEGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++        G+  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITNTLAPLFAGLDEGLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVI P++++K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFETCRWRNANHRDWMMGPEGEVIRPNVIDKPPSAELRDDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD +++ +V+ + S  +     ++ E  + VEHL+Y SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPELDALLEILVDRDGSIADCVAAGFSRENAKRVEHLIYISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 PRAFWLDRRYPIVNRWRD 550


>gi|254294201|ref|YP_003060224.1| NAD+ synthetase [Hirschia baltica ATCC 49814]
 gi|254042732|gb|ACT59527.1| NAD+ synthetase [Hirschia baltica ATCC 49814]
          Length = 553

 Score =  508 bits (1308), Expect = e-142,   Method: Composition-based stats.
 Identities = 261/560 (46%), Positives = 343/560 (61%), Gaps = 11/560 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  +L I  AQLN +VGD+  N+ KA  A +EA+  G DL++  ELF+ GYPPEDLV K 
Sbjct: 1   MSDRLTILSAQLNAIVGDVDANLEKAVGALKEAHACGADLVVLPELFLCGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG--VLNSVVILDAGNIIAVRDKINLP 118
           +  +AC  A   L S T   G GIVVG P  ++      NSV ++  G I A+R K  LP
Sbjct: 61  ALSKACLRAAHELASQTRQDGPGIVVGMPVWEEGQALPYNSVALIADGEIKALRHKYELP 120

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           NY  F EKRTF  G    P+ FR   LG+ ICEDIW  +     LK++GAE L S N SP
Sbjct: 121 NYDVFDEKRTFQQGPKPLPVGFRGFTLGLPICEDIWLEAVP-DALKEKGAEILLSPNGSP 179

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           +  N    R +  + Q + + LP++YVNQVGGQDEL FDG SF  D + ++  Q+  F E
Sbjct: 180 WRRNVRDARLKAFS-QWADLRLPLVYVNQVGGQDELAFDGESFAIDSRGRIVQQLPDFEE 238

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
              ++ W    + +    M  +          + E  Y A ++ L DYV+K  F  V+IG
Sbjct: 239 AYSVSVW----ERTPMGLMCVEGKKDEL--SSDLEETYLATMMGLGDYVRKTGFPGVLIG 292

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSA+ AAIAVDALG ENV  +M+P +YTS +SL DA  CA+ALG KYD + I   
Sbjct: 293 LSGGIDSAMVAAIAVDALGPENVWCVMMPSRYTSRESLLDAQQCAEALGVKYDNIQISSA 352

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           VN +  ++S+           ENIQSR+RG  LMALSN    M+ TT NKSE++VGY TL
Sbjct: 353 VNAYDEMLSEAFTGTTPDTTEENIQSRVRGVTLMALSNKFGHMVTTTGNKSEMAVGYATL 412

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM GG+NPLKD+YKT+VF+LA WRN++   +  GP   VIP +I+ K PSAELR  Q 
Sbjct: 413 YGDMCGGYNPLKDIYKTEVFELARWRNANVPKNAHGPYGIVIPENIISKPPSAELREDQK 472

Query: 479 DQESLPPYPILDDIIKRI-VENEESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           D++SLPPY ILDDI+  +    E       + + ++ VR ++ L+  +EYKRRQAP G K
Sbjct: 473 DEDSLPPYHILDDILYGLIEREESIEEIVSRGHFEDVVRRIDSLVRINEYKRRQAPPGVK 532

Query: 538 ITAKSFGRDRLYPISNKFRD 557
           I  K+FGR R YP+ N++RD
Sbjct: 533 IGDKNFGRGRRYPLVNRYRD 552


>gi|300023353|ref|YP_003755964.1| NAD+ synthetase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525174|gb|ADJ23643.1| NAD+ synthetase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 575

 Score =  508 bits (1308), Expect = e-141,   Method: Composition-based stats.
 Identities = 272/559 (48%), Positives = 354/559 (63%), Gaps = 9/559 (1%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IA+AQLN  VGD+AGN  +A  A  +A     D+I+F ELF++GYPPEDLV K +F  
Sbjct: 1   MRIALAQLNATVGDLAGNARRAAEAHAKAAALSADVIVFPELFLNGYPPEDLVLKPAFQD 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           A  + ++ L +   + G  I++G   +    V N+V +LD G I A+  K  LPNY  F 
Sbjct: 61  ATRAELERLATACAE-GPAILMGTIWRKDGKVYNAVALLDRGRIEAITAKAELPNYGVFD 119

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F SG    P+  R +R+G+ ICEDIW      + L + GAE + S N SP+  +K 
Sbjct: 120 EKRVFASGPMPGPLNVRGVRIGVPICEDIWTPEA-VETLAETGAEIIISPNGSPFDWHKP 178

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R  I   +++   LP+ Y+NQVGGQDEL+FDGASF  +G + LA Q+  + E   +TE
Sbjct: 179 DTRMNIAVARVTESGLPLAYLNQVGGQDELVFDGASFVLNGDRSLAVQLPAWREALVVTE 238

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           W +    S W   S + A           A Y+ACVL LRDYV KN F  V++GLSGGID
Sbjct: 239 WQH--TPSGWRCQSGEVAKL----SDGSAAAYDACVLGLRDYVDKNAFPGVVLGLSGGID 292

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL AAIAVDALG + V  +MLP K+TS  SL+DAA CAKALG +YD + I   V     
Sbjct: 293 SALVAAIAVDALGPDRVHAVMLPSKFTSDDSLQDAAECAKALGIRYDKVSIEPAVAGLTW 352

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        S I  EN+QSR+RG ILMA+SN   AML+TT NKSE+SVGY TLYGDM+G
Sbjct: 353 SLKDLFAGTNSDITEENLQSRVRGTILMAISNKFGAMLVTTGNKSEMSVGYATLYGDMNG 412

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GFNP+KDLYKT+V+ L+ WRN        GP   VIP  IL K+P+AELR +QTDQ+SLP
Sbjct: 413 GFNPIKDLYKTEVYALSRWRNEQRPDGAFGPQGIVIPERILTKAPTAELRANQTDQDSLP 472

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY  LDDI+  +VE E        + +  ETV+ VE LLY +EYKRRQA  G KI++++F
Sbjct: 473 PYDALDDILVSLVEKEMPVAAVIARGHTLETVKKVERLLYLAEYKRRQAAPGVKISSRNF 532

Query: 544 GRDRLYPISNKFRDHISEE 562
           GRDR YPI+N+FR+ +  E
Sbjct: 533 GRDRRYPITNRFREDVPSE 551


>gi|114762129|ref|ZP_01441597.1| NAD(+) synthase [Pelagibaca bermudensis HTCC2601]
 gi|114545153|gb|EAU48156.1| NAD(+) synthase [Roseovarius sp. HTCC2601]
          Length = 552

 Score =  508 bits (1308), Expect = e-141,   Method: Composition-based stats.
 Identities = 240/558 (43%), Positives = 337/558 (60%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ IAQLNP +GD+AGN A+A+ A E+A   G D++   E+FI+GY  +DL  K 
Sbjct: 1   MADRFRLTIAQLNPTMGDLAGNAAQAKDAWEQAKAAGADMVALPEMFIAGYNAQDLPMKH 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F   C +A+  L  D  D G  + +G P  +   + N+ +I   G ++    K +LPNY
Sbjct: 61  AFTLDCMAAVKALAEDCAD-GPSLGIGCPWVEGTELYNAYIICRGGKMVTQVFKHHLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F SG    P    + R+G  ICED W      + L + GAEFL   N SPY+
Sbjct: 120 NVFDELRIFDSGPIGGPYAVGNTRIGSPICEDAWYEDV-AETLAETGAEFLLVPNGSPYF 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK + R   +  ++    LP+IY+N VGGQD+ IFDG SF  +    +A Q+  F E  
Sbjct: 179 RNKYETRLNKMIARVVETGLPLIYLNMVGGQDDQIFDGGSFVLNPHGAVALQLPVFEEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     ++    W  +  D  +         E DY+A VL+LRDY +K  F KV++G+S
Sbjct: 238 -IAHVDLERTEDGWRALEGDFTTHP----DAMEQDYHAMVLALRDYCRKTGFGKVLLGMS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL A IAVDALG ENV+ +MLP +YTS  SLEDA ACA+ LGC YD +PI    +
Sbjct: 293 GGVDSALVATIAVDALGAENVRCVMLPSEYTSEHSLEDAKACAENLGCHYDFVPITPGRD 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +   + +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITETLAPLFEGRDADLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DMSGG+NP+KDLYKT+VF +  WRN++     +GP    IP  I+ K PSAELR  Q D 
Sbjct: 413 DMSGGYNPIKDLYKTRVFDICRWRNANARPWMMGPEAAPIPERIITKPPSAELRDDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I++ +V+++ S  +     Y+    + VEHLLY SEYKR Q+  G +++
Sbjct: 473 DSLPDYPVLDGILQILVDDDGSIADCVAAGYDRADAKKVEHLLYISEYKRFQSAPGARLS 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 KRAFWLDRRYPIVNRWRD 550


>gi|206602425|gb|EDZ38906.1| NAD+ synthase [Leptospirillum sp. Group II '5-way CG']
          Length = 592

 Score =  508 bits (1307), Expect = e-141,   Method: Composition-based stats.
 Identities = 231/602 (38%), Positives = 332/602 (55%), Gaps = 57/602 (9%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           ++KLK+A+AQ NP+VGDI+GN+A  +    +A  + +D+++F EL ++GYPPEDL+ K S
Sbjct: 1   MRKLKLALAQTNPIVGDISGNLAHIKDMIVQARSEHVDVVVFPELALTGYPPEDLLLKPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI     A+D L     +    ++VGF  +  + + N+  +L  G +  +  K  LPNY 
Sbjct: 61  FIDKNLRALDELLGFAPEL--LVLVGFVDRQDD-IYNAAAVLHGGKLHGIYRKQYLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQ-GAEFLFSLNASPYY 180
            F E R F  G  +  + +R  RLGI ICEDIW              AE + +L+ASP++
Sbjct: 118 VFDENRYFQEGVESPVLEYRSARLGINICEDIWYPKGPLYTQTLMGDAECILNLSASPFH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R  ++  +       I YVN VGGQDEL+FDG S       ++  + K F E  
Sbjct: 178 AGKREVRENMLCTRAVDSACYIAYVNMVGGQDELVFDGQSLVISPDGEIESRGKAFQEDL 237

Query: 241 FMTEWHYD------------------QQLSQWNYMSDDSASTMYI--------------- 267
            +TE   D                  Q L +  +  DD      I               
Sbjct: 238 LITEIDLDHVFRVRLHDPRRRKDRLSQSLDRPQWNQDDVLVRWKIEEPGRRQASGGTLPE 297

Query: 268 -----------PLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDAL 316
                      PL      Y A V  +RDYV+KN+F +V++GLSGGIDSAL AAIA DAL
Sbjct: 298 KKVLVKSPYTQPLDRLAEIYEALVTGVRDYVRKNSFREVLVGLSGGIDSALVAAIATDAL 357

Query: 317 GKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSG 376
           G E+V  + +P  +TS +S ED    +  L  + + +PI      F  ++S   Q+ P  
Sbjct: 358 GPEHVHGLFMPSMFTSQESYEDVLKLSGTLKVQVETIPIAAAFEQFLQILSPHFQDRPRD 417

Query: 377 IVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQ 436
              EN+QSRIRG +LMALSN    ++LTT NKSE+SVGY TLYGDM+GGF+ LKD+ KT 
Sbjct: 418 TAEENLQSRIRGLLLMALSNKFHWLVLTTGNKSEMSVGYQTLYGDMAGGFSVLKDVPKTL 477

Query: 437 VFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRI 496
           V+ LA + N+           ++IP  I+EK+P+AELRP+Q D +SLPPY ILD I++  
Sbjct: 478 VYDLADFLNTRR--------ADIIPHRIIEKAPTAELRPNQKDLDSLPPYEILDPIMEAY 529

Query: 497 VENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           VE+++ F     + ++  TV  V  L+  SEYKRRQ+P G K+T ++FG+D   PI+N+F
Sbjct: 530 VEDDQGFEEIIGKGFDPATVARVLSLIDKSEYKRRQSPPGIKLTLRAFGKDWRVPITNRF 589

Query: 556 RD 557
           ++
Sbjct: 590 KE 591


>gi|227356237|ref|ZP_03840626.1| glutamine-dependent NAD(+) synthetase [Proteus mirabilis ATCC
           29906]
 gi|227163701|gb|EEI48617.1| glutamine-dependent NAD(+) synthetase [Proteus mirabilis ATCC
           29906]
          Length = 538

 Score =  507 bits (1306), Expect = e-141,   Method: Composition-based stats.
 Identities = 234/556 (42%), Positives = 330/556 (59%), Gaps = 24/556 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KLK+A+AQLN VVGDI GN  +     +   ++  DL+LF+EL + GY PEDL+F+ 
Sbjct: 1   MSRKLKLALAQLNWVVGDIEGNCERMLATVK--AQEDADLVLFSELALCGYSPEDLLFRP 58

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C   +  L+  +      IVVG P      + N++     G + A   K  LPNY
Sbjct: 59  DFQQRCEEQLVRLEQASKK--TAIVVGHPWWQNGTIYNALSFFYQGELQARYFKQQLPNY 116

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G     + F+   LG+LICEDIW  +     LK+ GA+ + S+NASPY 
Sbjct: 117 GVFDEKRYFQQGNERCVVPFKGYHLGLLICEDIW-INEPIDALKQAGADLVLSINASPYS 175

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R +++       HLP++Y+NQ+GGQDEL+FDG S  FD +  +  ++  F EQ 
Sbjct: 176 REKPHIRTQLIKEHCQRTHLPVVYLNQIGGQDELVFDGCSKVFDERGTITHRLAAFDEQV 235

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + E+           ++          L      Y A VL+ RDYV KN F   I+GLS
Sbjct: 236 AVVEFD---------ELTIVPMQDAAPELSPLAQVYQALVLATRDYVTKNGFKGAILGLS 286

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDALGKE+VQ +M+P++YTS  S+ DA   A  LG ++D + I  + +
Sbjct: 287 GGIDSGLTVAIAVDALGKESVQAVMMPFRYTSEMSIHDAKEQADLLGVEFDTVSIEPMFD 346

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +S   +        EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 347 AFMDQLSPMFKGSAIDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 406

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+         L+  IP  ++++ PSAEL P QTDQ
Sbjct: 407 DMAGGFDVLKDVPKTLVFELAKYRNT---------LSPAIPQRVIDRPPSAELAPGQTDQ 457

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           ++LPPY ILD +++  VE ++S  +     +++  VR V  L+  +EYKRRQAPVG +IT
Sbjct: 458 DNLPPYDILDALLEGYVEQDKSVSDLVAAGFDEAIVRKVVKLVDINEYKRRQAPVGPRIT 517

Query: 540 AKSFGRDRLYPISNKF 555
           +++FG+DR YPI++ F
Sbjct: 518 SRNFGKDRRYPITSGF 533


>gi|197285726|ref|YP_002151598.1| NAD synthetase [Proteus mirabilis HI4320]
 gi|194683213|emb|CAR43877.1| glutamine-dependent NAD(+) synthetase [Proteus mirabilis HI4320]
          Length = 538

 Score =  507 bits (1305), Expect = e-141,   Method: Composition-based stats.
 Identities = 234/556 (42%), Positives = 330/556 (59%), Gaps = 24/556 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KLK+A+AQLN VVGDI GN  +     +   ++  DL+LF+EL + GY PEDL+F+ 
Sbjct: 1   MSRKLKLALAQLNWVVGDIEGNCERMLATVK--AQEDADLVLFSELALCGYSPEDLLFRP 58

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C   +  L+  +      IVVG P      + N++     G + A   K  LPNY
Sbjct: 59  DFQQRCEEQLVRLEQASKK--TAIVVGHPWWQNGTIYNALSFFYQGELQARYFKQQLPNY 116

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G     + F+   LG+LICEDIW  +     LK+ GA+ + S+NASPY 
Sbjct: 117 GVFDEKRYFQQGNERCVVPFKGYHLGLLICEDIW-INEPIDALKQAGADLVLSINASPYS 175

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R +++       HLP++Y+NQ+GGQDEL+FDG S  FD +  +  ++  F EQ 
Sbjct: 176 REKPHIRTQLIKEHCQRTHLPVVYLNQIGGQDELVFDGCSKVFDERGTITHRLAAFDEQV 235

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + E+           ++          L      Y A VL+ RDYV KN F   I+GLS
Sbjct: 236 AVVEFD---------ELTIVPMQDAAPELSPLAQVYQALVLATRDYVTKNGFKGAILGLS 286

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDALGKE+VQ +M+P++YTS  S+ DA   A  LG ++D + I  + +
Sbjct: 287 GGIDSGLTVAIAVDALGKESVQAVMMPFRYTSEMSIHDAKEQANLLGVEFDTVSIEPMFD 346

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +S   +        EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 347 AFMDQLSPMFKGSAVDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 406

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+         L+  IP  ++++ PSAEL P QTDQ
Sbjct: 407 DMAGGFDVLKDVPKTLVFELAKYRNT---------LSPAIPQRVIDRPPSAELAPGQTDQ 457

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           ++LPPY ILD +++  VE ++S  +     +++  VR V  L+  +EYKRRQAPVG +IT
Sbjct: 458 DNLPPYDILDALLEGYVEQDKSVSDLVAAGFDEAIVRKVVKLVDINEYKRRQAPVGPRIT 517

Query: 540 AKSFGRDRLYPISNKF 555
           +++FG+DR YPI++ F
Sbjct: 518 SRNFGKDRRYPITSGF 533


>gi|152967241|ref|YP_001363025.1| NAD+ synthetase [Kineococcus radiotolerans SRS30216]
 gi|151361758|gb|ABS04761.1| NAD+ synthetase [Kineococcus radiotolerans SRS30216]
          Length = 599

 Score =  507 bits (1305), Expect = e-141,   Method: Composition-based stats.
 Identities = 215/586 (36%), Positives = 311/586 (53%), Gaps = 39/586 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+AQ++  VGD+ GN+A        A + G  L+LF E  ++GYP EDL  + S
Sbjct: 1   MPQLRVAMAQVDTTVGDLDGNVAVILDWTRRAAQDGAHLVLFPETAVTGYPVEDLALRTS 60

Query: 62  FIQACSSAIDTLKSDTHD---GGAGIVVGFPRQDQEGVL-----------NSVVILDAGN 107
           F+ A   A+  L     D   G   +VVG+  +  E              N   +L  G 
Sbjct: 61  FVDASRRAVGRLARRLADDGFGDVTVVVGYVDRVGEDARPGAGGPRRLPQNCAAVLHGGR 120

Query: 108 IIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG 167
           ++A   K +LPNY  F E R F+ G     +  R + + + ICED+W++    +     G
Sbjct: 121 VVARYAKHHLPNYGVFDEYRIFVPGDDLLVVRVRGVDVAVAICEDLWQDGGPVQMAGDAG 180

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
           A  L  LNASPY  +K   R E+V  + +    PI YVN VGGQDEL+FDG S       
Sbjct: 181 AGLLAVLNASPYERDKDDVRLELVARRAAEAGCPIAYVNAVGGQDELVFDGDSLVVAAGG 240

Query: 228 QLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYI---------------PLQEE 272
            +  +   F E   +T+      ++   +       T+                 PL + 
Sbjct: 241 TVLARGPQFREALVVTDLDLPAGVTTPGWEEHVQRVTVTAEAVPAYEPRASEVLQPLPDV 300

Query: 273 EADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTS 332
              + A VL LRDYV+KN F  V++ +SGGIDSAL A++A DA+G ENV  I LP  Y+S
Sbjct: 301 AEVHGALVLGLRDYVRKNGFRSVVVAVSGGIDSALVASLACDAIGPENVLGISLPSGYSS 360

Query: 333 PQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILM 392
             S +DA   A   G +Y   PI  +V  F   +         G+  EN+Q+R+RG  +M
Sbjct: 361 QHSRDDAEDLANRCGFEYRQYPIAPMVEAFLGTVP------LRGVAEENLQARVRGTTIM 414

Query: 393 ALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSG 452
            ++N    + L TSNKSE++VGY TLYGD  GG+ PLKD+ KT V++L+ WRN+  ++ G
Sbjct: 415 GIANQEGHLTLATSNKSELAVGYSTLYGDSVGGYAPLKDVPKTLVWELSRWRNAEALSRG 474

Query: 453 LGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYN 511
             P    IP + + K PSAELRP QTDQ+SLPPY +LD I++  VE +       +  ++
Sbjct: 475 EQP---PIPENTITKPPSAELRPDQTDQDSLPPYEVLDAILEDYVEGDRGRAEMLEAGFD 531

Query: 512 DETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
              V  V  L+  +E+KRRQ   G KI+ K+FGRDR  PI+N++R+
Sbjct: 532 ATVVDSVVTLVDRAEWKRRQFAPGPKISYKAFGRDRRLPITNRWRE 577


>gi|238753908|ref|ZP_04615268.1| NAD+ synthase [Yersinia ruckeri ATCC 29473]
 gi|238707896|gb|EEQ00254.1| NAD+ synthase [Yersinia ruckeri ATCC 29473]
          Length = 549

 Score =  506 bits (1304), Expect = e-141,   Method: Composition-based stats.
 Identities = 232/556 (41%), Positives = 339/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 10  MSRSLSIALAQLNLLVGDIEGNTERMLQTLHEQQKAGADLVMFSELSLSGYPPEDLLYRS 69

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F   C + ++ L++ +      ++VG P ++ + + N++ +  AG ++    K  LPNY
Sbjct: 70  DFYLRCEAQLERLRAASQT--VAVLVGHPWREGDKLYNALSLFSAGKLLGRYFKQQLPNY 127

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G  +  +  +  RLG+LICED+W +       K  GAE L S+NASPY 
Sbjct: 128 GVFDEKRYFTPGDKSCVVELKGYRLGLLICEDLWFSEP-VDAAKAAGAELLLSINASPYN 186

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        +P++Y+NQVGGQDELIFDG S  FD +  +  ++  F+EQ 
Sbjct: 187 REKPYIRKTLMASHCQRTQMPLVYLNQVGGQDELIFDGCSKVFDSKGNMTHRLAAFAEQT 246

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +          Q   +  +  +     L      Y A VL++RDYV KN F   ++GLS
Sbjct: 247 TLC---------QLQDLVVEPMAAPAADLSPLAEVYEALVLAVRDYVTKNGFKGAVLGLS 297

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGKE VQ +M+P++YT+  S+ DA   A+ LG ++D+L I  + +
Sbjct: 298 GGIDSALTLAIAVDALGKEKVQALMMPFRYTADISIADAKEEAEILGIEFDLLSIEPMFD 357

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 358 AFMGQLAPMFAGTEKDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 417

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VFQL  +RN+         ++ VIP  ++++ PSAEL P Q DQ
Sbjct: 418 DMAGGFDVLKDVPKTLVFQLCEYRNT---------VSYVIPQRVIDRPPSAELAPDQLDQ 468

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE++ES  +     +++  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 469 DSLPPYDILDAILEGYVEHDESVADLVANGFDESIVRKVIRLVDINEYKRRQSAVGPRIT 528

Query: 540 AKSFGRDRLYPISNKF 555
           A+SFG+DR YPI++ F
Sbjct: 529 ARSFGKDRRYPITSGF 544


>gi|124514781|gb|EAY56293.1| NAD+ synthase [Leptospirillum rubarum]
          Length = 592

 Score =  506 bits (1302), Expect = e-141,   Method: Composition-based stats.
 Identities = 231/602 (38%), Positives = 330/602 (54%), Gaps = 57/602 (9%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           ++KLK+A+AQ NP+VGDI GN+A  +    +A  + +D+++F EL ++GYPPEDL+ K S
Sbjct: 1   MRKLKLALAQTNPIVGDIPGNLAHIKDMILQARSEHVDVVVFPELALTGYPPEDLLLKPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI     A+D L     +    ++VGF  +  + + N+  +L  G +  +  K  LPNY 
Sbjct: 61  FIDKNLRALDELLGFAPEL--LVLVGFVDRQDD-IYNAAAVLHGGKLHGIYRKQYLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQ-GAEFLFSLNASPYY 180
            F E R F  G  +  + +R  RLGI ICEDIW              AE + +L+ASP++
Sbjct: 118 VFDENRYFQEGVESPVLEYRSARLGINICEDIWYPKGPLYTQTLMGDAECILNLSASPFH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R  ++  +       I YVN VGGQDEL+FDG S       ++  + K F E  
Sbjct: 178 AGKREVRENMLCTRAVDSACYIAYVNMVGGQDELVFDGQSLVISPDGEIESRGKAFQEDL 237

Query: 241 FMTEWHYD------------------QQLSQWNYMSDDSASTMYI--------------- 267
            +TE   D                  Q L +  +  DD      I               
Sbjct: 238 LITEIDLDHVFRVRLHDPRRRKDRLSQSLDRPQWNQDDVLVRWKIEEAGRRQAPGGARPE 297

Query: 268 -----------PLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDAL 316
                      PL      Y A V  +RDYV+KN+F +V++GLSGGIDSAL AAIA DAL
Sbjct: 298 KKVLVKSPYTQPLDRLSEIYEALVTGVRDYVRKNSFREVLVGLSGGIDSALVAAIATDAL 357

Query: 317 GKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSG 376
           G E+V  + +P  +TS +S ED    +  L    + +PI      F  ++S   Q+ P  
Sbjct: 358 GAEHVHGLFMPSMFTSQESYEDVLKLSGTLKVHVETIPIGAAFEQFLQILSPHFQDRPRD 417

Query: 377 IVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQ 436
              EN+QSRIRG +LMALSN    ++LTT NKSE+SVGY TLYGDM+GGF+ LKD+ KT 
Sbjct: 418 TAEENLQSRIRGLLLMALSNKFHWLVLTTGNKSEMSVGYQTLYGDMAGGFSVLKDVPKTL 477

Query: 437 VFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRI 496
           V+ LA + N+           ++IP  I+EK+P+AELRP+Q D +SLPPY ILD I++  
Sbjct: 478 VYDLADFLNTRR--------ADIIPHRIIEKAPTAELRPNQKDLDSLPPYEILDPIMEAY 529

Query: 497 VENEESFINND-QEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           VE+++ F     + ++  TV  V  L+  SEYKRRQ+P G K+T ++FG+D   PI+N+F
Sbjct: 530 VEDDQGFEEIVGKGFDPATVARVLSLIDKSEYKRRQSPPGIKLTLRAFGKDWRVPITNRF 589

Query: 556 RD 557
           ++
Sbjct: 590 KE 591


>gi|144901045|emb|CAM77909.1| NH3-dependent NAD+ synthetase protein [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 552

 Score =  506 bits (1302), Expect = e-141,   Method: Composition-based stats.
 Identities = 258/560 (46%), Positives = 349/560 (62%), Gaps = 9/560 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L IA AQ+NPVVGD+AGN+A+ R AR +A   G  L++F EL +SGYPPEDLV K 
Sbjct: 1   MSDSLSIAFAQINPVVGDVAGNVARIRAARAQAAADGAQLVVFPELVVSGYPPEDLVLKS 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+ A   A++ L +DT D G  I+VG P +    + N+ ++LD G + A R K +LPNY
Sbjct: 61  AFLDAIEQAVEDLAADTADNGPAILVGAPWRVAGRLHNAALLLDHGRVAASRLKHHLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F  G    PI FR +RLG+L+CED+W +    + L + GAE L   N SP+ 
Sbjct: 121 GVFDEARVFAPGPVPGPIQFRGVRLGVLVCEDMWYSDV-AETLAECGAEILVVPNGSPFE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K+  R      +++   LP+IYVNQ+GGQDEL+FDGASF  D + ++  ++  ++EQ 
Sbjct: 180 LDKVGVRLSRAKERVAETGLPLIYVNQLGGQDELVFDGASFALDAKGEVMVRLPAWAEQV 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
             T WH      + +     +     IP + +E  Y A VL LRDYV KN F  V++GLS
Sbjct: 240 VTTRWH------KQDGAWSVAGPIAPIP-ERDEDLYQAMVLGLRDYVGKNGFPGVVLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL AA+A DALG + V  +M+P  YTS +SL+DAA  AK LGC+ D + I   + 
Sbjct: 293 GGIDSALAAAVAADALGADKVWCVMMPSPYTSQESLDDAAGVAKMLGCRLDNINIGPAMG 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F  +++       + I  EN+QSR RG  LMALSN    M+L+T NKSE+S GY TLYG
Sbjct: 353 AFDHMLAPHFAGTNADITEENLQSRARGVTLMALSNKFGPMVLSTGNKSEMSTGYATLYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GG+  LKD+YKT VF +  WRN +     LGP   V+P  ++ K PSAEL+P QTDQ
Sbjct: 413 DMCGGYAVLKDVYKTAVFAVCRWRNGNFPAGALGPNGPVMPERVITKPPSAELKPDQTDQ 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           ++LPPY +LD I+  ++E E S      + Y+D  VR +  +L  +EYKRRQAP G KIT
Sbjct: 473 DTLPPYDVLDGILSCLIEGELSVEATVAKGYDDAMVRRIWRMLDRAEYKRRQAPPGVKIT 532

Query: 540 AKSFGRDRLYPISNKFRDHI 559
            +SFG+DR YPI+N F   +
Sbjct: 533 GRSFGKDRRYPITNGFTRSV 552


>gi|27378891|ref|NP_770420.1| NAD synthetase [Bradyrhizobium japonicum USDA 110]
 gi|27352040|dbj|BAC49045.1| NAD synthetase [Bradyrhizobium japonicum USDA 110]
          Length = 585

 Score =  505 bits (1301), Expect = e-141,   Method: Composition-based stats.
 Identities = 276/567 (48%), Positives = 369/567 (65%), Gaps = 16/567 (2%)

Query: 1   MLKKLK---IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           M ++L    + +AQLNP VGD+ GN A+AR AR  A   G DL+LF ELFI+GYPPEDLV
Sbjct: 1   MTERLNAFAVTLAQLNPTVGDVEGNAARARAARVRAAADGADLVLFPELFIAGYPPEDLV 60

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
            K +F  AC +AI+ L  +T DGG  ++VG P  +   + N+  +LD G I  +R K NL
Sbjct: 61  QKPAFQAACRAAIEGLARETADGGPAMLVGTPWVEDGKLYNACALLDGGRIAGLRFKCNL 120

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIW-----KNSNICKHLKKQGAEFLF 172
           PNY  F EKR F  G +  P+  R +R+G+ ICEDIW        N+ + L + GAE + 
Sbjct: 121 PNYGVFDEKRLFARGPAAGPVTVRGVRIGVPICEDIWLDESEDYENVVETLAETGAEIIL 180

Query: 173 SLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQ 232
             N SPY  +K   R  +   +++   LP++Y+NQV GQDEL+FDGASF  +G   LA Q
Sbjct: 181 VPNGSPYARDKNDVRLSVAVARVTESGLPLVYLNQVCGQDELVFDGASFALNGDLSLAAQ 240

Query: 233 MKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNF 292
           +  F+E   +T   + +    W          +    + + ADY ACVL LRDYV KN F
Sbjct: 241 LPAFAES--ITTLRFTRNGEDWRCAG-----PIAAQPEGDHADYAACVLGLRDYVAKNGF 293

Query: 293 HKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDV 352
             V++G+SGGIDSALCAAIAVDALG + V  +MLPY+YT+  S+ DA   A  LG +Y+V
Sbjct: 294 PGVLLGISGGIDSALCAAIAVDALGADQVHGVMLPYRYTAASSIADAGELAGHLGIRYEV 353

Query: 353 LPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEIS 412
           LPI + V  F +++S   +  P  I  EN+Q+R RG +LMA+SN +  M++TT NKSE+S
Sbjct: 354 LPIAEAVTGFETILSGIFKNLPPDITEENLQARTRGTLLMAISNKTGLMVVTTGNKSEMS 413

Query: 413 VGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAE 472
           VGY TLYGDM+GGFNP+KD+YKTQVF+LA+ RNS     GLGP  EVIPP I+ + P+AE
Sbjct: 414 VGYATLYGDMNGGFNPIKDIYKTQVFRLAALRNSWRPEGGLGPAGEVIPPDIITRPPTAE 473

Query: 473 LRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQ 531
           LR +QTDQ+SLP Y +LD I++R+VE EE         ++ ETV  ++HLL  +EYKRRQ
Sbjct: 474 LRENQTDQDSLPTYDVLDAILERLVEREEPLDQIIAAGFDRETVTRIDHLLNVAEYKRRQ 533

Query: 532 APVGTKITAKSFGRDRLYPISNKFRDH 558
           A  G K+T ++FGRDR YPI+N+FRD 
Sbjct: 534 AAPGVKVTPRNFGRDRRYPITNRFRDK 560


>gi|206890265|ref|YP_002248293.1| NAD+ synthetase [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206742203|gb|ACI21260.1| NAD+ synthetase [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 571

 Score =  505 bits (1300), Expect = e-140,   Method: Composition-based stats.
 Identities = 217/585 (37%), Positives = 330/585 (56%), Gaps = 43/585 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +KK+++A+ Q+NP+VGDI GN +K    +E+A ++  D+I+F EL ++GY PEDL+F  S
Sbjct: 1   MKKIRLALCQINPIVGDIEGNFSKILSFKEKAVKEKADIIVFPELILTGYTPEDLLFYPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+  + A++ L  +  D    +++G P ++++ + NS VIL    +I    KI LPNYS
Sbjct: 61  FIKKANEALNKLIENVKDF--VMILGLPVKEED-LYNSAVILAEQKVIDTYHKIYLPNYS 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F SG       +  +  G+ ICEDI+  +         GAE + +++ASP+Y 
Sbjct: 118 VFDEMRYFKSGKRASVYEYSGVLFGVNICEDIFHPTLPSPIQASSGAELIINISASPFYA 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K +K+  +++ +   + + I Y+N VGGQDE++FDG S       ++    K F E   
Sbjct: 178 GKFEKKLRMLSTRAYDMGVFIAYLNTVGGQDEIVFDGRSMVISPSGEIITMGKAFEEDFI 237

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIP----------------------------LQEEE 273
           + +   ++              + +                              L EEE
Sbjct: 238 VVDLDLEEVTRVRMREPKIRWESEFERAEIIKISGEQKKSLAVQSLQPSAFSLKILSEEE 297

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             + A    LRDYV+KN F +V +GLSGGIDS+  A +A DALG + V  + +P +YTS 
Sbjct: 298 EIFKALKTGLRDYVEKNGFSRVCLGLSGGIDSSFVALVATDALGSDRVTGVFMPSRYTSR 357

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMA 393
           +S ED     K LG +   + I ++   +   ++   +  P     ENIQSRIRGNILMA
Sbjct: 358 ESKEDVYELVKNLGIELIEISIDEIFEEYLRRLADTFKGLPEDTTEENIQSRIRGNILMA 417

Query: 394 LSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGL 453
           +SN    +++TT NKSE++VGY TLYGDM+GGF  +KD+YKTQV+++A W          
Sbjct: 418 ISNKFGWLVITTGNKSEMAVGYATLYGDMAGGFAVIKDVYKTQVYRVAKW---------- 467

Query: 454 GPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYND 512
               + IP  I +K PSAELRP QTDQ++LPPY ILD+I+KR +E   S     +Q ++ 
Sbjct: 468 -ASRDRIPERIFKKPPSAELRPGQTDQDTLPPYEILDEILKRHIEKCMSEEEIVEQGFDR 526

Query: 513 ETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           +TVR V  ++  +E+KRRQ+P G KI+  S G+D  +PI+N+F +
Sbjct: 527 DTVRKVLRMVKKAEFKRRQSPPGIKISPVSLGKDWRFPITNRFGE 571


>gi|154706227|ref|YP_001424305.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii Dugway
           5J108-111]
 gi|154355513|gb|ABS76975.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii Dugway
           5J108-111]
          Length = 542

 Score =  504 bits (1299), Expect = e-140,   Method: Composition-based stats.
 Identities = 230/556 (41%), Positives = 324/556 (58%), Gaps = 20/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKK 60
           +KKL I  AQLN +VGDI GN      A  +A ++   DLILF EL I+ YPPEDL+F+ 
Sbjct: 1   MKKLVIVGAQLNFLVGDIEGNTQLIIDAANQAYQESKADLILFPELSITSYPPEDLLFRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +  +    A+ T+          +VVG+P        N   ++  G I+A   K  LPNY
Sbjct: 61  ALYRRVHQALQTIADKVK--NTTVVVGYPDFIDNKCYNKAAVIADGKIVATYAKHELPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G     I  + +++GILICED+W   N  K     GA+ +  +NASP+ 
Sbjct: 119 RVFDEKRYFAAGDQPCVIEIKGVKIGILICEDLW-LENPIKQSVAAGAQLIACINASPFA 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K   R +++T +    H+PI+Y+N VGGQDEL+FDG S  F+   +L  Q  +  E+ 
Sbjct: 178 QDKSHHRRDLLTKRTKRYHIPIVYLNLVGGQDELVFDGGSLVFNQHGELIQQGSYLKEEL 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              E+  D  L+               PL  EE  YN  VL +RDY+ KNNF   +IGLS
Sbjct: 238 ITVEFDIDDNLTILTKTP-----LPPEPLD-EEKIYNVLVLGVRDYINKNNFPGAVIGLS 291

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL  AIAVDA+G E V  +++P  +TS  S+EDA   AKAL  +   + I  +  
Sbjct: 292 GGVDSALTLAIAVDAIGSERVSGVLMPSPFTSTMSIEDAEGKAKALNVRTSTINIQPIFE 351

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +          +  EN+Q+RIRG +LMA+SN   A++LTT NKSE++VGY TLYG
Sbjct: 352 AFIRSLESEFTGLGKDVTEENLQARIRGTLLMAISNKKGAIVLTTGNKSEMAVGYATLYG 411

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  LKD+YKT V++L  +RN+         ++ VIP  +LE+ PSAEL P Q DQ
Sbjct: 412 DMAGGFGVLKDVYKTMVYRLCRYRNT---------ISRVIPERVLERPPSAELAPDQKDQ 462

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           + LPPY ILD+I++R +  +E         ++ E V+ V  ++  +EYKRRQAP+G +IT
Sbjct: 463 DVLPPYHILDEILERYIAKDEDPTAIAAGGFDVEMVKKVVRMINRNEYKRRQAPIGIRIT 522

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 523 ERAFGKDRRYPITSGF 538


>gi|85715402|ref|ZP_01046384.1| NAD(+) synthase [Nitrobacter sp. Nb-311A]
 gi|85697823|gb|EAQ35698.1| NAD(+) synthase [Nitrobacter sp. Nb-311A]
          Length = 583

 Score =  504 bits (1299), Expect = e-140,   Method: Composition-based stats.
 Identities = 275/564 (48%), Positives = 361/564 (64%), Gaps = 14/564 (2%)

Query: 1   ML-KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFK 59
           M     KI + QLNP VGDIAGN AKAR AR +A   G  L+   ELFI+GYPPEDLV +
Sbjct: 1   MTETTFKITLGQLNPTVGDIAGNAAKARAARAQAKADGAALLALPELFIAGYPPEDLVLR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
            +F  AC  AI+ L  +T DGG  +++G P  D   + N+  +LD G + A+R K+NLPN
Sbjct: 61  PAFQAACREAIEDLARETSDGGPAMLIGTPWVDDGKLYNAYALLDEGRVAAIRFKVNLPN 120

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWK-----NSNICKHLKKQGAEFLFSL 174
           Y  F EKR F  G    P+  R +R+G+ ICED W        NI + L + GAE L   
Sbjct: 121 YGVFDEKRVFARGPVGGPLKIRGVRIGVPICEDTWVEESAEYENIVECLAETGAEILIVP 180

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           N SPY   K   R  I   +++   LP++Y+NQVGGQDEL+FDGASF  +    LA Q  
Sbjct: 181 NGSPYAKGKSDIRLSISVARVTESDLPLVYLNQVGGQDELVFDGASFVLNADCSLAAQFP 240

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHK 294
            F E   +    + +    W          +   ++ +EADY ACVL LRDYV+KN F  
Sbjct: 241 AFEES--IVTLQWTRSAEGWRCTG-----PVAPQIEGDEADYAACVLGLRDYVRKNGFPC 293

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
           V++G+SGGIDSALCAAIAVDALG E V+ +MLP ++T+  SL+DAA  A ALG +Y+VLP
Sbjct: 294 VLLGVSGGIDSALCAAIAVDALGAERVRGVMLPSRFTAQVSLDDAARLATALGIRYEVLP 353

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I   V  F  ++S      P     EN+QSR RG +LMA+SN + AML+TT NKSE+SVG
Sbjct: 354 IAPAVEGFEKILSATFAGLPRDTTEENLQSRARGTLLMAISNKTGAMLVTTGNKSEMSVG 413

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
           Y TLYGDM+GGFNP+KD++KT+VF+LAS RN+       GP  EVIPPSI+ + P+AELR
Sbjct: 414 YATLYGDMNGGFNPIKDIFKTEVFRLASLRNAWKPDGAFGPSGEVIPPSIIARPPTAELR 473

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAP 533
            +Q DQ+SLPPY +LD I++R+VE EE   +     ++ + +  V+ LL  +EYKRRQA 
Sbjct: 474 ENQLDQDSLPPYELLDAILERLVEREEPLASIVAEGFDRDVIVRVDRLLNAAEYKRRQAA 533

Query: 534 VGTKITAKSFGRDRLYPISNKFRD 557
            G K+T ++FGRDR YPI+N+FRD
Sbjct: 534 PGVKVTRRNFGRDRRYPITNRFRD 557


>gi|165918537|ref|ZP_02218623.1| NAD+ synthetase [Coxiella burnetii RSA 334]
 gi|212212687|ref|YP_002303623.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii CbuG_Q212]
 gi|165917783|gb|EDR36387.1| NAD+ synthetase [Coxiella burnetii RSA 334]
 gi|212011097|gb|ACJ18478.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii CbuG_Q212]
          Length = 542

 Score =  504 bits (1299), Expect = e-140,   Method: Composition-based stats.
 Identities = 230/556 (41%), Positives = 324/556 (58%), Gaps = 20/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKK 60
           +KKL I  AQLN +VGDI GN      A  +A ++   DLILF EL I+ YPPEDL+F+ 
Sbjct: 1   MKKLVIVGAQLNFLVGDIEGNTQLIIDAANQAYQESKADLILFPELSITSYPPEDLLFRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +  +    A+ T+          +VVG+P        N   ++  G I+A   K  LPNY
Sbjct: 61  ALYRRVHQALQTIADKVK--NTTVVVGYPDFIDNKCYNKAAVITDGKIVATYAKHELPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G     I  + +++GILICED+W   N  K     GA+ +  +NASP+ 
Sbjct: 119 RVFDEKRYFAAGDQPCVIEIKGVKIGILICEDLW-LENPIKQSVAAGAQLIACINASPFA 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K   R +++T +    H+PI+Y+N VGGQDEL+FDG S  F+   +L  Q  +  E+ 
Sbjct: 178 QDKSHHRRDLLTKRTKRYHIPIVYLNLVGGQDELVFDGGSLVFNQHGELIQQGSYLKEEL 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              E+  D  L+               PL  EE  YN  VL +RDY+ KNNF   +IGLS
Sbjct: 238 ITVEFDIDDNLTILTKTP-----LPPEPLD-EEKIYNVLVLGVRDYINKNNFPGAVIGLS 291

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL  AIAVDA+G E V  +++P  +TS  S+EDA   AKAL  +   + I  +  
Sbjct: 292 GGVDSALTLAIAVDAIGSERVSGVLMPSPFTSTMSIEDAEGEAKALNVRTSTINIQPIFE 351

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +          +  EN+Q+RIRG +LMA+SN   A++LTT NKSE++VGY TLYG
Sbjct: 352 AFIRSLESEFTGLGKDVTEENLQARIRGTLLMAISNKKGAIVLTTGNKSEMAVGYATLYG 411

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  LKD+YKT V++L  +RN+         ++ VIP  +LE+ PSAEL P Q DQ
Sbjct: 412 DMAGGFGVLKDVYKTMVYRLCRYRNT---------ISRVIPERVLERPPSAELAPDQKDQ 462

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           + LPPY ILD+I++R +  +E         ++ E V+ V  ++  +EYKRRQAP+G +IT
Sbjct: 463 DVLPPYHILDEILERYIAKDEDPTAIAAGGFDVEMVKKVVRMINRNEYKRRQAPIGIRIT 522

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 523 ERAFGKDRRYPITSGF 538


>gi|88800780|ref|ZP_01116337.1| NAD synthase [Reinekea sp. MED297]
 gi|88776486|gb|EAR07704.1| NAD synthase [Reinekea sp. MED297]
          Length = 538

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 234/552 (42%), Positives = 329/552 (59%), Gaps = 19/552 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+A+AQ    VGDI GN+ K      EA  QG D+I+F EL ++GYPPEDL+ + S  +
Sbjct: 1   MKLALAQQRFPVGDIDGNVDKILTLSREAMAQGADMIVFPELTLTGYPPEDLLLRPSLAK 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
             S A+  L          +VVG+P+++   + N V+++  G +IA   K +LPNY  F 
Sbjct: 61  RVSQAMHRLFD--ARLPIAMVVGYPQREDGKLYNKVMVISEGQVIADYRKQHLPNYQVFD 118

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G       F   R+G+ ICEDIW +    +   + GA+   ++N SPY  N+ 
Sbjct: 119 EKRYFQKGDQTCVFDFMGARIGLSICEDIWYDGP-ARRAYEAGAQINLNINGSPYSINRT 177

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +RHE VT  +S   +  +YVN VGGQDEL+FDG SF       +   +  F E     E
Sbjct: 178 AERHEQVTRVVSQWPMATVYVNHVGGQDELVFDGGSFVVGADATVQASLPEFQEALQYVE 237

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
               Q+ + W   S +    +  P+  E A Y A    L DYV +N F  V++G+SGGID
Sbjct: 238 LT--QEANGWQVKSGE----VTPPMSVEAALYEALKTGLADYVNRNRFPGVVLGMSGGID 291

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL AAIAVDALG + V  +M+PY YT+  SLEDA   A+ LG +Y+VLPI +      +
Sbjct: 292 SALSAAIAVDALGPDRVMGVMMPYHYTAKISLEDAEDEARRLGIRYEVLPIGEAFEAALT 351

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +     + P+ +  +N+QSR+RG  LMALSN +  M+LTT NKSE++VGY TLYGDM G
Sbjct: 352 TLQPQFGDRPADVTEQNMQSRMRGLFLMALSNKTGNMVLTTGNKSEMAVGYATLYGDMCG 411

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           G+N LKD+ K  V++L+ WRNS           EVIP  ++ + PSAEL P Q D++SLP
Sbjct: 412 GYNCLKDVPKLWVYRLSRWRNS---------FGEVIPERVITRPPSAELAPDQLDEDSLP 462

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY +LD II+R VE++ES     +  +N++ V+ V  L+  +EYKRRQAP G ++T + F
Sbjct: 463 PYEVLDAIIERYVEHDESQQTIIESGFNEDDVKRVIRLIDLNEYKRRQAPEGVRVTKRGF 522

Query: 544 GRDRLYPISNKF 555
           GRDR YPI++ +
Sbjct: 523 GRDRRYPITHGW 534


>gi|123441385|ref|YP_001005372.1| NAD synthetase [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|122088346|emb|CAL11137.1| putative glutamine-dependent NAD [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 540

 Score =  504 bits (1298), Expect = e-140,   Method: Composition-based stats.
 Identities = 233/556 (41%), Positives = 341/556 (61%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRKLSIALAQLNWLVGDIEGNTERMLQTLHEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++ T      ++VG P +++  + N++ +   G ++    K  LPNY
Sbjct: 61  DFYQRCEAQLDRLQAATQQ--TAVLVGHPWREEGNLYNALSLFADGKLLGRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+    +  +  RLG+LICED+W +      +K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHDTCVVELKGYRLGLLICEDLWFDGP-VDAVKAAGAEIVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                     L Q+N             L      Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 ---------TLLQFNECEVVPMMAPAAELPPLAQVYEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +S            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLSPMFAGTARDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   + +++  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVAEGFDETIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|332162672|ref|YP_004299249.1| NAD synthetase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318606778|emb|CBY28276.1| nad synthetase; Glutamine amidotransferase chain of NAD synthetase
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325666902|gb|ADZ43546.1| NAD synthetase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 540

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 232/556 (41%), Positives = 340/556 (61%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRKLSIALAQLNWLVGDIEGNTERMLQTLHEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++ T      ++VG P +++  + N++ +   G ++    K  LPNY
Sbjct: 61  DFYQRCEAQLDRLQAATQQ--TAVLVGHPWREEGNLYNALSLFADGKLLGRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+    +  +  RLG+LICED+W +      +K   AE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHDTCVVELKGYRLGLLICEDLWFDGP-VDAVKAARAEIVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                     L Q+N             L      Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 ---------TLLQFNECEVVPMMAPAAELPPLAQVYEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +S            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLSPMFAGTARDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   + +++  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVAEGFDETIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|254463160|ref|ZP_05076576.1| glutamine-dependent NAD(+) synthetase [Rhodobacterales bacterium
           HTCC2083]
 gi|206679749|gb|EDZ44236.1| glutamine-dependent NAD(+) synthetase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 557

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 240/558 (43%), Positives = 335/558 (60%), Gaps = 9/558 (1%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
             + +I + QLNP +GDIAGN AKAR A E     G DL+   E+FI GY  +DLV K +
Sbjct: 7   SDRFRITLGQLNPTMGDIAGNAAKARTAWEAGRDAGADLVALPEMFILGYNSQDLVMKPA 66

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
              AC +AI+ L  +    G  + +G P  +   + N+  I   G I +   K NLPN  
Sbjct: 67  VQAACLAAIEALAVECA-HGPALAIGGPAVEDGKLFNAYFICRGGKISSKSLKHNLPNED 125

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F SG    P    + R+G  ICED W      + L++ GAEFL   N SPYY 
Sbjct: 126 VFDEVRIFDSGPLGGPYSVGNTRIGSPICEDAWHEEV-AETLEETGAEFLLVPNGSPYYR 184

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K   R   +  ++    LP+IY+N VGGQD+ +FDG SF  +   +LA QM  F E   
Sbjct: 185 GKFDVRMNQMVSRVVETGLPLIYLNMVGGQDDQVFDGGSFALNPGGKLAIQMPVFDE--L 242

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           ++     +    W     +            E DY  CV +LRDY+ K  F KV++G+SG
Sbjct: 243 ISHVDLTRTDEGWRVDDGEKTIIPGQ----FEQDYRVCVTALRDYMSKTGFKKVLLGMSG 298

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSAL A IAVDALG ENV+ +MLP +YTS  SL+DA  CA+ +G +Y+ +PI +  + 
Sbjct: 299 GIDSALVATIAVDALGGENVRCVMLPSEYTSQGSLDDAKDCAERIGAEYNFVPISEGRDA 358

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
             + ++   +   + +  ENIQSR+RG +LMA+SN   +MLLTT NKSE++VGY T+YGD
Sbjct: 359 ITNTLAPLFEGLEADVTEENIQSRLRGLLLMAMSNKFGSMLLTTGNKSEVAVGYATIYGD 418

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           MSGG+NP+KD+YK +VF++  WRN +     +GP  EV+PPSI++K PSAELRP Q D +
Sbjct: 419 MSGGYNPIKDMYKVRVFEVCRWRNENHFEWMMGPKGEVVPPSIIDKPPSAELRPDQKDSD 478

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLP YP+LD I++ +V+++ S        Y+   V+ +EHLLY SEYKR Q+  GT+++ 
Sbjct: 479 SLPDYPVLDGILEMLVDDDASVAQCVAAGYDRAVVKKIEHLLYISEYKRFQSAPGTRLSR 538

Query: 541 KSFGRDRLYPISNKFRDH 558
           ++F  DR YPI N++RD+
Sbjct: 539 RAFWLDRRYPIVNRWRDN 556


>gi|153209220|ref|ZP_01947286.1| NAD+ synthetase [Coxiella burnetii 'MSU Goat Q177']
 gi|212218339|ref|YP_002305126.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii CbuK_Q154]
 gi|120575475|gb|EAX32099.1| NAD+ synthetase [Coxiella burnetii 'MSU Goat Q177']
 gi|212012601|gb|ACJ19981.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii CbuK_Q154]
          Length = 542

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 230/556 (41%), Positives = 324/556 (58%), Gaps = 20/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKK 60
           +KKL I  AQLN +VGDI GN      A  +A ++   DLILF EL I+ YPPEDL+F+ 
Sbjct: 1   MKKLVIVGAQLNFLVGDIEGNTQLIIDAANQAYQESKADLILFPELSITSYPPEDLLFRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +  +    A+ T+          +VVG+P        N   ++  G I+A   K  LPNY
Sbjct: 61  ALYRRVHQALQTIADKVK--NTTVVVGYPDFIDNKCYNKAAVITDGKIVATYAKHELPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G     I  + +++GILICED+W   N  K     GA+ +  +NASP+ 
Sbjct: 119 RVFDEKRYFAAGDQPCVIEIKGVKIGILICEDLW-LENPIKQSVAAGAQLIACINASPFA 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K   R +++T +    H+PI+Y+N VGGQDEL+FDG S  F+   +L  Q  +  E+ 
Sbjct: 178 QDKSHHRRDLLTKRTKRYHIPIVYLNLVGGQDELVFDGGSLVFNQHGELIQQGSYLKEEL 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              E+  D  L+               PL  EE  YN  VL +RDY+ KNNF   +IGLS
Sbjct: 238 ITVEFDIDDNLTILTKTP-----LPPEPLD-EEKIYNVLVLGVRDYINKNNFPGAVIGLS 291

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL  AIAVDA+G E V  +++P  +TS  S+EDA   AKAL  +   + I  +  
Sbjct: 292 GGVDSALTLAIAVDAIGSERVSGVLMPSPFTSTISIEDAEGEAKALNVRTSTINIQPIFE 351

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +          +  EN+Q+RIRG +LMA+SN   A++LTT NKSE++VGY TLYG
Sbjct: 352 AFIRSLESEFTGLGKDVTEENLQARIRGTLLMAISNKKGAIVLTTGNKSEMAVGYATLYG 411

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  LKD+YKT V++L  +RN+         ++ VIP  +LE+ PSAEL P Q DQ
Sbjct: 412 DMAGGFGVLKDVYKTMVYRLCRYRNT---------ISRVIPERVLERPPSAELAPDQKDQ 462

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           + LPPY ILD+I++R +  +E         ++ E V+ V  ++  +EYKRRQAP+G +IT
Sbjct: 463 DVLPPYHILDEILERYIAKDEDPTAIAAGGFDVEMVKKVVRMINRNEYKRRQAPIGIRIT 522

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 523 ERAFGKDRRYPITSGF 538


>gi|126737475|ref|ZP_01753210.1| NAD synthetase [Roseobacter sp. SK209-2-6]
 gi|126722060|gb|EBA18763.1| NAD synthetase [Roseobacter sp. SK209-2-6]
          Length = 552

 Score =  504 bits (1297), Expect = e-140,   Method: Composition-based stats.
 Identities = 242/559 (43%), Positives = 342/559 (61%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I++AQLNP VGD+ GN AKAR+A  E  +   DL+   E+F++GY  +DLV K 
Sbjct: 1   MADRFRISLAQLNPTVGDLDGNAAKARQAWTEGRKAKADLVALPEMFLTGYNAQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F  A  +  + L  D  D G  + +G P  +   + N+ +IL  G I +   K +LPN 
Sbjct: 61  VFHLAAMAKAEELAKDCAD-GPALAIGCPWVEDGKLYNAYLILKDGKIASRCLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W      + L++ GAEFL   N SPY+
Sbjct: 120 TVFDEVRIFDAGPLGGPYAVGNTRIGSPICEDGWHEDV-AETLEETGAEFLLIPNGSPYF 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK++ R   +  +     LP+IY+N VGGQD+ +FDG SF  +    LA QM  F E  
Sbjct: 179 RNKMEVRQNHMVARAVETGLPVIYLNMVGGQDDQVFDGGSFVLNPNGALALQMPVFDE-- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            MT+   ++    W  +  + A        E E DY   V +LRDY++K+ F KV++GLS
Sbjct: 237 CMTQLDLERAPEGWRAIEGEKAHLP----DEWEQDYRVMVEALRDYLRKSGFQKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ AAIAVDA+G ENV+ +MLP +YTS +SL+DA A A+ALG  YD +PI +   
Sbjct: 293 GGVDSAIVAAIAVDAIGAENVRCVMLPSEYTSRESLDDAEAVAEALGVHYDYVPITEGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++   +   + +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITNTLAPLFEGRDADLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN +     +GP  EVI P++++K PSAELR  Q D 
Sbjct: 413 DMNGGYNPIKDLYKTRVFETCRWRNDNHRPWMMGPAGEVIRPNVIDKPPSAELRDDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD I++ +V+ + S  +     +  ET + VEHL+Y SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPELDAILEILVDQDGSIADCVAAGFEAETAKRVEHLVYISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++F  DR YPI N+FRD 
Sbjct: 533 PRAFWLDRRYPIVNRFRDQ 551


>gi|163783722|ref|ZP_02178709.1| NH(3)-dependent NAD+ synthetase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881047|gb|EDP74564.1| NH(3)-dependent NAD+ synthetase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 567

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 224/577 (38%), Positives = 319/577 (55%), Gaps = 35/577 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L + +AQ+NPVVGDI GN+ K R +          LI+F EL +SGY PEDL+ +  F++
Sbjct: 2   LNVTLAQVNPVVGDIEGNVEKIRESVARCEDT-SHLIVFPELVVSGYFPEDLLLRIDFVR 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
            C  A++ L     D  + +VVG P      + NS+ +L  G ++ V  K  LPNYS F 
Sbjct: 61  KCMEAVEELAKSLKDAKSLVVVGAP-FYGGDLYNSLYLLYGGEVVGVYHKGRLPNYSVFD 119

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G     +    I+LG  ICEDIW   ++ +     GAE + ++NASPY+  K 
Sbjct: 120 EKRYFREGEDPLLVELNGIKLGFSICEDIWYPDHLERLSVLSGAEVIVNINASPYHIGKH 179

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           + R   V  +       ++Y N VGG DEL+FDG S   D   ++  + K F E      
Sbjct: 180 EFREGFVRARAEDNICFVLYANLVGGHDELVFDGRSMVVDPLGRVVGRAKSFEEDLLTLS 239

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEA-----------------------DYNACVL 281
              D+   +         ++  I     EA                        Y A VL
Sbjct: 240 IDVDKVRRRRLLDLRWRNASREIDPFPVEASIELPDKPYVEPRLEESPSEEEEVYRAVVL 299

Query: 282 SLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAA 341
              DYV KN F KV+IGLSGG+DS+L A IA DALG + V  + +P +++S +S EDA  
Sbjct: 300 GTHDYVVKNGFSKVVIGLSGGMDSSLTACIATDALGADKVLGVFMPSRFSSKESFEDAKT 359

Query: 342 CAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAM 401
            A  LG ++  +PI ++   +   +   L E       ENIQ+RIR NIL  +SN    +
Sbjct: 360 LADNLGIEFHTVPIDEVYVAYHDELLPVLGEIEFDTADENIQARIRANILFYISNKLGHL 419

Query: 402 LLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIP 461
           +L+TSNKSE + GY T+YGDMSGGF PLKDLYKT +++LA +RNS         L+ VIP
Sbjct: 420 VLSTSNKSESATGYTTIYGDMSGGFAPLKDLYKTTIYKLARYRNS---------LSPVIP 470

Query: 462 PSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEH 520
             + +K PSAELRP+QTDQ++LPPY +LD+I+K  +E+  S  +   + Y+  TV  V  
Sbjct: 471 ERVFQKPPSAELRPNQTDQDTLPPYEVLDEILKMYLEDNVSPEDIVKKGYDRGTVFKVVK 530

Query: 521 LLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           ++  +EYKR+QAPVG K+T+++FG+D   PI+N++  
Sbjct: 531 MVRRAEYKRKQAPVGVKVTSRAFGKDWRMPITNRYER 567


>gi|330966002|gb|EGH66262.1| glutamine-dependent NAD+ synthase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 535

 Score =  503 bits (1296), Expect = e-140,   Method: Composition-based stats.
 Identities = 229/550 (41%), Positives = 326/550 (59%), Gaps = 20/550 (3%)

Query: 9   IAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSFIQACS 67
           +AQLN  VGD+ GN+ K  +A + A    G  +I+F EL + GYPPEDL+ + S      
Sbjct: 1   MAQLNIRVGDVHGNVEKIIKAAQTARDDLGAHVIVFPELTLCGYPPEDLLLRSSMQSRIE 60

Query: 68  SAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKR 127
            A+  ++      G  IV+GFP  +     NS  ++  G  +A   K  LPNY  F EKR
Sbjct: 61  KALARVREAAR--GIVIVIGFPWVEDGARYNSCAVISEGEEVARYYKQRLPNYRVFDEKR 118

Query: 128 TFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKR 187
            F SG     +    I++GI ICEDIW +    K     GA+ + +LNASP++  K  +R
Sbjct: 119 YFESGSGPCVVNLFGIQVGITICEDIWFSEP-LKQACDAGAQIMLTLNASPFHRGKQAER 177

Query: 188 HEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHY 247
             ++  +     +P++YVNQVGGQDEL+FDG SF  DG  ++  +   F E  ++T++  
Sbjct: 178 EALLAQRADECSIPMMYVNQVGGQDELVFDGNSFVVDGNGKVTQRAPAFEEGLYVTDFDC 237

Query: 248 DQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSAL 307
                  +        T+   L  E + Y A V  ++DYV +N F  V++GLSGGIDSAL
Sbjct: 238 ------TDNSLVPVPGTVTELLSLEASVYQALVSGVKDYVHRNGFKGVVLGLSGGIDSAL 291

Query: 308 CAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMS 367
             A+A DALG ENV+ +M+PY YT+  S +DA   A  LG KY VLPI  +V  F S ++
Sbjct: 292 VLAVAADALGAENVEAVMMPYHYTAQMSQDDAREEADILGVKYSVLPIASMVEAFLSTLA 351

Query: 368 QFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFN 427
              +        EN+Q+R RG +LMA+SN  + ++LTT NKSE++VGY TLYGDM+GGF+
Sbjct: 352 PMFEGLGKDTTEENLQARCRGTMLMAISNKKRYLVLTTGNKSEMAVGYATLYGDMAGGFD 411

Query: 428 PLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYP 487
            LKD+ KT VF+L  +RN+         L  VIP  ++++ PSAEL P Q D++SLPPYP
Sbjct: 412 VLKDVPKTLVFKLCEYRNT---------LDYVIPQRVIDRPPSAELAPDQKDEDSLPPYP 462

Query: 488 ILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRD 546
           +LD+I++  VE + S     ++ ++ E VR V  L+  +EYKRRQA VG +IT + FGRD
Sbjct: 463 VLDEILRLYVEQDLSADAIIEEGFDTEVVRKVIRLVDLNEYKRRQAAVGPRITERGFGRD 522

Query: 547 RLYPISNKFR 556
           R YPI++ +R
Sbjct: 523 RRYPITSGWR 532


>gi|300087867|ref|YP_003758389.1| NAD+ synthetase [Dehalogenimonas lykanthroporepellens BL-DC-9]
 gi|299527600|gb|ADJ26068.1| NAD+ synthetase [Dehalogenimonas lykanthroporepellens BL-DC-9]
          Length = 541

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 217/557 (38%), Positives = 323/557 (57%), Gaps = 20/557 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  +++A+AQ+N  VGD  GN++  RR  ++A   G  L++F E+ +SGYPPEDL+ K S
Sbjct: 1   MNDIRLALAQINTTVGDYVGNVSLIRRYLKDAADGGAGLVVFPEMAVSGYPPEDLLHKPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+A   A+  +      G    VVGF     +G+ N+  ++  G I  +  K +LPNY 
Sbjct: 61  FIEAGQQALAEVAGTV--GDLTAVVGFVDTAPDGLYNAAAVIHQGEIRHIYHKRHLPNYG 118

Query: 122 EFHEKRTFISGYSNDPIV-FRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
            F E+R F  G           +RLG+ +CEDIW++        + GA+ + +++ASP++
Sbjct: 119 VFDEQRYFKPGDDCPVFEGTGGLRLGVNVCEDIWRDDGPMVVQSRDGADIIINISASPFH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R  ++  + +   +P+++ N VGGQDEL+FDGAS   D   ++  + + F E+ 
Sbjct: 179 RGKYHQRERMLKARAAGGGVPVVFCNLVGGQDELVFDGASVVIDAGGRVLGRARQFEEEL 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              +   D           D    +     E +  Y A V   RDYV KN F +V++GLS
Sbjct: 239 LFVDLAGD---------GRDGRGIVAELPDEYDEIYRALVTGTRDYVMKNAFRQVVVGLS 289

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS+L AA+AVDALG   V  +++P ++++P+S   AA  A  LG + + +PI     
Sbjct: 290 GGIDSSLVAAVAVDALGASAVNGLIMPSRFSAPESAAYAAELADNLGIRVNEIPIEGPYA 349

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            +   ++     +   I  ENIQ+RIRGN+LMALSN    ++L T NKSE + GY TLYG
Sbjct: 350 AYLESLTGVFTGQAPDITEENIQARIRGNLLMALSNKFGWLVLNTGNKSETATGYTTLYG 409

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  +KD+ KT V+ L  +RN     +       +IP SI++++PSAELRP Q D 
Sbjct: 410 DMAGGFAVIKDVPKTLVYDLCRYRNRTAGRT-------LIPQSIIDRAPSAELRPGQKDA 462

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ++D I++  VE +    +     ++ ETVR +  L+ GSEYKRRQAP G KIT
Sbjct: 463 DSLPPYDVMDPILEAYVEQDLGVADIIGLGHDPETVRRIAGLVDGSEYKRRQAPPGVKIT 522

Query: 540 AKSFGRDRLYPISNKFR 556
            K+FGRDR  PI+NKFR
Sbjct: 523 PKAFGRDRRLPITNKFR 539


>gi|83944365|ref|ZP_00956820.1| NAD(+) synthase [Sulfitobacter sp. EE-36]
 gi|83844909|gb|EAP82791.1| NAD(+) synthase [Sulfitobacter sp. EE-36]
          Length = 552

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 240/558 (43%), Positives = 330/558 (59%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I + QLNP VGD+AGN   AR A  +    G DL+   E+F++GY  +DLV K+
Sbjct: 1   MTSRFRITLGQLNPTVGDLAGNADLAREAWAQGKEAGADLVALPEMFLAGYNAQDLVMKQ 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F     + ++ L +D  D G  + +G P  +   + N+ +IL  G I +   K NLPN 
Sbjct: 61  AFQLDVMTHLEALAADCAD-GPALAIGAPWVEGAKLYNAYLILRNGKIASRVFKHNLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F S     P    D R+G  ICED W      + L + GAEFL   N SPYY
Sbjct: 120 TVFDEVRIFDSAPLGGPYAVGDTRIGSPICEDAWHPDV-AETLAETGAEFLLVPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R   +  ++    LP+IY+N VGGQD+ +FDGASF  +   +LAFQM  F  Q 
Sbjct: 179 RGKFETRLNHMVARVVETELPLIYLNMVGGQDDQVFDGASFALNPGGKLAFQMPAFDAQ- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     +Q    W  +  + A        + E DY   V  LRDY+ K  F KV++GLS
Sbjct: 238 -IAHVDLEQTPEGWRVVEGEKAHMP----SDLEQDYRVMVQGLRDYMGKTGFKKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A IAVDALG +NV+ +MLP +YTS  SL+DA + AKALGC+YD +PI     
Sbjct: 293 GGIDSAIVATIAVDALGADNVRCVMLPSEYTSQASLDDAESVAKALGCRYDYVPIAQGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++         +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITNTLAPLFDGTKPDLTEENIQSRLRGLLLMAVSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KD+YKT+VF    WRN +     +GP  EVI P I++K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDMYKTRVFDSCRWRNENHRDWMMGPEGEVIAPRIIDKPPSAELREDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD ++  +V+++ S  +     ++ E  + VEHLLY SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPDLDAMLTILVDDDGSIADCVAAGFDREVAKKVEHLLYISEYKRFQSAPGPRLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
             +F  DR YPI N++RD
Sbjct: 533 KGAFWLDRRYPIVNRWRD 550


>gi|225850164|ref|YP_002730398.1| glutamine-dependent NAD+ synthetase [Persephonella marina EX-H1]
 gi|225645778|gb|ACO03964.1| glutamine-dependent NAD+ synthetase [Persephonella marina EX-H1]
          Length = 574

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 232/585 (39%), Positives = 331/585 (56%), Gaps = 41/585 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +KKL++A+ QLN  VGDI GN  K   A +EA     D+I F EL I+GYPPEDL+ K S
Sbjct: 1   MKKLRLALGQLNMTVGDIEGNTEKIISAIKEAKLHECDIIAFPELAITGYPPEDLLLKPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI     A++ +   +       +VGF  + ++ + N+  +L  G I+AV  K  LPNY 
Sbjct: 61  FINRNLQALNRIAQASE--NIITIVGFVDKVED-IYNAAAVLLNGKIVAVYHKNFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F  G     +     ++G+ ICEDIW   N       +GAE + ++NASPY+ 
Sbjct: 118 VFDEVRYFQRGNEITLLNIEGYKIGLSICEDIWYPENPINIQAIEGAELIININASPYHI 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K K R +++  +     + I YVN VGGQDEL+FDG S        +  + + F E+  
Sbjct: 178 GKGKFREDMLKVRARDNLVSIAYVNLVGGQDELVFDGNSIIVGPDGSVLTKGRSFEEEIV 237

Query: 242 MTEWHYDQQLSQ------------------------WNYMSDDSASTMY----IPLQEEE 273
           + + + D    Q                         ++   D   T+     +   E E
Sbjct: 238 LCDINLDAIFRQQLKDNRLRNLRAMYKREEKVKEIHLDFKIKDKLETIPQKTILDRPEIE 297

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             Y A V  +RDY+ KN F KV+IGLSGGIDS+L A IA DALGK+NV+ +++P ++TS 
Sbjct: 298 EIYKALVTGVRDYIHKNGFEKVVIGLSGGIDSSLTATIATDALGKDNVKGVLMPSQFTSK 357

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMA 393
           +S+EDA   A+ LG +   LPI D+   +   +             EN+Q+RIRGN+LMA
Sbjct: 358 ESVEDALELAENLGIETFTLPITDIFEKYKDELKDIFAGLKPDATEENLQARIRGNLLMA 417

Query: 394 LSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGL 453
           LSN    ++L T NKSE+SVGY TLYGDM GGF  LKD+ KT+V++LA +RNS       
Sbjct: 418 LSNKFGWIVLATGNKSEMSVGYATLYGDMVGGFAVLKDVLKTKVYELAQYRNS------- 470

Query: 454 GPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYND 512
             ++ VIP  +LEK PSAEL+P Q D++ L PYPILD+II   VE +    +  +  ++ 
Sbjct: 471 --ISPVIPQRVLEKPPSAELKPDQRDEDELLPYPILDEIIMLYVEEDMPVQDIIRMGFDR 528

Query: 513 ETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
            +V  V  ++  +EYKRRQAP+G +IT ++FG+DR  P++NKFR+
Sbjct: 529 HSVEKVVKMIDRNEYKRRQAPIGIRITHRAFGKDRRMPVTNKFRE 573


>gi|308048511|ref|YP_003912077.1| NAD+ synthetase [Ferrimonas balearica DSM 9799]
 gi|307630701|gb|ADN75003.1| NAD+ synthetase [Ferrimonas balearica DSM 9799]
          Length = 539

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 237/556 (42%), Positives = 331/556 (59%), Gaps = 23/556 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M K+L +A+AQLN  VG I  N  K      +A +QG DL+LF EL ++GYPPEDL+ + 
Sbjct: 1   MSKQLVVALAQLNLTVGAIEDNAQKCLEWAAKAEQQGADLVLFPELALTGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
                   A+  L++ +  G   I+VG P   +EG+ N   ++  G I+   DK  LPNY
Sbjct: 61  DCQARVDEALAQLQAYS--GDIAILVGHPAMTEEGLRNRASLIHQGAILGHVDKQRLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E+R F     +  I F+  +LG+LICEDIW      K +  QGA+ L +LNASP+ 
Sbjct: 119 RVFDEERYFEPADHSAVIPFKGHQLGVLICEDIWHPEP-VKQVTDQGADLLLTLNASPFD 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +KL +R +++    +   L ++Y+NQV GQDELIFDG S   D    +  ++  F E  
Sbjct: 178 MSKLTERLDVLEACTAESGLAVVYLNQVCGQDELIFDGHSLVMDATGHICHELPQFEESL 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +          ++     D      +P Q+    YNA VL++RDYV KN F   ++GLS
Sbjct: 238 QLV---------RFTDGQPDQGERHPLPSQD-AQVYNALVLAVRDYVGKNGFKGAVLGLS 287

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIA DALG + VQ +M+P+KYTS  S+EDA A A+ALG  YDV+ I  + +
Sbjct: 288 GGIDSALTLAIAADALGADKVQAVMMPFKYTSSMSVEDARAQAEALGVTYDVVSIEPMFD 347

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++   +        EN+Q+R RG +LMALSN S  +LLTT NKSE++VGY TLYG
Sbjct: 348 AFMGQLAPMFEGTQKDTTEENLQARARGVLLMALSNKSGKILLTTGNKSEMAVGYCTLYG 407

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF  +KDL K  V++L+ +RN+         L+EVIP  ++ + PSAEL P Q DQ
Sbjct: 408 DMCGGFAVIKDLPKLLVYRLSRYRNT---------LSEVIPERVITRPPSAELAPDQVDQ 458

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LDDI++R VE ++S        + +  VR V  L   +EYKRRQA VG ++T
Sbjct: 459 DSLPPYDVLDDILERYVERDQSLEEIVAAGHREADVRRVIRLTDINEYKRRQAAVGPRVT 518

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 519 PRAFGKDRRYPITSGF 534


>gi|157364390|ref|YP_001471157.1| NAD+ synthetase [Thermotoga lettingae TMO]
 gi|157314994|gb|ABV34093.1| NAD+ synthetase [Thermotoga lettingae TMO]
          Length = 582

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 233/588 (39%), Positives = 322/588 (54%), Gaps = 40/588 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  L++ +AQ+N  VGDI GN+ K     E A +  +D++ F EL I+GYPPEDL+FK+ 
Sbjct: 1   MNTLRVGLAQINSTVGDIEGNVEKILEKLELAQQFSVDVVAFPELVITGYPPEDLLFKRH 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI     A++ +           VVGF   +   + N+  +L+ G+I+AV  K  LPNY 
Sbjct: 61  FIDQNKKALEKIAKYVPK-SMIAVVGFVD-ENSDIFNAAAVLNNGSIVAVYRKNYLPNYG 118

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKK-QGAEFLFSLNASPYY 180
            F E R F  G     I F + R+G+ ICEDIW      +       A  L ++++SPY+
Sbjct: 119 VFDEFRYFQHGDKALVISFCNARIGVTICEDIWYPGGPARIEALLGDAHLLLNISSSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  +  ++  + +     I YVN VGGQDELIFDGAS   + Q ++  + K F E  
Sbjct: 179 SGKLSWKERMLAVRANDNLAAIAYVNLVGGQDELIFDGASLIVNEQGEIISRAKQFEEDF 238

Query: 241 FMTEWHY---------DQQLSQWNYMS--------------------DDSASTMYIPLQE 271
            + +            D +  Q   +                      D  S +  PL  
Sbjct: 239 LIGDIDLVGIERSRLHDPRRRQDKRVWSQEIAKLNIVNIPFEPIENKPDIKSRIENPLPR 298

Query: 272 EEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYT 331
               Y+A VL  RDY++KN    V+IGLSGGIDSAL   IAVDALG ++V  + +P  Y+
Sbjct: 299 VAEVYHALVLGTRDYLKKNGIKNVVIGLSGGIDSALTCCIAVDALGPDHVTGVSMPGPYS 358

Query: 332 SPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNIL 391
           S  SLEDA   AK L  +Y V+PI+++   F   +     + P  +  ENIQ+RIRG IL
Sbjct: 359 STHSLEDAELLAKNLNIRYLVIPINEIYETFLKSLKPVFGDLPFDVAEENIQARIRGVIL 418

Query: 392 MALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITS 451
           MALSN    ++LTT NKSE S GY TLYGD +GGF  LKD+YKT V++L+ + N      
Sbjct: 419 MALSNKFGWLVLTTGNKSESSTGYCTLYGDTAGGFAVLKDVYKTLVYELSEYVNQKAQ-- 476

Query: 452 GLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINND-QEY 510
                 E+IP  + EK PSAELR  Q DQ+ LPPYP+LD I+K  VE++ S        Y
Sbjct: 477 -----KEIIPQRVFEKPPSAELRFGQVDQDKLPPYPLLDSILKAYVEDDRSVSEIVPAGY 531

Query: 511 NDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
           ++ TVR V  ++  SEYKRRQ   G KIT ++FG+DR  PI+N+FR+ 
Sbjct: 532 DETTVRKVAWMVDSSEYKRRQLAPGPKITYRAFGKDRRLPITNQFREW 579


>gi|153947276|ref|YP_001400135.1| NAD synthetase [Yersinia pseudotuberculosis IP 31758]
 gi|170023507|ref|YP_001720012.1| NAD synthetase [Yersinia pseudotuberculosis YPIII]
 gi|152958771|gb|ABS46232.1| NAD+ synthetase family protein [Yersinia pseudotuberculosis IP
           31758]
 gi|169750041|gb|ACA67559.1| NAD+ synthetase [Yersinia pseudotuberculosis YPIII]
          Length = 540

 Score =  503 bits (1295), Expect = e-140,   Method: Composition-based stats.
 Identities = 233/556 (41%), Positives = 339/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNWLVGDIEGNTERMLQTLNEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C   ++ L++ T      ++VG P ++ + + N++ +   G ++    K  LPNY
Sbjct: 61  DFYQRCEVQLERLQAATP--HIAVLVGHPWREGDKLYNALSLFAQGKLLGRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  +  +  RLG+LICED+W        +K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHQSCVVELKGYRLGLLICEDLW-LDGPIDAVKAAGAEVVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQVGGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQVGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                     L Q N  +    +     L      Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 ---------TLLQLNECNVIPMTAPVAELPPLAQVYEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG K+DV+ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGVKFDVMSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++    +       EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPMFADTGRDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLAEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S        +++  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVAELVADGFDEAIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A+SFG+DR YPI++ F
Sbjct: 520 ARSFGKDRRYPITSGF 535


>gi|22125216|ref|NP_668639.1| NAD synthetase [Yersinia pestis KIM 10]
 gi|45442325|ref|NP_993864.1| NAD synthetase [Yersinia pestis biovar Microtus str. 91001]
 gi|51597189|ref|YP_071380.1| NAD synthetase [Yersinia pseudotuberculosis IP 32953]
 gi|108808346|ref|YP_652262.1| NAD synthetase [Yersinia pestis Antiqua]
 gi|108811388|ref|YP_647155.1| NAD synthetase [Yersinia pestis Nepal516]
 gi|145599529|ref|YP_001163605.1| NAD synthetase [Yersinia pestis Pestoides F]
 gi|149365369|ref|ZP_01887404.1| putative glutamine-dependent NAD [Yersinia pestis CA88-4125]
 gi|162418452|ref|YP_001607954.1| NAD synthetase [Yersinia pestis Angola]
 gi|165928256|ref|ZP_02224088.1| NAD+ synthetase family protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165939227|ref|ZP_02227777.1| NAD+ synthetase family protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166008048|ref|ZP_02228946.1| NAD+ synthetase family protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212501|ref|ZP_02238536.1| NAD+ synthetase family protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167398909|ref|ZP_02304433.1| NAD+ synthetase family protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167421435|ref|ZP_02313188.1| NAD+ synthetase family protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167423380|ref|ZP_02315133.1| NAD+ synthetase family protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167469238|ref|ZP_02333942.1| NAD+ synthetase family protein [Yersinia pestis FV-1]
 gi|186896284|ref|YP_001873396.1| NAD synthetase [Yersinia pseudotuberculosis PB1/+]
 gi|218929969|ref|YP_002347844.1| NAD synthetase [Yersinia pestis CO92]
 gi|229838496|ref|ZP_04458655.1| putative glutamine-dependent NAD [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229895500|ref|ZP_04510671.1| putative glutamine-dependent NAD [Yersinia pestis Pestoides A]
 gi|229899066|ref|ZP_04514210.1| putative glutamine-dependent NAD [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229901639|ref|ZP_04516761.1| putative glutamine-dependent NAD [Yersinia pestis Nepal516]
 gi|270489830|ref|ZP_06206904.1| NAD+ synthetase [Yersinia pestis KIM D27]
 gi|294504529|ref|YP_003568591.1| NAD(+) synthase [Yersinia pestis Z176003]
 gi|21958083|gb|AAM84890.1|AE013734_5 putative NH3-dependent NAD(+) synthetase [Yersinia pestis KIM 10]
 gi|45437189|gb|AAS62741.1| putative glutamine-dependent NAD [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51590471|emb|CAH22111.1| putative glutamine-dependent NAD [Yersinia pseudotuberculosis IP
           32953]
 gi|108775036|gb|ABG17555.1| glutamine-dependent NAD [Yersinia pestis Nepal516]
 gi|108780259|gb|ABG14317.1| putative glutamine-dependent NAD [Yersinia pestis Antiqua]
 gi|115348580|emb|CAL21522.1| putative glutamine-dependent NAD [Yersinia pestis CO92]
 gi|145211225|gb|ABP40632.1| glutamine-dependent NAD [Yersinia pestis Pestoides F]
 gi|149291782|gb|EDM41856.1| putative glutamine-dependent NAD [Yersinia pestis CA88-4125]
 gi|162351267|gb|ABX85215.1| NAD+ synthetase family protein [Yersinia pestis Angola]
 gi|165912827|gb|EDR31454.1| NAD+ synthetase family protein [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165919763|gb|EDR37096.1| NAD+ synthetase family protein [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165992430|gb|EDR44731.1| NAD+ synthetase family protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206432|gb|EDR50912.1| NAD+ synthetase family protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166960924|gb|EDR56945.1| NAD+ synthetase family protein [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167051413|gb|EDR62821.1| NAD+ synthetase family protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057550|gb|EDR67296.1| NAD+ synthetase family protein [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|186699310|gb|ACC89939.1| NAD+ synthetase [Yersinia pseudotuberculosis PB1/+]
 gi|229681568|gb|EEO77662.1| putative glutamine-dependent NAD [Yersinia pestis Nepal516]
 gi|229688011|gb|EEO80083.1| putative glutamine-dependent NAD [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229694862|gb|EEO84909.1| putative glutamine-dependent NAD [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229701306|gb|EEO89334.1| putative glutamine-dependent NAD [Yersinia pestis Pestoides A]
 gi|262362479|gb|ACY59200.1| NAD(+) synthase [Yersinia pestis D106004]
 gi|262366517|gb|ACY63074.1| NAD(+) synthase [Yersinia pestis D182038]
 gi|270338334|gb|EFA49111.1| NAD+ synthetase [Yersinia pestis KIM D27]
 gi|294354988|gb|ADE65329.1| NAD(+) synthase [Yersinia pestis Z176003]
 gi|320016055|gb|ADV99626.1| putative glutamine-dependent NAD [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 540

 Score =  503 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 232/556 (41%), Positives = 339/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNWLVGDIEGNTERMLQTLNEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C   ++ L++ T      ++VG P ++ + + N++ +   G ++    K  LPNY
Sbjct: 61  DFYQRCEVQLERLQAATP--HIAVLVGHPWREGDKLYNALSLFAQGKLLGRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  +  +  RLG+LICED+W        +K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHQSCVVELKGYRLGLLICEDLW-LDGPIDAVKAAGAEVVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                     L Q N  +    +     L      Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 ---------TLLQLNECNVIPMTAPVAELPPLAQVYEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG K+DV+ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGVKFDVMSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++    +       EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPMFADTGRDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLAEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S        +++  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVAELVADGFDEAIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A+SFG+DR YPI++ F
Sbjct: 520 ARSFGKDRRYPITSGF 535


>gi|157371885|ref|YP_001479874.1| NAD synthetase [Serratia proteamaculans 568]
 gi|157323649|gb|ABV42746.1| NAD+ synthetase [Serratia proteamaculans 568]
          Length = 540

 Score =  503 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 232/556 (41%), Positives = 342/556 (61%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +  +E  + G DL++FTEL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNLLVGDIEGNTERMLQTVQEQQKAGADLVMFTELALSGYPPEDLLYRN 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +  L+  + +    I+VG P ++ + + N++ +   G ++A   K  LPNY
Sbjct: 61  DFYQRCDAQLQRLQQASAE--VAILVGHPWREGDKLYNALSLFSEGQLLARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G     +  +  +LG+LICED+W         K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFQAGSETCVVELKGYQLGLLICEDLWFPGP-VDAAKAAGAEMILSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++ G     HLP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAGHCQRTHLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLTAFAEQV 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + E          N +     +     L +    Y A VL++RDYV KN F   ++GLS
Sbjct: 238 TLLEL---------NELEVVPMTAPAAELPQLAQVYEALVLAVRDYVTKNGFKGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++D++ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDIVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLTPMFAGTERDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVIDRPPSAELAPDQLDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   + +++  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVERDKSVADLVAEGFDEAIVRKVIRLVDINEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|188997459|ref|YP_001931710.1| NAD+ synthetase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932526|gb|ACD67156.1| NAD+ synthetase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 573

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 232/584 (39%), Positives = 341/584 (58%), Gaps = 40/584 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +KK+++A+AQ+NPVVGD   N  K     E+A +   D++ F EL ++GYPPEDL+ K S
Sbjct: 1   MKKIRLALAQINPVVGDFEYNYNKILEFIEKAKKLEADIVAFPELVLTGYPPEDLILKPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+     ++ LK +        VVGF  + ++ V N+  ++    I+ V  K  LPNY 
Sbjct: 61  FIEKNLQHLEKLKENID--NIIAVVGFIDKQED-VFNAAAVIYNKEIVGVYHKQFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F  G     +   + ++GI ICEDIW   N        GAE + ++NASPY  
Sbjct: 118 VFDENRYFQKGDGLLLLSIDNYKVGISICEDIWYPENPVNDYAILGAEVVININASPYSQ 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+KKR E++  +     + I YVN VGGQDEL+FDG S   D Q ++  + + F E+  
Sbjct: 178 GKVKKREEMLKVRSRDNLISIAYVNMVGGQDELVFDGNSLILDAQGEILAKAESFEEELL 237

Query: 242 MTEWHYDQQLS---------------------------QWNYMSDDSASTMYIPLQEEEA 274
           + +   D+                              +    ++  +  + +  +E E 
Sbjct: 238 LADIDLDEIFRLQLKDNRLKNLRYLKKPINVKEVRLDYKIKNKNNQISQKIALDKKEIED 297

Query: 275 DYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQ 334
           +Y A V+ LRDY+ KN F KV+IGLSGGIDS+L A IAVDALGKENV+ +++P  YTS +
Sbjct: 298 NYKALVVGLRDYINKNGFKKVVIGLSGGIDSSLTACIAVDALGKENVKGVLMPSHYTSKE 357

Query: 335 SLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMAL 394
           S+EDA   AK L  +   +PI ++ + +     +  +        EN+Q+RIRGNILMAL
Sbjct: 358 SIEDAIELAKNLDIETFTIPIKNIFDKYLEEFQEIFKGLKPDTTEENLQARIRGNILMAL 417

Query: 395 SNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLG 454
           SN    +++ T NKSE+SVGY TLYGDM GGF  LKD+ KT+V++L+ +RNS        
Sbjct: 418 SNKFGWIVIATGNKSEMSVGYSTLYGDMVGGFAVLKDVLKTKVYELSYYRNS-------- 469

Query: 455 PLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDE 513
            +++VIP  +L K PSAELRP+QTD+  L PYPILD II+  VE + +     +  + ++
Sbjct: 470 -ISKVIPDRVLTKPPSAELRPNQTDEAELLPYPILDQIIQFYVEQDLTVEEIVKLGFEEK 528

Query: 514 TVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
            V+ + +L+  +EYKRRQAP+G KIT ++FG+DR  PI+N+F++
Sbjct: 529 DVKKIINLIDKNEYKRRQAPIGIKITERAFGKDRRMPITNRFKE 572


>gi|29654185|ref|NP_819877.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii RSA 493]
 gi|29541451|gb|AAO90391.1| glutamine-dependent NAD(+) synthetase [Coxiella burnetii RSA 493]
          Length = 542

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 230/556 (41%), Positives = 324/556 (58%), Gaps = 20/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKK 60
           +KKL I  AQLN +VGDI GN      A  +A ++   DLILF EL I+ YPPEDL+F+ 
Sbjct: 1   MKKLVIVGAQLNFLVGDIEGNTQLIIDAANQAYQESKADLILFPELSITSYPPEDLLFRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +  +    A+ T+          +VVG+P        N   ++  G I+A   K  LPNY
Sbjct: 61  ALYRRVHQALQTIADKVK--NTTVVVGYPDFIDNKCYNKAAVITDGKIVATYAKHELPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G     I  + +++GILICED+W   N  K     GA+ +  +NASP+ 
Sbjct: 119 RVFDEKRYFAAGDQPCVIEIKGVKIGILICEDLW-LENPIKQSVAAGAQLIACINASPFA 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K   R +++T +    H+PI+Y+N VGGQDEL+FDG S  F+   +L  Q  +  E+ 
Sbjct: 178 QDKSHHRRDLLTKRTKRYHIPIVYLNLVGGQDELVFDGGSLVFNQHGELIQQGSYLKEEL 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              E+  D  L+               PL  EE  YN  VL +RDY+ KNNF   +IGLS
Sbjct: 238 ITVEFDIDDNLTILTKTP-----LPPEPLD-EEKIYNVLVLGVRDYINKNNFPGAVIGLS 291

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL  AIAVDA+G E V  +++P  +TS  S+EDA   AKAL  +   + I  +  
Sbjct: 292 GGVDSALTLAIAVDAIGSERVSGVLMPSPFTSTMSIEDAEGEAKALNVRTSTINIQPIFE 351

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +          +  EN+Q+RIRG +LMA+SN   A++LTT NKSE++VGY TLYG
Sbjct: 352 AFIRSLESEFTGLGKDVTEENLQARIRGTLLMAISNKKDAIVLTTGNKSEMAVGYATLYG 411

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  LKD+YKT V++L  +RN+         ++ VIP  +LE+ PSAEL P Q DQ
Sbjct: 412 DMAGGFGVLKDVYKTMVYRLCRYRNT---------ISRVIPERVLERPPSAELAPDQKDQ 462

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           + LPPY ILD+I++R +  +E         ++ E V+ V  ++  +EYKRRQAP+G +IT
Sbjct: 463 DVLPPYHILDEILERYIAKDEDPTAIAAGGFDVEMVKKVVRMINRNEYKRRQAPIGIRIT 522

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 523 ERAFGKDRRYPITSGF 538


>gi|119383605|ref|YP_914661.1| NAD synthetase [Paracoccus denitrificans PD1222]
 gi|119373372|gb|ABL68965.1| NH(3)-dependent NAD(+) synthetase [Paracoccus denitrificans PD1222]
          Length = 556

 Score =  502 bits (1293), Expect = e-140,   Method: Composition-based stats.
 Identities = 243/564 (43%), Positives = 330/564 (58%), Gaps = 13/564 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    +I + QLNP VGD+ GN A AR A  +A   G +L+   E+FI+GY  +DLV K 
Sbjct: 1   MTDTFRITLGQLNPTVGDLPGNAAMAREAWAKAREAGANLLALPEMFITGYQTQDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q   + I  L  D  D G  I +G P  +++ + N+  IL+ G + A   K  LP+ 
Sbjct: 61  GFTQEAMAHIVDLARDCAD-GPAIGIGGPYAEEDRLYNAYWILNGGRVAARVRKHELPHK 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F  G  + P     +R+G  ICED W      + L + GAE L   N SPY+
Sbjct: 120 QLFDEWRLFNVGPISGPYSLDGLRIGSPICEDAWWPEVC-ETLAETGAEILLVPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ----LAFQMKHF 236
            NKL  R   +  ++    LP+IY+N VGGQD+ I+DGASF  +  +        Q+  F
Sbjct: 179 RNKLDLRMGHMVARVVETGLPLIYLNSVGGQDDQIYDGASFVLNPGEDGGVVKVMQLAPF 238

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E     ++      ++       +   M     E E DY A  L LRDY++K+ F KV+
Sbjct: 239 DEMLAHVDF------TRTPQGWRAAPGRMDHQPDEWEQDYRAMTLGLRDYMRKSGFRKVV 292

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL A IA DA+G ENV+ +MLP +YTS  SL+DAA CA  LG + D + I 
Sbjct: 293 LGLSGGIDSALVATIASDAVGPENVRCVMLPSEYTSQASLDDAADCAGRLGTRLDTVHIE 352

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
              +     ++  +         ENIQSR+RG +LMALSN    +LLTT NKSE++VGY 
Sbjct: 353 GARDAVGDALAHLMAGTQPDATEENIQSRLRGVMLMALSNKFGELLLTTGNKSEVAVGYA 412

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           T+YGDM+GG+NP+KDLYKT+VFQ   WRN +     LG   EVIPP I+ K PSAELRP+
Sbjct: 413 TIYGDMAGGYNPIKDLYKTRVFQTCRWRNENHRDWMLGRAGEVIPPQIISKPPSAELRPN 472

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           Q DQ+SLPPY +LD I++ +VE + +  +   Q +  ETV+ VE LLYGSE+KR QA  G
Sbjct: 473 QKDQDSLPPYEVLDAILEGLVEKDLALKDLVAQGFEPETVKKVETLLYGSEWKRYQAAPG 532

Query: 536 TKITAKSFGRDRLYPISNKFRDHI 559
            +I+ K+F  DR YP+ N++RD +
Sbjct: 533 PRISTKAFWLDRRYPLVNRWRDRL 556


>gi|161829967|ref|YP_001596848.1| NAD+ synthetase [Coxiella burnetii RSA 331]
 gi|161761834|gb|ABX77476.1| NAD+ synthetase [Coxiella burnetii RSA 331]
          Length = 542

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 230/556 (41%), Positives = 324/556 (58%), Gaps = 20/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKK 60
           +KKL I  AQLN +VGDI GN      A  +A ++   DLILF EL I+ YPPEDL+F+ 
Sbjct: 1   MKKLVIVGAQLNFLVGDIEGNTQLIIDAANQAYQESKADLILFPELSITSYPPEDLLFRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +  +    A+ T+          +VVG+P        N   ++  G I+A   K  LPNY
Sbjct: 61  ALYRRVHQALQTIADKVK--NTTVVVGYPDFIDNKCYNKAAVITDGKIVATYAKHELPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G     I  + +++GILICED+W   N  K     GA+ +  +NASP+ 
Sbjct: 119 RVFDEKRYFAAGDQPCVIEIKGVKIGILICEDLW-LENPIKQSVAAGAQLIACINASPFA 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K   R +++T +    H+PI+Y+N VGGQDEL+FDG S  F+   +L  Q  +  E+ 
Sbjct: 178 QDKSHHRRDLLTKRTKRYHIPIVYLNLVGGQDELVFDGGSLVFNQHGELIQQGSYLKEEL 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              E+  D  L+               PL  EE  YN  VL +RDY+ KNNF   +IGLS
Sbjct: 238 ITVEFDIDDNLTILTKTP-----LPPEPLD-EEKIYNVLVLGVRDYINKNNFPGAVIGLS 291

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL  AIAVDA+G E V  +++P  +TS  S+EDA   AKAL  +   + I  +  
Sbjct: 292 GGVDSALTLAIAVDAIGSERVSGVLMPSPFTSTMSIEDAEGGAKALNVRTSTINIQPIFE 351

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +          +  EN+Q+RIRG +LMA+SN   A++LTT NKSE++VGY TLYG
Sbjct: 352 AFIRSLESEFTGLGKDVTEENLQARIRGTLLMAISNKKDAIVLTTGNKSEMAVGYATLYG 411

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  LKD+YKT V++L  +RN+         ++ VIP  +LE+ PSAEL P Q DQ
Sbjct: 412 DMAGGFGVLKDVYKTMVYRLCRYRNT---------ISRVIPERVLERPPSAELAPDQKDQ 462

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           + LPPY ILD+I++R +  +E         ++ E V+ V  ++  +EYKRRQAP+G +IT
Sbjct: 463 DVLPPYHILDEILERYIAKDEDPTAIAAGGFDVEMVKKVVRMINRNEYKRRQAPIGIRIT 522

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 523 ERAFGKDRRYPITSGF 538


>gi|50085923|ref|YP_047433.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Acinetobacter sp. ADP1]
 gi|49531899|emb|CAG69611.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Acinetobacter sp. ADP1]
          Length = 541

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 226/557 (40%), Positives = 327/557 (58%), Gaps = 21/557 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  KIA+AQ +P +G+I  N  +      EA +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKIALAQFSPHIGNIDSNAQRMVEQANEAKKQNADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQ-DQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   LK         +V GF  Q ++    NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFQQLKEV---KDIVMVFGFVHQTEEGHRYNSAAVMKDGVVLGVYNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F EKR F  G+ +    +   + G+LICEDIW + N  K L K   E +  LNASPY 
Sbjct: 118 SVFDEKRYFSPGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSKLNVETVLVLNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + +T     +++ ++Y+NQVGGQD+LIFDG+SF  +   ++AFQ   F E+ 
Sbjct: 177 VGKPQHRVQTLTELSKQLNVHLVYLNQVGGQDDLIFDGSSFIINHDGEVAFQAPSFKEEL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           + +E+  +Q+  +               L      Y + V++ RDYVQ++ F  VI+GLS
Sbjct: 237 YYSEFDIEQKRYK--------KIDPAPALDTIAEIYQSLVMATRDYVQRSGFSGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIA DA+G + VQ +M+PY YTS  S+EDA   A+ +G  + +  IH +VN
Sbjct: 289 GGIDSALTLAIAADAIGADKVQAVMMPYTYTSQISVEDATEQARRMGVTFGIAEIHPIVN 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSE++VGY TLYG
Sbjct: 349 SFMQTLYPFFGNAPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSELAVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF  LKD+YKT VF+LA +RN+          T VIP  ++ + PSAELRP Q DQ
Sbjct: 409 DMVGGFAVLKDVYKTIVFELAKYRNTLS-------ETPVIPERVITRPPSAELRPDQKDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y ILD I+   +E ++S  +   + ++ E V  V  L+  +EYKRRQ  +G +I+
Sbjct: 462 DSLPAYDILDAILYAYIEEDQSQSDIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGPRIS 521

Query: 540 AKSFGRDRLYPISNKFR 556
           +++F R+R YPI N +R
Sbjct: 522 SRAFSRERRYPIVNGWR 538


>gi|302524481|ref|ZP_07276823.1| glutamine-dependent NAD(+) synthetase [Streptomyces sp. AA4]
 gi|302433376|gb|EFL05192.1| glutamine-dependent NAD(+) synthetase [Streptomyces sp. AA4]
          Length = 590

 Score =  502 bits (1292), Expect = e-140,   Method: Composition-based stats.
 Identities = 220/580 (37%), Positives = 328/580 (56%), Gaps = 32/580 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L+IA+AQ+N  VGDI GN A       +A   G  +++F E+  +GYP EDL  +++
Sbjct: 18  MPQLRIALAQVNTTVGDIDGNTALTVEWTRKAAEAGAHVVVFPEMSQTGYPVEDLTLRRT 77

Query: 62  FIQACSSAIDTLKSDTHDGGAGIV---VGFPRQDQEGVLNSVVILDAGNIIAVRDKINLP 118
           F  A   ++  L     + G G V   VG+   D+ G  ++   L  G ++A + K +LP
Sbjct: 78  FADASRRSVTELARRLDEAGCGEVLAYVGYLDHDEVGPRDAAAALYRGEVVARQFKHHLP 137

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           NY  F E R F  G   + +    + +G++ICEDIW++      L K G + + + NASP
Sbjct: 138 NYGVFDEHRYFKPGTELEVLRLHGVDIGMVICEDIWQDGGPISALGKAGVDLVVAPNASP 197

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y  +K ++R  ++  + +    P++Y NQVGGQD+L+FDG S        L  +   F E
Sbjct: 198 YERSKDEQRLPLIARRAAEAGAPLVYTNQVGGQDDLVFDGDSLVVGADGTLLARAPQFVE 257

Query: 239 QNFMTEWHYD----------QQLSQWNYMSDDSA---------STMYIPLQEEEADYNAC 279
              + +              + L     +  DS           T+  PL +E   ++A 
Sbjct: 258 HLLVLDLDVPASGAAATGSFEGLEVHRRVLTDSPLAEYSPLAAPTISEPLSDEAEVWSAL 317

Query: 280 VLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDA 339
           V+ LRDYV KN F  V  G SGGIDSA+CAA+A DALG +NV  + +P KY+S  S +DA
Sbjct: 318 VVGLRDYVHKNGFSTVTFGFSGGIDSAVCAALAADALGGDNVYGVSMPSKYSSSHSRDDA 377

Query: 340 AACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSK 399
           +  A+ +G  Y V PI D+V+ + + +      + +G+  ENIQ+R+RG +LMALSN   
Sbjct: 378 SDLAERIGAHYRVEPIGDMVDVYVNQL------QLTGLAEENIQARVRGMLLMALSNLDG 431

Query: 400 AMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEV 459
            ++L T NK+E++VGY T+YGD  G F P+KDL+KT V+QLA WRN      G  P    
Sbjct: 432 HLVLATGNKTELAVGYSTIYGDAVGAFAPIKDLFKTHVWQLARWRNEEAAKRGETP---P 488

Query: 460 IPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYV 518
           IP + + K PSAELRP Q D +SLP Y +LDD++   VEN+  + +  +  ++ ET+  V
Sbjct: 489 IPENSITKPPSAELRPDQKDSDSLPDYELLDDVLDDYVENDRGYADLIEAGFDPETIDRV 548

Query: 519 EHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
             ++  +EYKRRQ P GTKIT K+FGRDR  P++N +R+ 
Sbjct: 549 VRMVDRAEYKRRQYPPGTKITFKAFGRDRRLPMTNGWRER 588


>gi|238759702|ref|ZP_04620862.1| NAD+ synthase [Yersinia aldovae ATCC 35236]
 gi|238702130|gb|EEP94687.1| NAD+ synthase [Yersinia aldovae ATCC 35236]
          Length = 540

 Score =  501 bits (1291), Expect = e-140,   Method: Composition-based stats.
 Identities = 234/556 (42%), Positives = 343/556 (61%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRKLSIALAQLNWLVGDIEGNTERMLQTLHEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++ T      ++VG P ++   + N++ +   G ++    K  LPNY
Sbjct: 61  DFYQRCKTQLDRLQAATQ--HTAVLVGHPWREAGKLYNALSLFAEGKLLGRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G  +  +  +  RLG+LICED+W +      +K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGDKSCVVELKGYRLGLLICEDLWFDGP-VDAVKAAGAEIVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                     L Q+N       +     L      Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 ---------TLLQFNGCEVVPMTAPVAELPPLAQVYEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F S +S            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMSQLSPMFAGTARDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD+I++  VE+++S  +     +++  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDEILEGYVEHDKSVTDLVADGFDETIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|83953407|ref|ZP_00962129.1| NAD(+) synthase [Sulfitobacter sp. NAS-14.1]
 gi|83842375|gb|EAP81543.1| NAD(+) synthase [Sulfitobacter sp. NAS-14.1]
          Length = 552

 Score =  501 bits (1291), Expect = e-139,   Method: Composition-based stats.
 Identities = 241/558 (43%), Positives = 329/558 (58%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I + QLNP VGD+AGN   AR A  +    G DL+   E+F++GY  +DLV K+
Sbjct: 1   MTSRFRITLGQLNPTVGDLAGNADLAREAWAQGKEAGADLVALPEMFLAGYNAQDLVMKQ 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F     + ++ L +D  D G  + +G P  +   + N+ +IL  G I +   K NLPN 
Sbjct: 61  AFQLDVMTHLEALAADCAD-GPALAIGAPWVEGAKLYNAYLILRNGKIASRVFKHNLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F S     P    D R+G  ICED W      + L + GAEFL   N SPYY
Sbjct: 120 TVFDEVRIFDSAPLGGPYAVGDTRIGSPICEDAWHPDV-AETLAETGAEFLLVPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R   +  ++    LP+IY+N VGGQD+ +FDGASF  +   +LAFQM  F  Q 
Sbjct: 179 RGKFETRLNHMVARVVETELPLIYLNMVGGQDDQVFDGASFALNPGGKLAFQMPAFDAQ- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     +Q    W  +  + A        + E DY   V  LRDY+ K  F KV++GLS
Sbjct: 238 -IAHVDLEQTPEGWRVVEGEKAHMP----SDLEQDYRVMVQGLRDYMGKTGFKKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A IAVDALG +NV+ +MLP +YTS  SL+DA A AKALGC+YD +PI     
Sbjct: 293 GGIDSAIVATIAVDALGADNVRCVMLPSEYTSQASLDDAEAVAKALGCRYDYVPIAQGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +     +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITDTLAPLFEGTKPDLTEENIQSRLRGLLLMAVSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KD+YKT+VF    WRN +      GP  EVI P I++K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDMYKTRVFDSCRWRNENHRDWMKGPEGEVIAPRIIDKPPSAELREDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD ++  +V+++ S  +     ++ E  + VEHLLY SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPDLDAMLTILVDDDGSIADCVAAGFDREVAKKVEHLLYISEYKRFQSAPGPRLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
             +F  DR YPI N++RD
Sbjct: 533 KGAFWLDRRYPIVNRWRD 550


>gi|307825849|ref|ZP_07656065.1| NAD+ synthetase [Methylobacter tundripaludum SV96]
 gi|307733157|gb|EFO04018.1| NAD+ synthetase [Methylobacter tundripaludum SV96]
          Length = 536

 Score =  501 bits (1291), Expect = e-139,   Method: Composition-based stats.
 Identities = 240/555 (43%), Positives = 331/555 (59%), Gaps = 24/555 (4%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSF 62
            LKIA+AQ N +VGDIA N+    RA   A  + G D+++F EL I+GYP EDL+ +  F
Sbjct: 2   TLKIALAQTNFLVGDIAANVDNIARAAIHARDELGADMVVFPELTITGYPAEDLLLRADF 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           I A ++A+  L       G  +VVGFP  D + + NS  +L  G I+A   K  LPNY  
Sbjct: 62  ITAANNALYQLADRVA--GIALVVGFPEHDGDKLYNSAAVLHQGAILACYRKRALPNYGV 119

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F E+R F +G       F    +G+ ICED+W    I +  K+ GAE L +LNASP+   
Sbjct: 120 FDEQRYFTAGSQPCVFEFNGTFIGLTICEDVW-RQGIIEDNKQAGAELLLTLNASPFNSG 178

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K+ +R  I+  Q+    +P++YVNQ+GGQDELIFDGASF  D    + F+   F EQ  +
Sbjct: 179 KIHQREAIICSQVKAAQIPLVYVNQIGGQDELIFDGASFVVDADGGIVFRAAEFKEQISV 238

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
            E+            +    +T      E  ++Y A VL ++DYV+KN F   I+GLSGG
Sbjct: 239 VEFD----------GNKPVKTTCAPSYNEVSSEYQALVLGIKDYVRKNGFQGAILGLSGG 288

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL  A+AVDALG + V+ ++LP +YT   S EDA   A+ALG K+ ++PI   VN F
Sbjct: 289 IDSALVLALAVDALGADKVEAVLLPSRYTQDMSNEDAMLEAEALGVKHHIIPIEPAVNAF 348

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
             +++            ENIQ+R RG +LMALSN    +LLTT NKSE+SVGY TLYGDM
Sbjct: 349 TGMLADIFAGTAKDATEENIQARCRGVVLMALSNKQGKLLLTTGNKSEMSVGYATLYGDM 408

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           SGGF P+KD+ K  ++QLA +RNS         L+  IP  ++ + PSAEL P Q D +S
Sbjct: 409 SGGFAPIKDVPKLLIYQLAHYRNS---------LSPAIPERVITRPPSAELAPDQVDADS 459

Query: 483 LPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY +LD I++R +E ++S        +  E V     L+  +EYKRRQ+P G +ITA+
Sbjct: 460 LPPYDVLDPILERYIEKDQSAAEIIAAGFRREDVARAISLVDRNEYKRRQSPPGIRITAR 519

Query: 542 SFGRDRLYPISNKFR 556
           +FGRDR YPI++ ++
Sbjct: 520 AFGRDRRYPITSGYK 534


>gi|329902389|ref|ZP_08273093.1| NAD synthetase [Oxalobacteraceae bacterium IMCC9480]
 gi|327548804|gb|EGF33438.1| NAD synthetase [Oxalobacteraceae bacterium IMCC9480]
          Length = 537

 Score =  501 bits (1291), Expect = e-139,   Method: Composition-based stats.
 Identities = 233/555 (41%), Positives = 326/555 (58%), Gaps = 22/555 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            +K+AIAQ+N  VGD++GN AK     E A  QG D+++  E+ + GYPPEDL+ + +F 
Sbjct: 2   TVKVAIAQINSTVGDLSGNRAKIFAFAERAAGQGADIVVTPEMSLVGYPPEDLLLRDAFY 61

Query: 64  QACSSAIDTLKSDTHD-GGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
              +  +  L +D     G  ++VG P        N+VV+L  G+I+A   K  LPN + 
Sbjct: 62  AQSAEQVAGLAADLAVFAGLHVLVGLPLLKDGARFNAVVVLADGHIVATYCKSELPNDAV 121

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F SG     +  + +  GI ICED W +       +  GA+ L   N SPY+ N
Sbjct: 122 FDEKRYFSSGDQACVLTIKGVTFGINICEDTWFDRAPA-LARAAGAQVLLVPNGSPYHMN 180

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           KL  R++I+   +    L ++YVN VGGQDELIFDG SF  D   QL  Q+ H  E   +
Sbjct: 181 KLHLRYDIMRANVCAQGLSLVYVNLVGGQDELIFDGNSFVMDQSGQLQAQLSHVDEDLQL 240

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
            E+            +          L  E   Y A VL +RDY+ KN F  V++GLSGG
Sbjct: 241 VEFD----------GATPLPGKFAPRLSVEAQVYQALVLGVRDYIGKNGFPGVLLGLSGG 290

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           +DSAL  A+AVDALG + V+T+M+P  YT+  S  D+   A+  G +YD + I +  + F
Sbjct: 291 VDSALTLAVAVDALGADKVRTVMMPSPYTAEISWIDSRDMAQRTGVRYDEIAIGNCFDAF 350

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
              +++     P     ENIQ+RIRG ILMALSN   +++LTT NKSE++VGY TLYGDM
Sbjct: 351 LGTLAEDFAGLPLDATEENIQARIRGTILMALSNKHGSIVLTTGNKSEMAVGYCTLYGDM 410

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF  LKD+ KT V++L ++RN+         ++ VIP  IL ++PSAELRP QTDQ+S
Sbjct: 411 AGGFAVLKDIAKTLVYRLCAYRNA---------ISPVIPERILTRAPSAELRPDQTDQDS 461

Query: 483 LPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY ILD I++  +E   S  +     +  E VR + HL+  +EYKRRQ+PVG ++T +
Sbjct: 462 LPPYEILDGIMQLFMEENRSVDDVIAAGFQAEDVRRITHLIKINEYKRRQSPVGIRVTHR 521

Query: 542 SFGRDRLYPISNKFR 556
           +FGRD  YPI++KFR
Sbjct: 522 AFGRDWRYPITSKFR 536


>gi|290476027|ref|YP_003468924.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Xenorhabdus bovienii
           SS-2004]
 gi|289175357|emb|CBJ82160.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Xenorhabdus bovienii
           SS-2004]
          Length = 540

 Score =  501 bits (1291), Expect = e-139,   Method: Composition-based stats.
 Identities = 234/556 (42%), Positives = 335/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L I +AQLN +VGDI GN  +  +  +E  ++G DL++F+EL +SGY PEDL+F+ 
Sbjct: 1   MSRTLNIVLAQLNWLVGDIEGNSERMLQTVQEQQKKGADLVMFSELALSGYFPEDLLFRA 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
              Q C   +  L+  +      I+VG P Q      N++ +   G IIA   K  LPNY
Sbjct: 61  DLHQRCREQLVRLQEAS--SQVAILVGHPWQQDGKTYNALSLFWKGEIIARYFKQLLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F +G  +  + F+   LG+LICED+W ++     LK+ G++ + SLNASPY 
Sbjct: 119 GVFDEDRYFKAGDQSCVVPFKGYNLGLLICEDLWFDAP-IDALKQAGSDIILSLNASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LPIIY+NQVGGQD+LIFDG S  FD   ++  +M  F EQ 
Sbjct: 178 REKPNIRSTLIQSHCQRTQLPIIYLNQVGGQDQLIFDGCSKVFDANGKITHRMAAFEEQI 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                    +  ++N M+ +  + +   L      Y A VLS+RDYV KN F   ++GLS
Sbjct: 238 ---------EQCRFNEMNIEPMANLIPQLSPLAQIYKALVLSVRDYVHKNGFKGALLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDALGK++VQ +M+P++YTS  S+ DA   A+ LG ++DV+ I  + +
Sbjct: 289 GGIDSGLTLAIAVDALGKDHVQAVMMPFRYTSEMSIHDAREQAELLGVEFDVVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + +             EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 349 AFMAQLEPMFAGTEKDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFN LKD+ KT VF L+ +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFNALKDVPKTMVFALSKYRNT---------VSPAIPQRVIDRPPSAELAPDQLDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I++  VE ++S  +   Q +++  VR V  L+  +EYKRRQAP+G +IT
Sbjct: 460 DSLPPYDMLDAILEGYVEKDKSVADLVAQGFDEAIVRKVIRLVDINEYKRRQAPIGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
            + FG+DR YPI++ F
Sbjct: 520 ERDFGKDRRYPITSGF 535


>gi|270264765|ref|ZP_06193030.1| hypothetical protein SOD_i01820 [Serratia odorifera 4Rx13]
 gi|270041448|gb|EFA14547.1| hypothetical protein SOD_i01820 [Serratia odorifera 4Rx13]
          Length = 540

 Score =  501 bits (1291), Expect = e-139,   Method: Composition-based stats.
 Identities = 234/556 (42%), Positives = 343/556 (61%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +  +E  + G DL++FTEL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNLLVGDIEGNTERMLQTVQEQQKAGADLVMFTELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +  L+  + D    I+VG P ++ + + N++ +   G ++A   K  LPNY
Sbjct: 61  DFYQRCDAQLHRLQQASTD--VAILVGHPWREGDKLYNALSLFSEGQLLARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G     +  +  RLG+LICED+W         K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFHAGNETCVVNLKGYRLGLLICEDLWFPEP-VDAAKAAGAEMILSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++ G     HLP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAGHCQRTHLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQV 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                     L ++N +     +     L +    Y A VL++RDYV KN F   ++GLS
Sbjct: 238 ---------TLLRFNELDVVPMTAPAAELPQLAQVYEALVLAVRDYVTKNGFKGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++D++ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGVEFDIVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLTPMFAGTERDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVIDRPPSAELAPDQVDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   + +++  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVERDKSVADLVAEGFDEAIVRKVIRLVDINEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|220933990|ref|YP_002512889.1| NAD+ synthetase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995300|gb|ACL71902.1| NAD+ synthetase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 546

 Score =  501 bits (1290), Expect = e-139,   Method: Composition-based stats.
 Identities = 231/562 (41%), Positives = 333/562 (59%), Gaps = 18/562 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFK 59
           M   LKIA+AQ++ +VGD+ GN  + R    +A  + G DL+LF EL I+GYPPEDL+ +
Sbjct: 1   MTDTLKIALAQVDLLVGDVEGNAERIRDWVFKARDELGADLVLFPELAITGYPPEDLLLR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
            S       A+  L  +    G  +V+G P QD+ G+ NS ++L  G I A  DK  LPN
Sbjct: 61  ASLHARVERALHRLAHEVR--GIDVVLGAPMQDERGLHNSALLLRDGAIAARYDKQILPN 118

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           YS F EKR F+ G+    I  R + LG+ +CEDIW         ++ GA  + ++NASPY
Sbjct: 119 YSVFDEKRYFVPGHGACVIQVRGVPLGLTVCEDIW-QPEPAARAREAGARLILNINASPY 177

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           +  K ++R + +  ++    L ++Y+N VGGQDEL+FDG S    G  ++   +  + E 
Sbjct: 178 HRGKREERLQTLRARVRETGLSVLYLNLVGGQDELVFDGQSLVMGGDGEVRQSLPAWHEA 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
             +         +     + + A        E    Y A V  +RDYV KN F   ++GL
Sbjct: 238 LSLVSVDCPAGDAPLQPRAGEQAPL----ADEAAELYQALVTGVRDYVSKNGFRGAVLGL 293

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL   IAVDALG + V+ +M+PY+YT+  S+EDA + A++LG +Y  +PI  +V
Sbjct: 294 SGGIDSALTLCIAVDALGADAVEAVMMPYRYTASMSVEDARSQAQSLGVRYREIPIEPMV 353

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F + ++   +  P     ENIQ+R RG ILMA+SN +  MLLTT NKSE++VGY TLY
Sbjct: 354 EAFMTGLAPEFEGLPRDTTEENIQARCRGVILMAISNKTGRMLLTTGNKSEMAVGYATLY 413

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGF PLKD+ K  VF+LA +RN+         L   IP  ++E+ PSAEL P Q D
Sbjct: 414 GDMAGGFAPLKDVSKLWVFRLAEYRNT---------LGAAIPRRVIERPPSAELAPGQQD 464

Query: 480 QESLPPYPILDDIIKRIVENEESFINND-QEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
            +SLPPY +LD I++R VE ++S        +++ TV+ V  L+  +EYKRRQAP G ++
Sbjct: 465 SDSLPPYEVLDPILERFVEQDQSVEQIVRAGFDEATVQRVATLVLRNEYKRRQAPPGVRV 524

Query: 539 TAKSFGRDRLYPISNKFRDHIS 560
           T + FG+DR YPI++ +   +S
Sbjct: 525 TRRGFGKDRRYPITSGYGRLLS 546


>gi|238762815|ref|ZP_04623784.1| NAD+ synthase [Yersinia kristensenii ATCC 33638]
 gi|238699120|gb|EEP91868.1| NAD+ synthase [Yersinia kristensenii ATCC 33638]
          Length = 540

 Score =  501 bits (1290), Expect = e-139,   Method: Composition-based stats.
 Identities = 232/556 (41%), Positives = 340/556 (61%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNWLVGDIEGNTERMLQTLHEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + ++ L++ T      ++VG P ++Q  + N++ +   G +     K  LPNY
Sbjct: 61  DFYQRCEAQLNRLQAATQQ--TAVLVGHPWREQGELYNALSLFADGKLQGRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  +  +  RLG+LICED+W +      +K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHQSCVVELKGYRLGLLICEDLWFDGP-VDAVKAAGAEIVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                     L Q+N       +     L      Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 ---------TLLQFNECDVVPMTAPAAELPPLAQVYEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +S            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLSPMFAGSKRDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +     +++  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVADGFDETIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|83648563|ref|YP_436998.1| NAD synthase [Hahella chejuensis KCTC 2396]
 gi|83636606|gb|ABC32573.1| NAD synthase [Hahella chejuensis KCTC 2396]
          Length = 546

 Score =  501 bits (1290), Expect = e-139,   Method: Composition-based stats.
 Identities = 234/557 (42%), Positives = 336/557 (60%), Gaps = 20/557 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKK 60
           + +LK+A AQ++ +VGDI GN+ K   A E A  +   DL++F EL ++GYPPEDL+ + 
Sbjct: 5   MTQLKVAFAQIDCLVGDIPGNVDKVIEAAETAKTKYNADLVIFPELTLTGYPPEDLLLRA 64

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S       A++ +     D    +V+GFP ++Q  + N    +D G I A   K  LPNY
Sbjct: 65  SLQVRVEKALERILYTVKD--IALVIGFPWREQGKLFNCAAFIDGGEIKAKYRKKCLPNY 122

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G     + +R   LG+ ICED+W            GA+F+ ++NASPY 
Sbjct: 123 QVFDEKRYFEPGSDTVVLPWRGFNLGVSICEDVW-EEEPIAATAAAGADFIVNINASPYD 181

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL++R  +V  +     +PI+YVN +GGQDELIFDG SF  +   ++ F    F E  
Sbjct: 182 IAKLQQRRTLVQSRAVTNSVPILYVNMIGGQDELIFDGGSFAVNRHGRVCFSAPQFEEGI 241

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           F+ E +         +      +     +  E + Y A V  +RDYV KN F  V+IGLS
Sbjct: 242 FLLELN------DVIHGEGQETAEPAPTMAVEASIYKALVTGVRDYVNKNRFKSVVIGLS 295

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+  A+AVDA+G + V+ +M+P++YTS  SLEDA A AKALG +Y+V+PI  + +
Sbjct: 296 GGIDSAVTLAVAVDAIGADRVRAVMMPFRYTSQMSLEDAEAEAKALGVQYEVVPIEPIYD 355

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            ENIQ+RIRG ILM +SN + A++LTT NKSE++VGY TLYG
Sbjct: 356 QFMGALNPLFAGLDRDTTEENIQARIRGVILMGISNKTGALVLTTGNKSEMAVGYATLYG 415

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG++ LKD++KT VF+LA +RN+         L+ VIP  ++ + PSAEL P Q D+
Sbjct: 416 DMAGGYDVLKDVFKTMVFRLAWYRNT---------LSPVIPERVITRPPSAELAPDQKDE 466

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD+I+   VE++ S      + ++ ETV  V  L+  +EYKRRQAP+G +IT
Sbjct: 467 DSLPPYEILDEILSLYVEHDVSADGIVAKGFDKETVYRVVRLVDINEYKRRQAPIGARIT 526

Query: 540 AKSFGRDRLYPISNKFR 556
            + FGRDR YPI++ ++
Sbjct: 527 MRGFGRDRRYPITSGWK 543


>gi|56479437|ref|YP_161026.1| NAD synthetase [Aromatoleum aromaticum EbN1]
 gi|56315480|emb|CAI10125.1| Glutamine-dependent NAD+ synthetase [Aromatoleum aromaticum EbN1]
          Length = 538

 Score =  501 bits (1290), Expect = e-139,   Method: Composition-based stats.
 Identities = 240/559 (42%), Positives = 341/559 (61%), Gaps = 23/559 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M K L IA+AQLN  VGD+  N  +  RA ++A   G DL+L  EL +SGYPPEDL+ + 
Sbjct: 1   MDKTLAIAVAQLNFTVGDLTANADRIIRALDQARAAGADLLLTPELALSGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F +ACS  +  +    H  G  +V+G P + ++   N+  ++  G ++A   K  LPNY
Sbjct: 61  DFYRACSREVARIA--LHTDGITLVLGHPEERRDWRYNAASVIRDGEVLATYHKHLLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E+R F  G          ++LG+ IC D+W  S   + ++ +GAE L  LNASPY+
Sbjct: 119 EVFDEERYFDRGLDACVFELNGVKLGVNICADLW-ESGPAELVRAEGAELLLGLNASPYH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NKL +R+E++ G+++   LP++Y N VGGQDEL+FDGASF  D   Q+ +Q   F E+ 
Sbjct: 178 MNKLARRYEVLRGRVADTGLPVVYCNMVGGQDELVFDGASFALDADGQVRYQAASFEERL 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +  +             +        P+  EE  Y A    +RDY+ KN F   IIGLS
Sbjct: 238 DVLHF--------RGGRWEPGEIVPARPI--EEEVYEALKTGVRDYLGKNGFPGAIIGLS 287

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL   IAVDALG E V+ +M+P  YT+  SL+D+ A    LG +YD +PI   +N
Sbjct: 288 GGIDSALTLCIAVDALGPERVRAVMMPSPYTAQMSLDDSRALVANLGVRYDEIPIEPAMN 347

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F  L+++  +  P+    EN+QSRIRG ILMALSN + A++LTT NKSE++ GY TLYG
Sbjct: 348 TFADLLARQFEGLPADTTEENLQSRIRGMILMALSNKTGAIVLTTGNKSEMATGYATLYG 407

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  LKDLYKT VF+L+ WRN+         ++ V+P +I+ + PSAEL+P QTDQ
Sbjct: 408 DMAGGFAVLKDLYKTFVFRLSRWRNT---------VSPVMPENIITRPPSAELKPDQTDQ 458

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD II+  +E +ES      + + +  VR    +L  +EYKRRQ+PVG ++T
Sbjct: 459 DSLPPYDVLDAIIEAYMERDESPREIIARGFPEADVRRTVAMLKRNEYKRRQSPVGIRVT 518

Query: 540 AKSFGRDRLYPISNKFRDH 558
            + FGRD  YPI+++++D 
Sbjct: 519 RRGFGRDWRYPITSRYQDE 537


>gi|253996052|ref|YP_003048116.1| NAD+ synthetase [Methylotenera mobilis JLW8]
 gi|253982731|gb|ACT47589.1| NAD+ synthetase [Methylotenera mobilis JLW8]
          Length = 539

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 227/554 (40%), Positives = 324/554 (58%), Gaps = 23/554 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQ+N +VGD+AGN  K       A  QG  L++  EL + GY PEDL+ +  F++
Sbjct: 1   MKIAIAQINCIVGDLAGNAKKIVAYAASAKEQGATLVVTPELSLCGYSPEDLLLRPDFLR 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC   + TL     D    ++VG P Q+ E   N+  +L+ G+I+A   K  LPNY  F 
Sbjct: 61  ACEDTLQTLAQQLSD--ITVIVGHPHQEGEQCFNAASVLEGGSIVATYHKQVLPNYGVFD 118

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F SG          +++G+LIC D+W         K  GAE L ++N SPY+  K 
Sbjct: 119 EKRYFSSGAEALVFNHCGVKVGVLICADVW-EPKPALLAKMAGAELLIAMNGSPYHMKKQ 177

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R E++  +    +LP++YVN VGGQDEL+FDGASF  + Q ++  ++  F  Q  + E
Sbjct: 178 SARFEVLKQRAVENNLPVVYVNMVGGQDELVFDGASFVLNAQGEVVAELDAFESQLEVIE 237

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           + + Q +             +   L  E   Y A  L L DY+ KN F  V+IGLSGG+D
Sbjct: 238 FDHAQPI----------YGEITPSLSLEATVYKALKLGLADYINKNGFPGVVIGLSGGVD 287

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL  A+AVDA+G + V  +M+P ++T+  S+ DA   A  +G KY+ + I  L + + S
Sbjct: 288 SALTLALAVDAIGADKVHAVMMPSEFTADISVNDAREMADIVGVKYEEIAIKPLFDSYLS 347

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S    + P     EN+Q+RIRG +LMA+SN   ++++TT NKSE++VGY TLYGDM+G
Sbjct: 348 ALSPQFGDMPFDATEENLQARIRGMLLMAISNKFGSIVVTTGNKSEMAVGYCTLYGDMAG 407

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF  LKD+ KT V++L ++RN          L+ VIP  I+ + PSAELR +Q DQ+SLP
Sbjct: 408 GFALLKDVPKTLVYRLCAYRNQ---------LSRVIPERIITRPPSAELRANQVDQDSLP 458

Query: 485 PYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY +LD II+  VEN+ S        Y    +  V  ++  +EYKRRQ+PVG +IT K F
Sbjct: 459 PYDVLDAIIEAYVENDLSRAEIVALGYPISDINRVIAMIDRNEYKRRQSPVGVRITDKGF 518

Query: 544 GRDRLYPISNKFRD 557
           G+DR YPI+ K  +
Sbjct: 519 GKDRRYPITAKLSE 532


>gi|83949870|ref|ZP_00958603.1| NAD(+) synthase [Roseovarius nubinhibens ISM]
 gi|83837769|gb|EAP77065.1| NAD(+) synthase [Roseovarius nubinhibens ISM]
          Length = 552

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 240/558 (43%), Positives = 330/558 (59%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLN  VGDI GN  KARRA +E    G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MSDRFRLTLAQLNATVGDIEGNAEKARRAWQEGRDAGADLVALPEMFITGYNTQDLVRKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q   +AID L  D  D G  + +G P  +   + N+  IL  G +     K +LPN 
Sbjct: 61  VFHQHAIAAIDQLARDCAD-GPALAIGGPWLEGAELHNAYHILQGGQVSRRVLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R + S     P     +R+G  ICED W      + L++ GAE L   N SPYY
Sbjct: 120 TVFDEVRLYGSAPIGGPYAVDGLRIGSPICEDAWHEDVT-ETLEETGAELLLIPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK++ R  ++  ++    LP++Y+N VG QD+ +FDG SF  +   +LA QM  F E  
Sbjct: 179 RNKMETRQNLMVSRVIETGLPLVYLNLVGAQDDQVFDGGSFVLNPGGELALQMPLFQEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +         + W     D A          E DYNA VLSLRDY+ K  F KV++GLS
Sbjct: 238 -IAHLDLVDTGAGWRAEKGDLAPLP----DAWEQDYNAMVLSLRDYMGKTGFKKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A IA DA+G +NV+ +MLP +YTS  SL+DA A A+ LGC YD +PI     
Sbjct: 293 GGIDSAIVATIAADAIGADNVRCVMLPSEYTSQASLDDAKALAENLGCSYDFVPISQSRQ 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +     +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AVTETLAPLFEGHAPDLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP   VIP +I+ K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFETCRWRNANHRDWMMGPAGAVIPENIITKPPSAELRDDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I++ +V+ + S  +     ++ +  + VEHL+Y SEYKR Q+  GT++T
Sbjct: 473 DSLPDYPVLDAILEILVDQDGSIEDCVRAGFDRDVAKRVEHLIYISEYKRFQSAPGTRLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
             +F  DR YPI N++RD
Sbjct: 533 KGAFWLDRRYPIVNRWRD 550


>gi|254477369|ref|ZP_05090755.1| glutamine-dependent NAD(+) synthetase [Ruegeria sp. R11]
 gi|214031612|gb|EEB72447.1| glutamine-dependent NAD(+) synthetase [Ruegeria sp. R11]
          Length = 554

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 245/558 (43%), Positives = 336/558 (60%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGDIAGN  KAR A       G DL+   E+FI+GY  +DL+ K 
Sbjct: 1   MADRFRVTLAQLNPTVGDIAGNADKARAAWAAGKEAGADLVALPEMFITGYNTQDLIQKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q+  + ++ L +D  D G  + +G P      + N+ +IL  G I A   K +LPN 
Sbjct: 61  IFHQSAIAEVERLAADCAD-GPALAIGSPWVRDGNLYNAYLILQGGKISAQVLKHHLPNA 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F SG    P     +R+G  ICED W      + L + GAEFL   N SPYY
Sbjct: 120 TVFDEVRLFQSGPLGGPYAVGGVRIGSPICEDGWYEDV-AETLAETGAEFLLIPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK++ R  ++  +     LP+IY+N VGGQD+ +FDG SF  +    LA QM  F E  
Sbjct: 179 RNKMEVRQNLMVARTVETGLPVIYLNMVGGQDDQVFDGGSFVLNPGGALALQMPVFDEAI 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                  ++    W  +  + AS         E DY     +LRDY++K  F KV++GLS
Sbjct: 239 Q--HLDLERTPDGWRAVEGEKASLP----DAWEQDYQVMTYALRDYMRKTGFKKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL AAIAVDALG ENV+ +MLP +YTS  SL+DA A AKALG  YD +PI +   
Sbjct: 293 GGVDSALVAAIAVDALGAENVRCVMLPSEYTSQGSLDDAEAVAKALGVHYDYVPISEGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++        G+  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITNTLAPLFAGLEEGLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVI PS+++K PSAELR  Q D 
Sbjct: 413 DMNGGYNPIKDLYKTRVFETCRWRNANHRPWMMGPEGEVIRPSVIDKPPSAELREDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD +++ +V+ E S  +     ++ E  + VEHL+Y SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPELDALLEMLVDQEASIADCVAAGFDREVAKRVEHLIYISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI+N++RD
Sbjct: 533 PRAFWLDRRYPIANRWRD 550


>gi|238788204|ref|ZP_04631999.1| NAD+ synthase [Yersinia frederiksenii ATCC 33641]
 gi|238723791|gb|EEQ15436.1| NAD+ synthase [Yersinia frederiksenii ATCC 33641]
          Length = 540

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 233/556 (41%), Positives = 339/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRKLSIALAQLNWLVGDIEGNTERMLQTLHEQQKAGADLVMFSELALSGYPPEDLLYRN 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++        ++VG P +++  + N++ +   G + A   K  LPNY
Sbjct: 61  DFYQRCEAQLDRLQAAAQQ--TAVLVGHPWREEGNLYNALSLFADGKLQARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+    +  +  RLG+LICED+W +      +K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHDTCVVELKGYRLGLLICEDLWFDGP-IDAVKAAGAEVVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYVRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                     L Q+N             L      Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 ---------TLLQFNECEVVPMMAPAAELPPLAQVYEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +S            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLSPMFAGTARDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +     +++  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILQGYVEQDKSVADLVADGFDETIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|87198992|ref|YP_496249.1| NAD synthetase [Novosphingobium aromaticivorans DSM 12444]
 gi|87134673|gb|ABD25415.1| NH(3)-dependent NAD(+) synthetase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 573

 Score =  501 bits (1289), Expect = e-139,   Method: Composition-based stats.
 Identities = 257/560 (45%), Positives = 346/560 (61%), Gaps = 11/560 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M+  L+I +AQLN  VGD+A N+A     RE A     DLI+F EL + GYPPEDL+ K 
Sbjct: 19  MVDTLRITLAQLNQSVGDLAANVAAMLAVRERARD--ADLIVFPELQLIGYPPEDLIMKP 76

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           + ++  ++ ++ L   T DGG  ++VG        + N V +L+ G + A R K  LPNY
Sbjct: 77  ALVERATAELEKLARVTADGGPAMLVGSVFVRDGALHNGVALLEGGRVAATRFKYELPNY 136

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F+ G   +P++F+   LG+ ICEDIW      +HL + GAE    +N SPY 
Sbjct: 137 GTFDEKRYFLPGPLPEPVLFKGAMLGLPICEDIWHPDVC-RHLAELGAEIFICINGSPYE 195

Query: 181 HNKLKKRHEIVTGQIS-HVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
            +K   R + V  + +    +P+ YVN+VGGQDE++FDGASF    +  +  QM  + E 
Sbjct: 196 IDKDVLRIDGVAKRRAIDTGIPLAYVNRVGGQDEIVFDGASFVVGPEGAVWVQMPDWEES 255

Query: 240 NFMTEWHYDQ--QLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
              T WH       ++W   + +       P    E  Y A V++LRDYV KN F  V++
Sbjct: 256 VVTTVWHRSDFGDANRWRCEAGEVHELAEHP----EDIYCAMVMALRDYVNKNRFPGVVL 311

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSA+CAAIAVDALG + V  +MLP +YTS +SL+DAA CA+ LG + D +PI  
Sbjct: 312 GLSGGIDSAICAAIAVDALGPDRVWCVMLPSRYTSQESLDDAAGCARMLGVRLDTVPIGP 371

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
            V+ F  +++         +  ENIQSRIRG  LMALSN    ML+TT NKSE+SVGY T
Sbjct: 372 AVDAFDGMLAPVFAGRQPDLTEENIQSRIRGVTLMALSNKFGPMLVTTGNKSEMSVGYAT 431

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           +YGDM+GG+NPLKD YKT VF ++ WRNSH    GLGP   V+P  I+ K PSAELRP Q
Sbjct: 432 IYGDMNGGYNPLKDAYKTTVFAVSEWRNSHRPKIGLGPDGPVMPQRIITKPPSAELRPDQ 491

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            D +SLPPY +LD I++ +VENE+S        +  +TV  +E LL  +EYKRRQAP G 
Sbjct: 492 KDSDSLPPYDVLDAILQGLVENEKSVDQIVAEGFERDTVARIERLLNLAEYKRRQAPPGV 551

Query: 537 KITAKSFGRDRLYPISNKFR 556
           K+ A+++GRDR YPI++ FR
Sbjct: 552 KLGARNYGRDRRYPITHGFR 571


>gi|269138134|ref|YP_003294834.1| NAD synthase [Edwardsiella tarda EIB202]
 gi|267983794|gb|ACY83623.1| NAD synthase [Edwardsiella tarda EIB202]
 gi|304558179|gb|ADM40843.1| NAD synthetase / Glutamine amidotransferase chain of NAD synthetase
           [Edwardsiella tarda FL6-60]
          Length = 540

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 232/556 (41%), Positives = 334/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +      +  + G D+++F+EL + GYPPEDL+++ 
Sbjct: 1   MSRTLSIALAQLNLLVGDIEGNAERMLAPLAQQQQAGADVVMFSELALCGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C   +  L+  + +    ++VG P +D E + N++ +   G ++A   K  LPNY
Sbjct: 61  DFHQRCQRQLARLQQASAE--IAVIVGHPWRDGECLYNALSVFAEGRLLARYYKQCLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G +   +  +  RLG+LICED+W ++     L   GAE L ++NASPY 
Sbjct: 119 GVFDEKRYFSAGDTPCTVTLKGYRLGLLICEDVWFDAP-VDALAAAGAEVLLTINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R+ ++        LP++Y+NQVGGQDEL+FDG S  FD +  L  ++  F EQ 
Sbjct: 178 REKPYIRNTLLADHCRRTGLPLLYLNQVGGQDELVFDGCSKAFDARGALTHRLAAFDEQV 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                   + L           ++    L      Y A VL++RDYV KN F   ++GLS
Sbjct: 238 TQVRLDDGRLL---------PMASPAAELPPLAQIYQALVLAVRDYVGKNGFQGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK  VQ +M+P++YT+  S+ DA A A A+G ++D+L I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKAQVQAVMMPFRYTADISVADAQAQALAMGVEFDILSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  + ++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPMFAGTERDTTEENLQARCRGVVLMALSNKRRRLVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VFQLA +RN+         L+  IP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFQLARYRNT---------LSPAIPQRVIDRPPSAELAPDQVDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S        +++  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILQGYVEQDKSVAQLVADGFDEAVVRKVIRLVDINEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|171463824|ref|YP_001797937.1| NAD+ synthetase [Polynucleobacter necessarius subsp. necessarius
           STIR1]
 gi|171193362|gb|ACB44323.1| NAD+ synthetase [Polynucleobacter necessarius subsp. necessarius
           STIR1]
          Length = 539

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 223/558 (39%), Positives = 324/558 (58%), Gaps = 22/558 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + KIA+AQ+NP++GD+AGN     +A  +A  QG  L++  EL ++GYPPEDL+ + 
Sbjct: 1   MSAQ-KIALAQINPLLGDLAGNAQLIYKAALDAYSQGAKLVVTPELSLTGYPPEDLLLRP 59

Query: 61  SFIQACSSAIDTLKSDTHDG-GAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
           +FI+A    ++ L  +        ++VG P++   G+ N   +L +G +IA   K  LPN
Sbjct: 60  AFIEAAQQQLELLMKELAQHSDLTVIVGHPKKTSVGLQNYASVLQSGKVIAGYAKQELPN 119

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           +  F E R F+ G          IR G+++CED W      K     GA+ L   NASPY
Sbjct: 120 HEVFDEVRYFVPGNQACVFECDGIRYGMILCEDAWHAGP-AKQAHAAGAQVLLVPNASPY 178

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           +  K   R +++   I+   +P++YVN VGGQDEL+FDG SF  +    +   M  F   
Sbjct: 179 HLKKEALRIDVLREHIAQTKMPLVYVNTVGGQDELVFDGGSFALNSHGDVVMAMPQFETG 238

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
             +       +L +           +  P   E   Y A VL +RDYV KN+F  VIIGL
Sbjct: 239 LGVVSASSSGELEK---------GWITPPQSVEAQAYQALVLGVRDYVTKNHFPGVIIGL 289

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGG+DSAL  AIAVDALG + V+ +M+   YT+  S  DA   A+ L  +YD +PI   V
Sbjct: 290 SGGVDSALVLAIAVDALGADKVRAVMMASHYTADISWIDAREMAENLSMQYDEIPISGPV 349

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           +   + +++           ENIQ+R+RG +LMALSN +  ++LTT NKSE++VGY TLY
Sbjct: 350 DALEASLAKQFTGLNVDATEENIQARVRGTLLMALSNKTGRLVLTTGNKSEMAVGYCTLY 409

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGF  +KD+ KT V++L ++RNS         +  +IP  IL ++PSAELRP Q D
Sbjct: 410 GDMAGGFAVIKDIAKTLVYRLCAYRNS---------IAPIIPERILTRAPSAELRPDQKD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLP Y +LD I++R +E  +S        ++ E+V  V  L+  +EYKRRQAP G ++
Sbjct: 461 QDSLPSYEVLDGIVERYMEQNQSIAQIIAAGFDPESVEKVTRLIKLNEYKRRQAPPGVRV 520

Query: 539 TAKSFGRDRLYPISNKFR 556
           TA++FGRD  YPI+++FR
Sbjct: 521 TARAFGRDWRYPITSQFR 538


>gi|237756468|ref|ZP_04585003.1| glutamine-dependent NAD(+) synthetase [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237691369|gb|EEP60442.1| glutamine-dependent NAD(+) synthetase [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 573

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 228/584 (39%), Positives = 341/584 (58%), Gaps = 40/584 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +KK+++A+AQ+NPVVGD   N  K     E+A +   D++ F EL ++GYPPEDL+ K S
Sbjct: 1   MKKIRLALAQINPVVGDFEYNYNKILEFIEKAKKLEADIVAFPELALTGYPPEDLILKPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           FI+     ++ LK +        +VGF  + ++ V N+  ++    I+ V  K  LPNY 
Sbjct: 61  FIEKNLYYLEKLKENVD--NIIAIVGFIDKQED-VFNAAAVIYNKEIVGVYHKQFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F  G     +   + ++G+ ICEDIW   N        GAE + ++NASPY  
Sbjct: 118 VFDENRYFQKGDGLLLLSIDNYKVGVSICEDIWYPENPVNDYAILGAEVVININASPYSQ 177

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K+K+R E++  +     + I YVN VGGQDEL+FDG S   D Q ++  + + F E+  
Sbjct: 178 GKVKRREEMLKVRSRDNLISIAYVNMVGGQDELVFDGNSLILDTQGEILAKAESFEEELL 237

Query: 242 MTEWHYDQQLS---------------------------QWNYMSDDSASTMYIPLQEEEA 274
           + +   D+                              +    ++  +  + +  +E E 
Sbjct: 238 LADIDLDEIFRLQLKDNRLKNLRYLKKPINVKEIRLDYKIKNKNNQISQKIALDRKEIED 297

Query: 275 DYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQ 334
            Y A V+ LRDY+ KN F KV+IGLSGGIDS+L A IAVDALGKENV+ +++P +YTS +
Sbjct: 298 TYKALVVGLRDYINKNGFKKVVIGLSGGIDSSLTACIAVDALGKENVKGVLMPSQYTSKE 357

Query: 335 SLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMAL 394
           S+EDA   AK L  +   +PI ++ + +     +  +        EN+Q+RIRGNILMAL
Sbjct: 358 SIEDALELAKNLDIETFTIPIKNIFDKYLEEFQEIFKGLKPDTTEENLQARIRGNILMAL 417

Query: 395 SNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLG 454
           SN    +++ T NKSE+SVGY TLYGDM GGF  LKD+ KT+V++L+ +RNS        
Sbjct: 418 SNKFGWIVIATGNKSEMSVGYSTLYGDMVGGFAVLKDVLKTKVYELSYYRNS-------- 469

Query: 455 PLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDE 513
            +++VIP  +L K PSAELRP+QTD+  L PYPILD II+  VE + +     +  + ++
Sbjct: 470 -ISKVIPDRVLTKPPSAELRPNQTDEAELLPYPILDQIIQFYVEQDLTVEEIVKLGFEEK 528

Query: 514 TVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
            V+ + +L+  +EYKRRQAP+G KIT ++FG+DR  PI+N++++
Sbjct: 529 DVKKIINLIDKNEYKRRQAPIGIKITERAFGKDRRMPITNRYKE 572


>gi|257093881|ref|YP_003167522.1| NAD synthetase [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257046405|gb|ACV35593.1| NAD+ synthetase [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
          Length = 536

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 229/555 (41%), Positives = 320/555 (57%), Gaps = 23/555 (4%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            LKIAIAQ+N  VGD AGN  +     E A  QG DL+L  EL + GYPPEDL+ +  F 
Sbjct: 2   PLKIAIAQINATVGDFAGNAQRILDFAERARAQGADLLLTPELSLCGYPPEDLLLRDDFC 61

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
            AC   +  L   +   G  ++VG P +      N+  ++  G  +A   K  LP+Y  F
Sbjct: 62  AACEHELALLA--SRVAGIAVLVGHPEKRAAHCYNAATLITDGTRVATYYKQRLPSYEVF 119

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F SG     +  + +R G+ IC D+W  +      +  GAE L  LNASPY+  K
Sbjct: 120 DEERYFDSGEGPCVLTLKGVRCGVNICADVW-EAGAADLARNAGAEVLLVLNASPYHIGK 178

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
            ++R E++  +I+   LP++Y N  GGQDEL+FDG SF  D +  L  Q+  F E   + 
Sbjct: 179 RERRTEVLRQRIASTGLPVVYANLAGGQDELVFDGGSFVLDSRGTLCCQLPQFEEALGIV 238

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
           ++  D +                     E   Y A VL +RDY+ KN F   IIGLSGGI
Sbjct: 239 DF-VDGEPQAAAIAPAPCL---------EAEVYQALVLGVRDYLGKNGFPGAIIGLSGGI 288

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IAVDALG + V+ +M+P  YT+  SL ++    + LG +YD + I   +  F 
Sbjct: 289 DSALTLCIAVDALGADKVRAVMMPSPYTAELSLAESREMVRLLGIRYDEIAIEPAMQTFA 348

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           +++ Q     P+    EN+Q+RIRG ILMA+SN + +++LTT NKSE++VGY TLYGDM+
Sbjct: 349 AMLEQQFAGLPADTTEENLQARIRGMILMAISNKTGSLVLTTGNKSEMAVGYCTLYGDMA 408

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF  +KD+ KT V++L+ WRN+             IP  I+ + PSAEL+P QTDQ+SL
Sbjct: 409 GGFAVIKDIAKTLVYRLSRWRNTRSYA---------IPERIISRPPSAELKPDQTDQDSL 459

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           PPY +LD I++  +E + S      Q + +  VR V HLL  SEYKRRQAPVG ++T + 
Sbjct: 460 PPYEVLDAIVEAYMEKDLSPRQIIAQGHAEADVRRVVHLLKISEYKRRQAPVGIRVTQRG 519

Query: 543 FGRDRLYPISNKFRD 557
           FG+D  YPI+N++RD
Sbjct: 520 FGKDWRYPITNRYRD 534


>gi|34497071|ref|NP_901286.1| NAD synthetase [Chromobacterium violaceum ATCC 12472]
 gi|34102928|gb|AAQ59292.1| glutamine-dependent NAD+ synthetase signal peptide protein
           [Chromobacterium violaceum ATCC 12472]
          Length = 530

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 221/553 (39%), Positives = 318/553 (57%), Gaps = 24/553 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IA+AQ NPVVGDI GN  K       A  QG D++L  EL ++GY PEDL+ + SF +
Sbjct: 1   MRIALAQFNPVVGDIVGNAQKIVDLANAALAQGADILLTPELALTGYSPEDLLLRDSFYR 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
             +  +D ++      G  ++VG P +      N+  +L  GN +    K+ LPNY  F 
Sbjct: 61  EVARGLDIIEQL---DGITVIVGHPARIGNERFNAATVLRDGNRLGQYHKMLLPNYEVFD 117

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E R F  G +        +++G+LICED W+           GAE L SLNASP++ +K+
Sbjct: 118 ECRYFTPGAAPLVFEQNGVKVGVLICEDAWQLEPAA-EAADAGAELLLSLNASPFHRDKI 176

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           + RH+++  ++    LP+ Y N VGGQDEL+FDG SF  D    +A Q   + ++  + +
Sbjct: 177 ETRHQVMRYRVEETGLPLAYANLVGGQDELVFDGGSFALDKAGNVAAQAAAYDDELLLVD 236

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           +             D            +E+ Y A V+ +RDY+ KN F   ++GLSGGID
Sbjct: 237 F----------AYGDFQPGRQAALPGAQESVYRALVVGVRDYIGKNGFPGALLGLSGGID 286

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL  A+AVDALG + V  +M+P +YT+  S+ D+      LG KYD + I  +   F +
Sbjct: 287 SALTLAVAVDALGADKVHAVMMPSRYTADISVTDSRDMIGRLGVKYDEIEIWPMYESFMA 346

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++            EN+Q+RIRG +LMALSN S  ++LTT NKSE++ GY TLYGDM+G
Sbjct: 347 ALAPSFAGLEMDTTEENLQARIRGTLLMALSNKSGKLVLTTGNKSEMTTGYCTLYGDMAG 406

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF  LKD+ KT VF+L  WRN+         ++++IP  I+ + PSAELRP Q DQ+SLP
Sbjct: 407 GFAVLKDVAKTLVFELCRWRNT---------VSDIIPERIITRPPSAELRPDQKDQDSLP 457

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY +LD I+ R VE+ +S  +     + +  V  V  LL  +EYKRRQAPVG ++T + F
Sbjct: 458 PYEVLDAIMARYVEDNQSAADIIAAGFAEADVNRVVRLLKINEYKRRQAPVGPRVTQRGF 517

Query: 544 GRDRLYPISNKFR 556
           G+D  YPI+NKF 
Sbjct: 518 GKDWRYPITNKFS 530


>gi|302036712|ref|YP_003797034.1| NAD(+) synthase (glutamine-hydrolyzing) [Candidatus Nitrospira
           defluvii]
 gi|300604776|emb|CBK41108.1| NAD(+) synthase (glutamine-hydrolyzing) [Candidatus Nitrospira
           defluvii]
          Length = 589

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 224/596 (37%), Positives = 319/596 (53%), Gaps = 48/596 (8%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           ++ L+IA+AQ+NP VGDIAGN    +   +EA R   DL+ F EL ++GYPPEDL+FK  
Sbjct: 1   MRPLRIAMAQINPTVGDIAGNTRLIQTWIKEARRAKADLVAFPELAVTGYPPEDLLFKPR 60

Query: 62  FIQACSSAIDTLKSDTHDGG----------AGIVVG----FPRQDQEGVLNSVVILDAGN 107
           FI+    A+  + ++                 +       FP   +  + N   +L    
Sbjct: 61  FIEDTQRALKAVAAEARGLVVVVGYVGQGATAVSASEAPSFPLAGRHELYNEAAVLSDRR 120

Query: 108 IIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG 167
           I+A   K +LPNY  F E R F  G     +V     +G+ ICEDIW +    +     G
Sbjct: 121 ILATYRKRHLPNYGVFDESRYFHPGSRLPLLVLNGATIGVNICEDIWFSDGPTRLQASAG 180

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
           AE + ++NASP++  K + R +++  +     + + Y N VGGQDEL+FDG S   D   
Sbjct: 181 AEVIVNINASPFHVGKGRMREQVLATRARENRVIVTYTNTVGGQDELVFDGCSMIVDQAG 240

Query: 228 QLAFQMKHFSEQNFMTEWH------------------------YDQQLSQWNYMSDDSAS 263
           ++  + K F +   + +                           D+   +       S  
Sbjct: 241 EIVGRGKAFEQDLIVADLDVAAVGRVRLAQGRRKPLPPRVAALIDRVDVRLPARKSQSVV 300

Query: 264 TM--YIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENV 321
                 PL   +  Y A VL ++DYV+KN F +V+IGLSGG+DSA+ A IAVDALG ENV
Sbjct: 301 VPDLEPPLGRLDEAYRALVLGVQDYVRKNGFKRVVIGLSGGVDSAITAVIAVDALGAENV 360

Query: 322 QTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAEN 381
             + +P  YTS  S ED A  A+ L  + D L I      +   + +  +        EN
Sbjct: 361 LGVFMPSPYTSRASREDVADMARRLHIQVDTLSITATFKSYLRALGRSFKGRRPDTTEEN 420

Query: 382 IQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLA 441
           +Q+RIRGN+LMA SN    ++LTT NKSE+SVGY TLYGDM+GGF  +KD+ KT V++L+
Sbjct: 421 LQARIRGNLLMAYSNKFGHLVLTTGNKSEMSVGYATLYGDMAGGFAVIKDVPKTMVYELS 480

Query: 442 SWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEE 501
             RN       L     VIP  +LE++P+AELRP Q D++SLPPY ILD I+K  VE + 
Sbjct: 481 HMRN-------LVGPVPVIPKRVLERAPTAELRPDQKDEDSLPPYAILDPILKAYVEEDR 533

Query: 502 SFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           +  +     ++ ETV  V  L+  SEYKRRQAP+G KIT ++FG+DR  PI+N +R
Sbjct: 534 ALEDITAMGFDRETVARVIALVDRSEYKRRQAPLGIKITHRAFGKDRRMPITNGYR 589


>gi|145588869|ref|YP_001155466.1| NAD+ synthetase [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047275|gb|ABP33902.1| NAD+ synthetase [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 539

 Score =  500 bits (1288), Expect = e-139,   Method: Composition-based stats.
 Identities = 228/558 (40%), Positives = 326/558 (58%), Gaps = 22/558 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + KIA+AQ+NP++GD+ GN     +A ++A +QG  L++  EL ++GYPPEDL+ + 
Sbjct: 1   MSAQ-KIALAQINPLLGDLGGNAQLILKASQDAFKQGAKLVVTPELSLTGYPPEDLLLRP 59

Query: 61  SFIQACSSAIDTL-KSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
           +FIQA    +D L +  T      ++VG P+Q   G+ N   +L  G +IA   K  LPN
Sbjct: 60  AFIQASERELDLLMQELTAYPDLTVIVGHPKQTDAGLQNYASVLRNGKVIAGYAKQELPN 119

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           +  F E R F+ G          I  G+++CED W      K     GA+ L   NASPY
Sbjct: 120 HEVFDEVRYFVPGNRACVFECAGIHYGLILCEDAWHPGP-AKQSHAAGAQILLVPNASPY 178

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           +  K   R +++   I   H+P++YVN VGGQDEL+FDG SF  +   ++   +  F   
Sbjct: 179 HLKKEALRIDVLRSHIHKTHMPLVYVNSVGGQDELVFDGGSFALNATGEVVMALPQFETA 238

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
               E     QL +           + +P   E   Y A VL +RDYV KN F  VIIGL
Sbjct: 239 LGYVEVSSAGQLKK---------GVIALPQSVEAQAYQALVLGVRDYVTKNRFPGVIIGL 289

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGG+DSAL  A+AVDALG + V+ +M+  +YT+  S  DA   A  LG +YD +PI   V
Sbjct: 290 SGGVDSALVLAVAVDALGADKVRAVMMASRYTADISWIDARELADNLGVRYDEIPISGPV 349

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           +     +++  +        ENIQ+R+RG +LMALSN +  ++LTT NKSE++VGY TLY
Sbjct: 350 DALEQSLAEQFKGMKVDATEENIQARVRGTMLMALSNKTGRLVLTTGNKSEMAVGYCTLY 409

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGF  +KD+ KT V++L ++RNS         +  VIP  IL ++PSAELRP QTD
Sbjct: 410 GDMAGGFAVIKDIAKTLVYRLCAYRNS---------IKPVIPERILTRAPSAELRPDQTD 460

Query: 480 QESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLP Y +LD I++R +E  +S        ++ E+V  V  L+  +EYKRRQAP G ++
Sbjct: 461 QDSLPSYEVLDGIVERYMEQNQSIEEMIAAGFDAESVEKVTRLIKLNEYKRRQAPPGVRV 520

Query: 539 TAKSFGRDRLYPISNKFR 556
           T ++FGRD  YPI+++FR
Sbjct: 521 TTRAFGRDWRYPITSQFR 538


>gi|253998620|ref|YP_003050683.1| NAD+ synthetase [Methylovorus sp. SIP3-4]
 gi|253985299|gb|ACT50156.1| NAD+ synthetase [Methylovorus sp. SIP3-4]
          Length = 550

 Score =  499 bits (1286), Expect = e-139,   Method: Composition-based stats.
 Identities = 230/555 (41%), Positives = 326/555 (58%), Gaps = 17/555 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
             ++++AIAQ+N VVGD+AGN A+      EA   G +L+L  EL +SGY P+DL+ ++ 
Sbjct: 8   KSQMQVAIAQINCVVGDLAGNAARILSYAHEAKAAGANLMLTPELALSGYSPQDLLLRED 67

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F   C   +  L          +VVG P ++     N+  +L  G I+    K  LPN+S
Sbjct: 68  FTHHCQRELQALAKALPA-DITVVVGHPHREHGRCYNAASVLQGGRIVLTYHKHALPNHS 126

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E R F  G        + +R GILIC D+W      K  K+ GAE L  LNASP++ 
Sbjct: 127 VFDEVRYFSPGNKAGVFEHQGVRCGILICADVW-EPGPAKVSKQAGAELLLVLNASPFHL 185

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K ++R++++  ++    LP++Y N VGGQDEL+FDG S   D       Q+  F+EQ  
Sbjct: 186 EKQQQRYKVLGKRVEETGLPLVYANLVGGQDELVFDGNSVVIDRCGAPVQQLPAFTEQLA 245

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           +       Q       +D +       L  EE+ Y A  L LRDYVQKN F   ++GLSG
Sbjct: 246 LVSIDLSPQNRANPLPADIAPG-----LTREESAYQALTLCLRDYVQKNGFPGAVLGLSG 300

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSAL  AIAVDALG + V  +M+P ++T+  S++DA   A+ LG KY  LPI  L + 
Sbjct: 301 GIDSALTLAIAVDALGADKVHAVMMPSEFTADMSVDDARQMAQLLGVKYTELPIKPLFDQ 360

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F + +++        I  EN+Q+RIRG +LMALSN   +++LTT NKSE++VGY TLYGD
Sbjct: 361 FCATLAEPFAGTSFDITEENLQARIRGMLLMALSNKFGSIVLTTGNKSEMAVGYSTLYGD 420

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGF  LKD+ KT V++LA +RNS         L++VIP  I+ + PSAELR  QTDQ+
Sbjct: 421 MAGGFAVLKDISKTLVYRLARYRNS---------LSQVIPERIIIRPPSAELRHGQTDQD 471

Query: 482 SLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPY +LD I++  VE + S        Y ++ V  V +L+  +EYKRRQ+P+G ++T 
Sbjct: 472 SLPPYDVLDAIMEAYVERDSSRQEIIAMGYREQDVARVLNLIDRNEYKRRQSPIGVRVTE 531

Query: 541 KSFGRDRLYPISNKF 555
           + FG DR YP+ ++F
Sbjct: 532 RGFGLDRRYPVVSRF 546


>gi|238795120|ref|ZP_04638711.1| NAD+ synthase [Yersinia intermedia ATCC 29909]
 gi|238725568|gb|EEQ17131.1| NAD+ synthase [Yersinia intermedia ATCC 29909]
          Length = 540

 Score =  499 bits (1286), Expect = e-139,   Method: Composition-based stats.
 Identities = 232/556 (41%), Positives = 340/556 (61%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +   E  + G  L++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNWLVGDIEGNTERMLQTLNEQQKAGASLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++ T      ++VG P +++  + N++ +   G ++    K  LPNY
Sbjct: 61  DFYQRCEAQLDRLQAATQQ--TAVLVGHPWREEGNLYNALSLFAEGKLLGRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  +     RLG+LICED+W +       K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHESCVVELNGYRLGLLICEDLWFDGP-VDAAKAAGAEVILSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++ G      LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAGHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            M          Q N  +    +     L      Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 TM---------LQLNECNVVPMTAPAAELPPLAQVYEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F S ++            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMSQLAPMFAGTGRDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +     +++  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVADGFDEAIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|239907746|ref|YP_002954487.1| probable glutamine-dependent NAD(+) synthetase [Desulfovibrio
           magneticus RS-1]
 gi|239797612|dbj|BAH76601.1| probable glutamine-dependent NAD(+) synthetase [Desulfovibrio
           magneticus RS-1]
          Length = 583

 Score =  499 bits (1286), Expect = e-139,   Method: Composition-based stats.
 Identities = 206/583 (35%), Positives = 302/583 (51%), Gaps = 39/583 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  L++A+ QLNP VGD+A N A        A   G D+++F E+ ++GYPPEDL+ K  
Sbjct: 1   MPALRLALCQLNPTVGDVAANAADVVSRLTAARDGGADIVVFPEMVVAGYPPEDLLLKPD 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC +A   +  ++   G   + G P  + + ++N+ ++   G +  +  K  LPNY 
Sbjct: 61  FVAACMAAARDIARESQ--GLTAIFGCPWFEGD-LVNAAIVAHDGAVAGIVAKRFLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG-AEFLFSLNASPYY 180
            F E R F +G          +  G+ +CEDIW          K G A  L +++ASPY+
Sbjct: 118 VFDENRYFAAGQGTTVFDRGGLIFGVSVCEDIWYPDGPPTEQAKHGGARLLINISASPYH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++  + +     + Y N VGGQDEL+FDG S  F     L  + + F E  
Sbjct: 178 MGKGTSRERMLATRAADNGAFVAYANLVGGQDELVFDGHSLVFAPDGALLARGRQFDEDM 237

Query: 241 FMTEWHYDQQLSQW---------------------------NYMSDDSASTMYIPLQEEE 273
              +   D    Q                                  + +TM  PL+   
Sbjct: 238 VWCDLDVDLPTRQRLLDPRCRKWEPAPACRPVRTALSPLAAPARPALAQATMAAPLEPVA 297

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             Y A V + RDYV+K+ F  V +GLSGGIDS+L A IA DALG ENV  + +P +++S 
Sbjct: 298 EVYRALVTATRDYVRKSGFCGVALGLSGGIDSSLTAIIAADALGPENVLGVAMPTRFSSD 357

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMA 393
            SLEDA A A+ LG +   + I  +   F   +     + P  +  EN+Q R+RG +LMA
Sbjct: 358 DSLEDAQALAERLGIELKTVVIEPIFQAFLDALGPIFGDRPFDVTEENLQPRVRGTLLMA 417

Query: 394 LSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGL 453
           LSN    ++LTT NKSE+ VGY TLYGD +GG+  +KD+ KT V+ L+ WRN        
Sbjct: 418 LSNKFGRLVLTTGNKSEVGVGYSTLYGDTAGGYAVIKDVPKTLVYALSRWRNEQAG---- 473

Query: 454 GPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYND 512
               +VIP  +L K P+AELRP+Q D +SLP Y +LD  ++  VE   S     ++  + 
Sbjct: 474 ---LDVIPERVLVKPPTAELRPNQKDSDSLPEYDVLDPTLQAYVELGLSPAAMLERGLDP 530

Query: 513 ETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
             V  V  L+  +EYKRRQ+P G KIT+++FG+D   PI N++
Sbjct: 531 AVVDRVTRLVDRNEYKRRQSPPGPKITSRAFGKDWRLPIVNRY 573


>gi|209885642|ref|YP_002289499.1| glutamine-dependent NAD(+) synthetase [Oligotropha carboxidovorans
           OM5]
 gi|209873838|gb|ACI93634.1| glutamine-dependent NAD(+) synthetase [Oligotropha carboxidovorans
           OM5]
          Length = 584

 Score =  499 bits (1286), Expect = e-139,   Method: Composition-based stats.
 Identities = 271/567 (47%), Positives = 368/567 (64%), Gaps = 13/567 (2%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
            ++  + +AQ+NP VGDI+GN AKA  AR +A   G  L++  ELF+ GYPPED+V K +
Sbjct: 4   SERFVVTLAQINPTVGDISGNAAKAWAARAKAAADGASLLVLPELFLCGYPPEDIVLKPA 63

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F   C + I+TL   T DGG  +++G P  D+  + N+V +LD G +  +R K NLPNY 
Sbjct: 64  FQARCRAEIETLARATADGGPAVLIGTPWVDEGKLYNAVALLDGGRVAGLRFKANLPNYG 123

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWK-----NSNICKHLKKQGAEFLFSLNA 176
            F EKR F  G +  P+  R +R+G+ ICED W        N+ + L + GAE L   N 
Sbjct: 124 VFDEKRIFARGPAAGPLTVRGVRIGVPICEDTWMEESAEYENVVECLAETGAEILIVPNG 183

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY  NK   R  +   +I+   LP IY+NQVGGQDEL+FDGASF  +  + LA Q+  F
Sbjct: 184 SPYARNKNDIRLSMAVARITESGLPFIYLNQVGGQDELVFDGASFAINADRSLAAQLPCF 243

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E      W  D+    W      S       L+ + ADY ACVL LRDYV KN F  V+
Sbjct: 244 QESITTLTWLRDEN--GWTCKGPVSPM-----LEGDRADYAACVLGLRDYVGKNGFPGVL 296

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +G+SGGIDSALC AIAVDA+G E V+ +MLPY++T+ +S+EDAA  A+A G +Y+VLPI 
Sbjct: 297 LGISGGIDSALCLAIAVDAIGVERVRGVMLPYRFTAKESIEDAARIARAFGIRYEVLPIA 356

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
             V  F  ++    + +P  +  EN+Q+R RG +LMA+SN    ML+TT NKSE+SVGY 
Sbjct: 357 AAVTGFEGILKDTFKGKPRDVTEENLQARTRGVLLMAISNKFGDMLVTTGNKSEMSVGYA 416

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGFNP+KD+YKT+VF+L+S RNS      LGP  +VIP SI+ + P+AELR +
Sbjct: 417 TLYGDMNGGFNPIKDIYKTEVFRLSSLRNSWKPEGALGPSGKVIPVSIIARPPTAELREN 476

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           QTDQ+SLPPY ILD I++R+VE++ S     ++ ++ +TV  ++ LL  +EYKRRQA  G
Sbjct: 477 QTDQDSLPPYDILDGILERLVEHDMSVAEIVEEGFDRDTVMRIDRLLNLAEYKRRQAAPG 536

Query: 536 TKITAKSFGRDRLYPISNKFRDHISEE 562
            K+T +SFGRDR YPI+N+FRD+   E
Sbjct: 537 VKVTRRSFGRDRRYPITNRFRDNGESE 563


>gi|298571422|gb|ADI87762.1| NAD+ synthetase [uncultured Nitrospirae bacterium MY4-5C]
          Length = 577

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 228/587 (38%), Positives = 330/587 (56%), Gaps = 43/587 (7%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M+K L++A+AQ+NP VG I  N  K     E+A R   D++ F EL I+GYPPEDL+ K 
Sbjct: 1   MVKTLRLALAQINPTVGSIKKNSEKIISFIEDARRHSADIVAFPELCITGYPPEDLLLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           SF++    A+D +K  T      +VVGF  +  + + N+  +L    II +  KI LPNY
Sbjct: 61  SFLKDNIKALDEIKRHT--NDIAVVVGFADKQDD-IYNAAALLYNHQIIDIYHKIFLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F SG  +         +G+ ICEDIW            GAE + ++NASPY 
Sbjct: 118 GVFDELRYFQSGVLSPVYEIAGCLVGLNICEDIWYPDGPAYKQSLAGAELIININASPYG 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK K +  +++ +     + + Y+N VGGQDEL+FDG+S  FD   ++  +   F+E+ 
Sbjct: 178 FNKSKAKDTMLSARAFDNRVILAYLNTVGGQDELVFDGSSTVFDSTGEVLARGASFTEEL 237

Query: 241 FMTEWHYD----------QQLSQWNYMSDDSASTMYIP--------------------LQ 270
            + +   +          ++  +   +  +    +++                     + 
Sbjct: 238 IVVDLDMEGVFVSRLHDPRRRQKVKALCHNEIKRVFVCDRVPGEKSPIKLIKRMPVRQMD 297

Query: 271 EEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKY 330
            +E  YNA VL  RDYV KN F  V+IGLSGGIDS++ A IAVDA+G ENV+ I +P  Y
Sbjct: 298 RDEEIYNALVLGTRDYVTKNGFKSVVIGLSGGIDSSIVACIAVDAIGPENVRGIFMPSPY 357

Query: 331 TSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNI 390
           TS  S ED    ++ L  +   +PI  + + +   ++     + +    EN+Q+RIRGNI
Sbjct: 358 TSQDSREDVCELSENLKIRTTEIPIAGIFSTYLGELTAAFDGKAADTTEENLQARIRGNI 417

Query: 391 LMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGIT 450
           LMA+SN    ++LTT NKSE+S GY TLYGDM+GGF  +KD+ K  V++L+ WRNS    
Sbjct: 418 LMAMSNKFGPLVLTTGNKSEMSAGYATLYGDMAGGFAVIKDVPKMMVYKLSRWRNS---- 473

Query: 451 SGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-E 509
                +TEVIP  +L K+P+AELR +Q D +SLPPY ILD II+  VE E          
Sbjct: 474 -----VTEVIPERVLTKAPTAELRHNQKDSDSLPPYEILDTIIESYVEKEMGLEEITTLG 528

Query: 510 YNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
            +++TVR    L+ GSEYKRRQ+P G KIT ++FG+DR +PI+N +R
Sbjct: 529 IDEQTVRKALALIDGSEYKRRQSPPGIKITGRAFGKDRRFPITNGYR 575


>gi|192290590|ref|YP_001991195.1| NAD synthetase [Rhodopseudomonas palustris TIE-1]
 gi|192284339|gb|ACF00720.1| NAD+ synthetase [Rhodopseudomonas palustris TIE-1]
          Length = 587

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 277/563 (49%), Positives = 373/563 (66%), Gaps = 13/563 (2%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           +L I++AQLNP VGDIAGN  KAR AR +A   G DLI++ ELFI+GYPPEDLV K +F 
Sbjct: 7   RLTISLAQLNPTVGDIAGNADKARAARRQAAADGADLIVYPELFIAGYPPEDLVLKPAFQ 66

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
            AC +AI+ L  +T DGG  +++G P  D   + N+  +LD G I A+R K+NLPNY  F
Sbjct: 67  AACRAAIEDLARETADGGPAMLIGSPWVDNGKLYNACALLDGGRIAAIRHKVNLPNYGVF 126

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIW-----KNSNICKHLKKQGAEFLFSLNASP 178
            EKR F  G  + P+  R +R+G+ ICED W        N+ + L + GAE L   N SP
Sbjct: 127 DEKRVFARGPVSGPVTIRGVRIGVPICEDTWLEESEDYENVVECLAETGAELLVVPNGSP 186

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K   R  +   +++   LP++YVNQVGGQDEL+FDGASF  +  + LA Q+  F E
Sbjct: 187 YARGKNDMRMSVSVARVTESDLPLVYVNQVGGQDELVFDGASFVLNADRTLAAQLPGFVE 246

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
              +T   + +  + W          +   ++ +EADY ACVL LRDYV+KN F  V++G
Sbjct: 247 S--VTTLSFVKGAAGWRC-----DGPVAPVIEGDEADYAACVLGLRDYVRKNGFPGVLLG 299

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           +SGGIDSALCAAIAVDALG + V+ +MLP++YT+  SL+DA   A ALG  Y+VLPI   
Sbjct: 300 ISGGIDSALCAAIAVDALGADKVRGVMLPFRYTAQISLDDAGRLASALGFGYEVLPIAQA 359

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V  F +++++        I  EN+Q+R RG +LMA+SN + AM++TT NKSE+SVGY TL
Sbjct: 360 VEGFEAILAKPFAGLERDITEENLQARTRGTLLMAISNKTGAMVVTTGNKSEMSVGYATL 419

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGFNP+KD+YKTQVF+L+S RN       LGP  EVIP SI+ + P+AELR +QT
Sbjct: 420 YGDMNGGFNPIKDIYKTQVFRLSSLRNRWKPDDALGPDGEVIPESIIIRPPTAELRENQT 479

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLPPY +LD I++R+VE E+   +     ++ +TV  ++ LL  +EYKRRQA  G K
Sbjct: 480 DQDSLPPYDVLDAILERLVEREQPLASIVAEGFDKDTVVRIDRLLNIAEYKRRQAAPGVK 539

Query: 538 ITAKSFGRDRLYPISNKFRDHIS 560
           +T K+FGRDR YPI+N+FRD   
Sbjct: 540 VTRKNFGRDRRYPITNRFRDKAE 562


>gi|146277632|ref|YP_001167791.1| NAD synthetase [Rhodobacter sphaeroides ATCC 17025]
 gi|145555873|gb|ABP70486.1| NH(3)-dependent NAD(+) synthetase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 554

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 246/559 (44%), Positives = 350/559 (62%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M ++ ++ +AQLNP VGD+A N+A AR+A E A   G D++  TE+F++GY  +DLV ++
Sbjct: 1   MTERFRLTLAQLNPTVGDLAANVALARKAWEAARAAGSDMVALTEMFVTGYQTQDLVMRR 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++   +AI+ L +D  + G  I +G P  + + ++N   +L+ G + A   K +LPN 
Sbjct: 61  AFVRDAMAAIERLAADCAE-GPAIGIGGPCLEGDRLMNGYWLLEGGRVTATVFKHHLPNG 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F SG  + P     +R+GI ICED W      + L + GAE L   N SPY+
Sbjct: 120 EVFDEKRLFSSGEVHGPCRVGPLRIGIPICEDSWHPDVC-ETLAETGAEILLVPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R  ++  ++    LP++Y+N VGGQD+ +FDGASF  +   +L  Q+  F E  
Sbjct: 179 REKLDVRVNLMVTRVVETGLPLVYLNMVGGQDDQVFDGASFVLNPHGRLMAQLPAFEEAL 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              ++  +     W  +     +         EADY+A V+ LRDY+ K+ F +V++GLS
Sbjct: 239 VHVDF--EATDEGWRALPAPIVAQP----DLWEADYHAMVVGLRDYLGKSGFSRVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL AAIA DALG E V+ +MLP +YTS  SLEDAAA A+ALGC+ D + I     
Sbjct: 293 GGIDSALVAAIAADALGPEAVRCVMLPSRYTSRHSLEDAAAVARALGCRLDEVGIEGPQE 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + +    +    GI  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AVGAALGPLFEGTAPGITEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYCTIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNP+KDLYKT+VFQ+  WRN+H      GP  EVIPP +++K PSAELR  Q D+
Sbjct: 413 DMNGGFNPIKDLYKTRVFQMCRWRNAHHRPWMKGPAGEVIPPRVIDKPPSAELREGQKDE 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY  LD I++ +V+ EES      + ++ ETV  VE L++ SE+KR Q+  GT++T
Sbjct: 473 DSLPPYATLDAILEGLVDREESAAELVARGFDRETVTKVERLIFLSEWKRFQSAPGTRLT 532

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++F  DR YP+ N++RD 
Sbjct: 533 RRAFWLDRRYPMVNRWRDE 551


>gi|238784206|ref|ZP_04628219.1| NAD+ synthase [Yersinia bercovieri ATCC 43970]
 gi|238714915|gb|EEQ06914.1| NAD+ synthase [Yersinia bercovieri ATCC 43970]
          Length = 540

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 232/556 (41%), Positives = 338/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L +A+AQLN +VGDI GN  +  +   E  + G  L++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSVALAQLNWLVGDIEGNTERMLQTLNEQQKAGASLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++ T      ++VG P ++   + N++ +   G ++A   K  LPNY
Sbjct: 61  DFYQRCEAQLDRLQAATQ--HIAVLVGHPWREAGNLYNALSLFSEGKLLARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  +  +  RLG+LICED+W +       K  GAE L S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHDSCVVELKGYRLGLLICEDLWFDGP-VDAAKAAGAEVLLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    L  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGNLTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                     L Q N             L      Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 ---------TLLQLNECEVVPMMAPAAELPPLAQVYEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPMFAGTARDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+++RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSAYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +     +++  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVADGFDETIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|238750370|ref|ZP_04611871.1| NAD+ synthase [Yersinia rohdei ATCC 43380]
 gi|238711301|gb|EEQ03518.1| NAD+ synthase [Yersinia rohdei ATCC 43380]
          Length = 540

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 233/556 (41%), Positives = 339/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRKLSIALAQLNWLVGDIEGNTERMLQTLHEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++ +      ++VG P +++  + N++ +   G + A   K  LPNY
Sbjct: 61  DFYQRCEAQLDRLQAASMA--TAVLVGHPWREEGNLYNALSLFANGKLQARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+    +  +  RLG+LICED+W +      +K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHDTCVVELKGYRLGLLICEDLWFDGP-VDAVKAAGAEVVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKVFDAAGTMTHRLAAFVEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            M          Q N       +     L      Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 TM---------LQLNECEVVPMAAPAAELPPLAQVYEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +S            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLSPMFAGTARDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +     +++  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVADGFDEAIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|94497814|ref|ZP_01304380.1| NAD+ synthetase [Sphingomonas sp. SKA58]
 gi|94422703|gb|EAT07738.1| NAD+ synthetase [Sphingomonas sp. SKA58]
          Length = 553

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 256/560 (45%), Positives = 341/560 (60%), Gaps = 13/560 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  KL IA+AQ+   VGD+  N          A  +G DLI+F EL + GYPPEDLV K 
Sbjct: 1   MTDKLVIALAQMTQSVGDLKANADAMLEW--RARAKGADLIVFPELQLIGYPPEDLVLKP 58

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           + +      +D +  +T DGG  ++VG     Q  + N V +LD G +  VR K  LPNY
Sbjct: 59  ALVTQADYQLDRMAQETADGGPAMLVGTVVAAQGVLFNVVALLDNGAVTTVRAKRELPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G    PI FR +++G+ ICEDIW       HL+ +GAE L S N SP+ 
Sbjct: 119 GTFDEKRLFAPGPLPAPIDFRGVKIGVPICEDIWFPFVTA-HLRSEGAEILISPNGSPFE 177

Query: 181 HNKLKKRHEIVT-GQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
            +K  +R   V   ++    LP+ Y+N+VGGQDEL+FDGASF  +    +A Q+  + E 
Sbjct: 178 VDKDDRRLNAVAGTRVRETGLPLAYLNRVGGQDELVFDGASFVMNADLSIAQQLPDWEEA 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
             +T+W  ++   QW  +  D       P       YNA VL LRDYV +N F  +++GL
Sbjct: 238 LVLTQW--EKWDGQWVCLPGDRHELDPRPAD----IYNAMVLGLRDYVNRNRFPGIVLGL 291

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL AA+AVDALG + V  +M+P ++TS  SL+DA ACA+ LG +YD++PI   V
Sbjct: 292 SGGIDSALSAAVAVDALGADRVWCVMMPSRFTSQDSLDDAVACARLLGVRYDIIPIEPAV 351

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F +++          +  EN+QSRIRG  LMALSN    MLLTT NKSE+SVGY T+Y
Sbjct: 352 GAFDAMLGPVFDGRAPDLTEENLQSRIRGVTLMALSNKCGHMLLTTGNKSEMSVGYATIY 411

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGIT--SGLGPLTEVIPPSILEKSPSAELRPHQ 477
           GDM+GG++ LKD YKT VF L+ WRN+H  +  +G+GP   V+P  ++ K PSAELR  Q
Sbjct: 412 GDMAGGYSVLKDAYKTTVFDLSRWRNAHVPSLGAGMGPAGPVMPERVITKPPSAELRADQ 471

Query: 478 TDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            D +SLPPY ILD I+  +VE E S  +   + +  ETV  +E LLY +EYKRRQAP G 
Sbjct: 472 RDDDSLPPYEILDPILYGLVEEELSVDDLVARGFEKETVARIERLLYVAEYKRRQAPPGV 531

Query: 537 KITAKSFGRDRLYPISNKFR 556
           K+  ++FGRDR YPI+N FR
Sbjct: 532 KLGIRNFGRDRRYPITNAFR 551


>gi|294010307|ref|YP_003543767.1| NAD+ synthase (glutamine-hydrolyzing) [Sphingobium japonicum UT26S]
 gi|292673637|dbj|BAI95155.1| NAD+ synthase (glutamine-hydrolyzing) [Sphingobium japonicum UT26S]
          Length = 553

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 253/560 (45%), Positives = 339/560 (60%), Gaps = 13/560 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  KL IA+AQ+   VGD+A N       R  A     DLI++ EL + GYPPEDLV K 
Sbjct: 1   MTDKLVIALAQMTQSVGDLAANADAMLEWRTRAME--ADLIVYPELQLIGYPPEDLVLKP 58

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           + +   +  +D L   T DGG  ++VG     Q  + N V +L+ G + A+R K  LPNY
Sbjct: 59  ALVDRANHELDRLAQATADGGPAMLVGTVVASQGVLFNVVALLEDGAVTAIRQKRELPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G    PI FR +++G+ ICEDIW       HL+ +GAE L S N SP+ 
Sbjct: 119 GTFDEKRLFAPGPLPAPIDFRGVKIGVPICEDIWFPFVTA-HLRAEGAEILISPNGSPFE 177

Query: 181 HNKLKKRHEIVT-GQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
            +K  +R   V   ++    LP++Y+N+VGGQDEL+FDGASF  +G   LA Q+  + E 
Sbjct: 178 VDKDDRRINAVAGTRVRETGLPLVYLNRVGGQDELVFDGASFVMNGDLSLAHQLPDWEEA 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
             +T W       +W           ++  +     YNA VL LRDYV KN F  V++GL
Sbjct: 238 LVLTHWE------KWEGQWVCLPGERHVLDERPADIYNAMVLGLRDYVNKNRFPGVVLGL 291

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL AA+AVDALG + V  +M+P ++TS +SL+DA  CA+ LG +YD +PI   V
Sbjct: 292 SGGIDSALSAAVAVDALGADRVWCVMMPSRFTSRESLDDAIECARLLGVRYDSIPIEPAV 351

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F ++++         +  ENIQSRIRG  LMALSN    MLLTT NKSE+SVGY T+Y
Sbjct: 352 EAFDAMLADVFTGRQRDLTEENIQSRIRGVTLMALSNKYGHMLLTTGNKSEMSVGYATIY 411

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSG--LGPLTEVIPPSILEKSPSAELRPHQ 477
           GDM+GG++ LKD YKT VF L  WRN +  + G   GP   V+P  ++ K PSAELR +Q
Sbjct: 412 GDMAGGYSVLKDAYKTTVFDLCRWRNENVPSLGEAFGPEGPVMPDRVITKPPSAELRDNQ 471

Query: 478 TDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            D++SLPPY +LD I+  +VE E S      + ++ +TV  +E LLY +EYKRRQ+P G 
Sbjct: 472 KDEDSLPPYEVLDPILYGLVEEELSVEQLVARGFDKDTVARIERLLYVAEYKRRQSPPGV 531

Query: 537 KITAKSFGRDRLYPISNKFR 556
           K+  ++FGRDR YPI+N FR
Sbjct: 532 KLGMRNFGRDRRYPITNAFR 551


>gi|293609041|ref|ZP_06691344.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829614|gb|EFF87976.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 541

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 225/556 (40%), Positives = 320/556 (57%), Gaps = 21/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTQKMIEQVNQAKKQDADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQ-DQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L          +V GF  Q +     NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQLAEV---KDIVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   + +  LN+SPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTVLVLNSSPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL I+YVNQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRIQTLSELAKQLHLNIVYVNQVGGQDDLIFDGTSFVSNQNGEIALQAPSFKEDI 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           ++ E+  D +L +    +          L+     Y   V++ RDYV+++ F  VI+GLS
Sbjct: 237 YIAEFDRDTKLYKVTESAPA--------LETFAEIYQGLVMATRDYVERSGFPGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +VN
Sbjct: 289 GGIDSALTLAIAVDAIGAEKVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSIVN 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +  F    P+    EN+Q+R RG +LM LSN    ++L T NKSE+SVGY TLYG
Sbjct: 349 SFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLATGNKSELSVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF  LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q DQ
Sbjct: 409 DMVGGFAVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LD I+   +E +    +   + ++ E V  V  L+  +EYKRRQ  +G +IT
Sbjct: 462 DSLPAYDVLDAILYAYIEEDLGQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGPRIT 521

Query: 540 AKSFGRDRLYPISNKF 555
           +++F R+R YPI N +
Sbjct: 522 SRAFSRERRYPIVNGW 537


>gi|149928337|ref|ZP_01916578.1| NAD synthetase [Limnobacter sp. MED105]
 gi|149822922|gb|EDM82167.1| NAD synthetase [Limnobacter sp. MED105]
          Length = 544

 Score =  499 bits (1284), Expect = e-139,   Method: Composition-based stats.
 Identities = 227/551 (41%), Positives = 317/551 (57%), Gaps = 15/551 (2%)

Query: 8   AIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACS 67
           AIAQLN  VGD+ GN AK      +A  QG+ ++L  EL I+GYPPEDL+ + SF +   
Sbjct: 2   AIAQLNLTVGDLKGNCAKILEYAHKAAAQGVRILLTPELSITGYPPEDLLLRPSFQRQTD 61

Query: 68  SAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKR 127
           +A + L+ +       +VVG P   +  + N+  +L  G ++ +  K +LPN   F E+R
Sbjct: 62  TAFEHLRQELAALDLYVVVGHPVSREGELFNAASVLYKGQVVGMYHKHDLPNREVFDEQR 121

Query: 128 TFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKR 187
            F             IR G+ ICED W            GAE L   NASPY+  K   R
Sbjct: 122 YFTPDNRPLVFEVDGIRFGLNICEDTWNRYAPE-AAAAAGAEVLLVPNASPYHMGKQTIR 180

Query: 188 HEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHY 247
             +V  ++    + I+Y N +GGQDEL+FDGASF  DG+Q +A ++  F E   M     
Sbjct: 181 QSMVAKRVQETGMAIVYANMLGGQDELVFDGASFAMDGKQHVAMRLPQFQEALAM----L 236

Query: 248 DQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSAL 307
           D        +  ++       L+     Y A  + + DYV KN F   IIGLSGG+DSA+
Sbjct: 237 DAVARPGEPIVLEAHQPCVPELELTAQVYEALKMGVHDYVTKNRFPGAIIGLSGGVDSAI 296

Query: 308 CAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMS 367
             AIAVDALG + V+ +M+P  YT+  SL+D+    + LG +YD + I D +N F S ++
Sbjct: 297 TLAIAVDALGADKVRAVMMPSPYTADISLDDSRDMVRRLGIQYDEISIQDCMNAFDSSLA 356

Query: 368 QFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFN 427
              +   +    EN+Q+RIRG +LMA+SN +  ++LTT NKSE++ GY TLYGDM+GGF 
Sbjct: 357 PLFKGLAADTTEENLQARIRGTMLMAISNKTGRIVLTTGNKSEMATGYCTLYGDMAGGFA 416

Query: 428 PLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYP 487
            +KD++KT V+QL  +RNS         L+EVIP  I+ + PSAELRP Q DQ+SLPPY 
Sbjct: 417 VIKDIFKTLVYQLCEYRNS---------LSEVIPTRIITRPPSAELRPDQVDQDSLPPYD 467

Query: 488 ILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRD 546
           +LD I+ R +E +ES  N     +  E V     LL  +EYKRRQAPVG ++T ++FGRD
Sbjct: 468 VLDAILARYMEKDESVENIVASGFQKEDVFKAVKLLRINEYKRRQAPVGIRVTHRAFGRD 527

Query: 547 RLYPISNKFRD 557
             YPI++KF D
Sbjct: 528 WRYPITSKFND 538


>gi|317493146|ref|ZP_07951569.1| NAD synthase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918806|gb|EFV40142.1| NAD synthase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 540

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 233/556 (41%), Positives = 338/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +      E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNWLVGDIEGNTERMLNTLCEQRKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F   C + +D L+  + D    ++VG P ++ E + N++ +   G ++A   K  LPNY
Sbjct: 61  DFYLRCQAQLDRLQQASTD--IAVLVGHPWREGEHLYNALSLFSEGQLVARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  +  +  RLG+LICED+W +      +   GAE L S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHESCVVELKGYRLGLLICEDLWFDGP-VDAVAAAGAEVLLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++T       LP++Y+NQVGGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLLTSHCQRTGLPLVYLNQVGGQDELIFDGCSKGFDASGNMTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +   H          M  +        L E    Y A VL++ DYV KN F   ++GLS
Sbjct: 238 ALFNLHD---------MQVEPMVAPAASLPELAQIYEALVLAVHDYVTKNGFQGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++D++ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQAMMMPFRYTADISIADAKEEAEILGVEFDIVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  + ++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPMFAGTERDTTEENLQARCRGVVLMALSNKRRRLVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVIDRPPSAELAPDQLDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +     +++  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVAAGFDEAVVRKVIRLVDINEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|291614117|ref|YP_003524274.1| NAD+ synthetase [Sideroxydans lithotrophicus ES-1]
 gi|291584229|gb|ADE11887.1| NAD+ synthetase [Sideroxydans lithotrophicus ES-1]
          Length = 534

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 231/554 (41%), Positives = 324/554 (58%), Gaps = 23/554 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQ+N  VGD+AGN AK     + A +QG  ++L  EL + GYPPEDL+ +  F  
Sbjct: 1   MKIAIAQINCTVGDLAGNAAKIAEYAQRAKKQGAGILLTPELSLCGYPPEDLLLRDGFYH 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC +A+  L       G  ++VG PR+      NS  +L  G I+A  +K  LPN+S F 
Sbjct: 61  ACDTALRDLALQAQ--GITLIVGHPRKIDRHFYNSASVLRDGKIVATYNKHALPNHSVFD 118

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E+R F  G     I    +R GI IC D+W      +  K+ GA+ L  LNASPY+ NK 
Sbjct: 119 EERYFAHGNEPCLIELDGVRFGINICADVWHEHAAIRA-KEAGAQVLLVLNASPYHFNKQ 177

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R+E +  +I    L ++Y N VGGQDEL+FDGASF  D + +L  Q   F E   + E
Sbjct: 178 DTRYETIRERIVDTGLAVVYANMVGGQDELVFDGASFVMDNEGELTHQFPAFDELLGLVE 237

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           +  D +L      +            +E + Y A  + +RDY+ KN F  V++GLSGGID
Sbjct: 238 FE-DGKLVPGKCENVVK---------DEASIYRALCVGVRDYIGKNRFPGVLLGLSGGID 287

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL  A+AVDALG + V  +M+P  YT+  S++D+    + LG +Y+ L I         
Sbjct: 288 SALTLAVAVDALGADKVLAVMMPSPYTAQMSIDDSREMVRLLGVRYEELDILPTFTALQE 347

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +S   +  P+    EN+Q+RIRGN+LMA+SN + +++LTT NKSE++VGY TLYGDM+G
Sbjct: 348 TLSPLFKGLPADTTEENLQARIRGNLLMAISNKTGSLVLTTGNKSEMTVGYATLYGDMAG 407

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF  LKD+ KT V++L++WRNS         +  VIP  I+ + PSAEL+P QTDQ+SLP
Sbjct: 408 GFAVLKDVSKTWVYRLSNWRNS---------MGRVIPERIITRPPSAELKPDQTDQDSLP 458

Query: 485 PYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
            Y +LD I+   VE   +    +   Y    V  V  L+  +EYKRRQAPVG +IT + F
Sbjct: 459 LYDVLDAIMACYVEKNMNIAQIEDLGYASADVLRVVRLIRIAEYKRRQAPVGVRITDRGF 518

Query: 544 GRDRLYPISNKFRD 557
           G+D  YPI+ +++D
Sbjct: 519 GKDWRYPITVRYQD 532


>gi|325121187|gb|ADY80710.1| putative glutamine-dependent NAD(+) synthetase [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 541

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 225/556 (40%), Positives = 319/556 (57%), Gaps = 21/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTQKMIEQVNQAKKQDADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQ-DQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L          +V GF  Q +     NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQLAEV---KDIVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   +    LN+SPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTALVLNSSPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL I+YVNQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRIQTLSELAKQLHLNIVYVNQVGGQDDLIFDGTSFVSNQNGEIALQAPSFKEDI 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           ++ E+  D +L +    +          L+     Y   V++ RDYV+++ F  VI+GLS
Sbjct: 237 YIAEFDRDTKLYKVTESAPA--------LETFAEIYQGLVMATRDYVERSGFPGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +VN
Sbjct: 289 GGIDSALTLAIAVDAIGAEKVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSIVN 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +  F    P+    EN+Q+R RG +LM LSN    ++L T NKSE+SVGY TLYG
Sbjct: 349 SFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLATGNKSELSVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF  LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q DQ
Sbjct: 409 DMVGGFAVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LD I+   +E +    +   + ++ E V  V  L+  +EYKRRQ  +G +IT
Sbjct: 462 DSLPAYDVLDAILYAYIEEDLGQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGPRIT 521

Query: 540 AKSFGRDRLYPISNKF 555
           +++F R+R YPI N +
Sbjct: 522 SRAFSRERRYPIVNGW 537


>gi|85703661|ref|ZP_01034765.1| NAD(+) synthase [Roseovarius sp. 217]
 gi|85672589|gb|EAQ27446.1| NAD(+) synthase [Roseovarius sp. 217]
          Length = 555

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 238/562 (42%), Positives = 334/562 (59%), Gaps = 9/562 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGD+AGN   AR A +E    G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MGDRFRLTLAQLNPTVGDLAGNARMARAAWQEGRAAGADLVALPEMFITGYNTQDLVRKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +  QA  + I+ L  D  + G  + +G P  D  G+ N+  +L  G + A   K +LPN 
Sbjct: 61  ALHQAAIATIEALARDCAE-GPALAIGGPALDGVGLFNAYYVLQGGAVRARVLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R + SG    P     +R+G  ICED W      + L + GAE L   N SP+Y
Sbjct: 120 TVFDEVRLYESGPVAGPYTVAGVRIGSPICEDAWHEDV-AETLAETGAEILLVPNGSPHY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK+  R  ++  ++    LP+IY+N VGGQD+ +FDG SF  +    LA Q+  F E  
Sbjct: 179 RNKMDLRQNMMVARVIETGLPLIYLNMVGGQDDQMFDGGSFVLNPGGALAVQLPMFQEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     ++    W       A        + E DY A VLSLRDY++K+   KV++GLS
Sbjct: 238 -VVHVDLERGPEGWRAAPGVLAHLP----DDLEQDYTAMVLSLRDYLRKSGLSKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ A IAVDA+G +NV+ +MLP ++TSP+SLEDA A A+ LGC+YD +PI     
Sbjct: 293 GGVDSAIVATIAVDAVGAKNVRCVMLPSEFTSPESLEDAKAVAENLGCRYDFVPIDAGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++         +  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITATLAPLFDGIEPDLTEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT++F++  WRN+      +G    VIP  +++K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRLFEICRWRNAQHRDWMMGGAGVVIPARVIDKPPSAELRADQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I+  +V+ + S  +     Y     + VEHLLY SEYKR QA  GT+++
Sbjct: 473 DSLPDYPVLDGILDILVDQDGSISDCVAAGYTLGDAKRVEHLLYISEYKRFQAAPGTRLS 532

Query: 540 AKSFGRDRLYPISNKFRDHISE 561
            ++F  DR YPI N++RD   E
Sbjct: 533 HRAFWLDRRYPIVNRWRDGSGE 554


>gi|110678543|ref|YP_681550.1| NAD synthetase [Roseobacter denitrificans OCh 114]
 gi|109454659|gb|ABG30864.1| glutamine-dependent NAD(+) synthetase [Roseobacter denitrificans
           OCh 114]
          Length = 552

 Score =  498 bits (1283), Expect = e-139,   Method: Composition-based stats.
 Identities = 240/559 (42%), Positives = 328/559 (58%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I + Q+NP VGD+AGN A AR   E     G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MADRFRITLGQMNPTVGDLAGNAALAREVWEAGKTAGADLVALPEMFITGYNAQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F    +  +D L  D  D G  + +G P  +   + N+ +IL  G I++   K +LPN 
Sbjct: 61  AFQLDVARHVDRLAQDCAD-GPTLAIGAPWVEGTRLYNAYLILKGGKIVSQVLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    + R+G  ICED W      + L + GAEFL   N SPYY
Sbjct: 120 TVFDEVRIFDAGPLGGPYSVGNSRVGSPICEDAWHEDV-AETLAETGAEFLLVPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R   +  ++    LP+IY+N VGGQD+ +FDGASF  +    LA Q+  F E  
Sbjct: 179 RGKFDTRLNHMVARVIETELPLIYLNMVGGQDDQVFDGASFGLNPGGNLAVQLPVFDEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     ++    W  +  + A          E DY   V +LRDY +K  F KV++GLS
Sbjct: 238 -VAHVDLERGPQGWRIVEGEKAHHP----DAWEQDYRVMVQALRDYCRKTGFGKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL AAIAVDALG +NV+ +MLP +YTS +SLEDA A AKALGC YD +PI +   
Sbjct: 293 GGVDSALVAAIAVDALGAQNVRCVMLPSEYTSAESLEDAEAVAKALGCHYDYVPITEGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +   + +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AIEQTLAPLFEGRGADLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN        GP  EVI P +++K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFETCRWRNKTHRDWMKGPQGEVITPRVIDKPPSAELRADQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD +++ +V+   S  +      + ET R +EHL+Y SEYKR Q+  G ++T
Sbjct: 473 DSLPDYPELDRLLEILVDRNGSIEDCVAAGSDVETARKIEHLIYISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRDH 558
             +F  DR YPI N++RD 
Sbjct: 533 KGAFWLDRRYPIVNRWRDR 551


>gi|300724142|ref|YP_003713459.1| putative glutamine-dependent NAD(+) synthetase [Xenorhabdus
           nematophila ATCC 19061]
 gi|297630676|emb|CBJ91341.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Xenorhabdus nematophila
           ATCC 19061]
          Length = 540

 Score =  498 bits (1282), Expect = e-138,   Method: Composition-based stats.
 Identities = 232/556 (41%), Positives = 335/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L I +AQLN +VGDI GN  +  +  +E   +  DL++F+EL +SGY PEDL+F+ 
Sbjct: 1   MSRTLNIGLAQLNWLVGDIEGNCERMLQTVKEQQEKEADLVMFSELALSGYFPEDLLFRS 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
              Q C   +  L+  +      I+VG P Q    + N++ +   G ++A   K  LPNY
Sbjct: 61  DLHQRCREQLIRLQEAS--SQVAILVGHPWQQDGKLYNALSLFWQGEVVARYFKQLLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E+R F +G  +  I F+   LG+LICED+W +      LKK GAE + S+NASPY 
Sbjct: 119 GVFDEERYFKAGKQDCVIPFKGYNLGLLICEDLWFDEP-VNALKKAGAEIILSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LPI+Y+NQVGGQD+LIFDG S  FD + ++  +M  F EQ 
Sbjct: 178 REKPNIRSALIKSHCQRTQLPIVYLNQVGGQDQLIFDGCSKVFDAKGEITHRMVAFEEQI 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                    +  +++ M+ +  +     L      Y A VLS+RDYVQKN F   ++GLS
Sbjct: 238 ---------EQCRFDGMNIEPMANPIPQLPSLGQIYKALVLSVRDYVQKNGFKGALLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDALGK++VQ +M+P++YTS  S+ DA   A+ LG ++DV+ I  + +
Sbjct: 289 GGIDSGLTLAIAVDALGKDHVQAVMMPFRYTSEMSIHDAREQAEMLGVEFDVVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + +             EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 349 AFMTQLEPMFAGTEKDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFN LKD+ KT VF L+ +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFNALKDVPKTMVFALSEYRNT---------VSPAIPQRVIDRPPSAELAPDQLDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I++  VE ++S  +   + +++  VR V  L+  +EYKRRQAP+G +IT
Sbjct: 460 DSLPPYDMLDAILEGYVEKDKSVADLIAEGFDEVIVRKVIRLVDINEYKRRQAPIGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
            + FG+DR YPI++ F
Sbjct: 520 QRDFGKDRRYPITSGF 535


>gi|238796754|ref|ZP_04640260.1| NAD+ synthase [Yersinia mollaretii ATCC 43969]
 gi|238719485|gb|EEQ11295.1| NAD+ synthase [Yersinia mollaretii ATCC 43969]
          Length = 540

 Score =  498 bits (1282), Expect = e-138,   Method: Composition-based stats.
 Identities = 235/556 (42%), Positives = 339/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +   E  + G DL++F+EL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNWLVGDIEGNTERMLQTLNEQQKAGADLVMFSELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +D L++ T      ++VG P ++   + N++ +   G ++A   K  LPNY
Sbjct: 61  DFYQRCEAQLDRLQAATQ--HIAVLVGHPWREAGHLYNALSLFSEGKLLARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  +  +D RLG+LICED+W +       K  GAE L S+NASPY 
Sbjct: 119 GVFDEKRYFSAGHESCVVALKDYRLGLLICEDLWFDGP-VDAAKAAGAEVLLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++        LP++Y+NQ+GGQDELIFDG S  FD    L  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAAHCQRTGLPLVYLNQIGGQDELIFDGCSKAFDAAGNLTHRLAAFAEQT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                     L Q N             L      Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 ---------TLLQLNECEVVPMMAPAAELPPLAQVYEALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+ VQ +M+P++YT+  S+ DA   A+ LG ++DVL I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDKVQALMMPFRYTADISIADAKEEAEILGIEFDVLSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPMFANTARDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++ + PSAEL P Q D+
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVITRPPSAELAPDQKDE 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +     +++  VR V  L+  +EYKRRQ+ VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVADLVADGFDETIVRKVIRLVDINEYKRRQSAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|254511880|ref|ZP_05123947.1| glutamine-dependent NAD(+) synthetase [Rhodobacteraceae bacterium
           KLH11]
 gi|221535591|gb|EEE38579.1| glutamine-dependent NAD(+) synthetase [Rhodobacteraceae bacterium
           KLH11]
          Length = 552

 Score =  498 bits (1282), Expect = e-138,   Method: Composition-based stats.
 Identities = 241/559 (43%), Positives = 337/559 (60%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    +I +AQLNP+VGDI GN AKA+ A ++      DL+   E+FI+GY  +DLV K 
Sbjct: 1   MADGFRITLAQLNPIVGDIEGNAAKAKAAWQQGRTAQADLVALPEMFITGYNTQDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F  A   A+  L  D  D G  + +G P  +   + N+ +IL  G I++   K +LPN 
Sbjct: 61  AFHHAAMDAVQALARDCAD-GPALAIGGPWFEDGKLYNAYLILKGGRIVSKALKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R + +G    P    +IR+G  ICED W      + L++ GAEFL   N SPY+
Sbjct: 120 TVFDEVRLYDAGPMGGPYAVGNIRIGSPICEDGWHEDV-AETLEETGAEFLLIPNGSPYF 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K   R   +  +     LP+IY+N VGGQD+ +FDGA+F  +   +LAF+M  F E  
Sbjct: 179 RDKYDIRLNHMVARTVETGLPVIYLNMVGGQDDQVFDGATFGLNPGGELAFRMPVFDEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     ++    W     +            E DY A V SLRDY+ K  F KV++GLS
Sbjct: 238 -VCTIDLERGDDGWRITPAEVVPQP----DTWEQDYRAMVQSLRDYMGKTGFGKVVLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL AAIAVDA+G  NV+ +MLP +YTS  SL+DA A AKALG  YD +PI +   
Sbjct: 293 GGVDSALVAAIAVDAIGAGNVRCVMLPSEYTSQSSLDDAEAVAKALGVHYDFVPISEGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++     +   +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AVTNTLAPLFAGQDEDLTEENIQSRLRGLLLMAISNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVI PS+++K PSAELR  Q D 
Sbjct: 413 DMNGGYNPIKDLYKTRVFETCRWRNANHRDWMMGPAGEVIRPSVIDKPPSAELREDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I+  +V+ + S  +     +++   R VEHL+Y SEYKR Q+  GT++T
Sbjct: 473 DSLPDYPVLDAILDILVDQDGSIADCVAAGFDEVEARRVEHLIYISEYKRFQSAPGTRLT 532

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++F  DR YPI N++RD 
Sbjct: 533 PRAFWLDRRYPIVNRWRDR 551


>gi|83310332|ref|YP_420596.1| NAD synthetase [Magnetospirillum magneticum AMB-1]
 gi|82945173|dbj|BAE50037.1| Glutamine-dependent NAD(+) synthetase [Magnetospirillum magneticum
           AMB-1]
          Length = 551

 Score =  498 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 257/556 (46%), Positives = 346/556 (62%), Gaps = 10/556 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L IA+AQ+NPVVGDIAGN+A  R AR EA   G DL++F EL + GYPPEDLV K 
Sbjct: 1   MSDTLSIALAQINPVVGDIAGNMALIRAARAEAQVLGADLVVFGELTLCGYPPEDLVLKG 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+ AC +A++   +   +GG  ++VG P + ++ + N+ ++LD G + A R K +LPNY
Sbjct: 61  AFLDACEAAVEE-LAAETEGGPALLVGAPWRVKDRLHNAALLLDHGRVAATRLKHHLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F  G +  P+ FR +RLGI+ICED+W      + L + GAE L   N SPY 
Sbjct: 120 GVFDEIRVFQPGPAPGPVSFRGVRLGIMICEDMWYADV-AETLGESGAEILVVPNGSPYE 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K  KR +    ++    LP+IYVNQVGGQDEL+FDGASF  D     A  +  +  Q 
Sbjct: 179 MDKPTKRLDHARARVEETGLPLIYVNQVGGQDELVFDGASFVLDSDGATAASIAPWQSQV 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T W   +    W      +      P+   E  Y A V  LRDYV KN F  V++GLS
Sbjct: 239 ILTRWT--RGSGGWRCDGPKA-----PPVSRLEGVYQALVTGLRDYVGKNRFPGVVLGLS 291

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+CAAIA DALG + V  +M+P  YTS +SLEDAA CA+ LG + D + I   + 
Sbjct: 292 GGIDSAICAAIAADALGPDKVWCVMMPSPYTSEESLEDAAECARLLGVRLDTVNIGPAMG 351

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F ++++     + + I  EN+QSR RG  LM +SN    M+L+T NKSE+S GY TLYG
Sbjct: 352 AFETMLAPLFAGKDADITEENLQSRSRGLTLMGISNKFGPMVLSTGNKSEMSCGYATLYG 411

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GG+  LKD+YKT VF L+SWRN       LGP   V+P  ++ K PSAEL+P Q DQ
Sbjct: 412 DMCGGYAVLKDVYKTTVFALSSWRNGQRPPGCLGPQGRVMPDRVITKPPSAELKPDQKDQ 471

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           ++LPPY  LD +++ ++E+E+S        Y++  VR V  +L  +EYKRRQAP G KIT
Sbjct: 472 DTLPPYDELDAMLEAMIEDEKSVAEIVAAGYDEAVVRRVWRMLDRAEYKRRQAPPGVKIT 531

Query: 540 AKSFGRDRLYPISNKF 555
           ++SFG+DR YPI+N F
Sbjct: 532 SRSFGKDRRYPITNAF 547


>gi|307728981|ref|YP_003906205.1| NAD+ synthetase [Burkholderia sp. CCGE1003]
 gi|307583516|gb|ADN56914.1| NAD+ synthetase [Burkholderia sp. CCGE1003]
          Length = 579

 Score =  498 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 226/585 (38%), Positives = 326/585 (55%), Gaps = 32/585 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  +IA+AQ+N  VGD AGN+AK   A  +A+  G  L++  EL +SGYPPEDL+ + +
Sbjct: 1   MKT-RIALAQINVTVGDFAGNVAKIVAAARDAHNAGAKLLVAPELALSGYPPEDLLLRPA 59

Query: 62  FIQACSSAIDTLKSDTHD-GGAGIVVGFPRQDQEG---------------------VLNS 99
           F  A ++A+  L +      G  ++VG P +D                          N+
Sbjct: 60  FYTASAAALRDLAAQLEPFAGLHVIVGHPLRDSANGANQGHGNANAPIERGVPPVDTFNA 119

Query: 100 VVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNI 159
             +L  G I+    K +LPN   F EKR F S           ++ G++ICED W  S  
Sbjct: 120 ASLLVDGRIVGTYRKQDLPNTEVFDEKRYFASDPQPFVFELDGVKYGVVICEDAWHASAA 179

Query: 160 CKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGA 219
               K  GA+ L   N SP++ NK   R +I+  +I    LP++YVN VG QDEL+FDG 
Sbjct: 180 Q-MAKAAGAQVLLIPNGSPFHLNKEAVRFDILRARIRETGLPMVYVNMVGAQDELVFDGG 238

Query: 220 SFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDS---ASTMYIPLQEEEADY 276
           SF  D   +L  +M  F E     E+     +      ++ S      +   L  E   Y
Sbjct: 239 SFVLDAHGELVAKMPQFEETTAFVEFENGAPVRNQTSTANGSSGADHAIAPELTLEAQVY 298

Query: 277 NACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSL 336
            A V+ +RDYV KN F   +IGLSGG+DSAL  A+A DALG + V+ +M+P +YT+  S 
Sbjct: 299 AALVMGVRDYVNKNGFPGALIGLSGGVDSALVLAVACDALGADRVRAVMMPSRYTADIST 358

Query: 337 EDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSN 396
            DAA  A+ +G +YD + I  + + F + ++Q     P     ENIQ+RIRG +LMALSN
Sbjct: 359 TDAADMARRVGVRYDEIAIAPMFDAFRNSLAQEFAGRPEDATEENIQARIRGTLLMALSN 418

Query: 397 HSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPL 456
              +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN           
Sbjct: 419 KFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCHYRNQASTF----ER 474

Query: 457 TEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETV 515
             VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E + S        Y  E V
Sbjct: 475 QNVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRSLAEIIAAGYAAEDV 534

Query: 516 RYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHIS 560
           + V  L+  +EYKRRQAP+G ++T ++FGRD  YPI++++ + + 
Sbjct: 535 KRVTRLIKINEYKRRQAPIGIRVTHRAFGRDWRYPITSRYTEPVE 579


>gi|119897651|ref|YP_932864.1| NAD synthetase [Azoarcus sp. BH72]
 gi|119670064|emb|CAL93977.1| NAD(+) synthase (glutamine-hydrolyzing) [Azoarcus sp. BH72]
          Length = 538

 Score =  498 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 231/559 (41%), Positives = 327/559 (58%), Gaps = 23/559 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L IA+AQLN  VGD+ GN  +   A   A  +G  L++  EL +SGYPPEDL+ + 
Sbjct: 1   MNTALSIAVAQLNFTVGDLVGNADRIIEAISAARERGAGLLITPELALSGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F + C+  +  +     D    +V+G P +      N+  ++  G +IA   K  LPNY
Sbjct: 61  DFYRGCAREVRRIAGHCRDF--CLVLGHPTERGGVYYNAASVIRDGEVIATYHKHLLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E+R F SG +        +R+G+ IC D+W  S   +  +  GAE L SLNASP++
Sbjct: 119 EVFDEERYFESGVAPCVFEHGGVRIGVNICADVW-ESGPAEVARAAGAEVLVSLNASPFH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K + R+ ++  ++    LP++Y N VGGQDEL+FDGASF  D    +A+Q + F+   
Sbjct: 178 IDKQQLRYAVLRDRVRETRLPVLYCNMVGGQDELVFDGASFALDRDGTVAYQSEAFAACI 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +  +   +                  P   E   Y A V  +RDY+ KN F   IIGLS
Sbjct: 238 DVLRFEQGRWSGGG----------HAAPKGTEADIYAALVCGVRDYLGKNGFPGAIIGLS 287

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  A+AVDALG + V  +M+P  YT+  SL+D+    K LG +YD + I   +N
Sbjct: 288 GGIDSALTLAVAVDALGADRVHAVMMPSPYTAQMSLDDSREMVKRLGVRYDEIAIEPAMN 347

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F  L++       +    EN+QSRIRG ILMALSN + A++LTT NKSE++ GY TLYG
Sbjct: 348 VFADLLAPQFAGLAADTTEENLQSRIRGMILMALSNKTGAIVLTTGNKSEMATGYATLYG 407

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  LKDLYKT V++LA+WRNS         + EVIP +I+++ PSAEL+P Q DQ
Sbjct: 408 DMAGGFAVLKDLYKTTVYRLAAWRNS---------VGEVIPQNIIDRPPSAELKPDQKDQ 458

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD II+  +E++ES      +   +  VR    +L  +EYKRRQAPVG ++T
Sbjct: 459 DSLPPYEVLDAIIQAYMEHDESPREIIARGLPEADVRRTVTMLKRNEYKRRQAPVGIRVT 518

Query: 540 AKSFGRDRLYPISNKFRDH 558
            + FGRD  YPI+++++D 
Sbjct: 519 QRGFGRDWRYPITSRYQDE 537


>gi|260553998|ref|ZP_05826263.1| glutamine-dependent NAD+ synthetase [Acinetobacter sp. RUH2624]
 gi|260404884|gb|EEW98389.1| glutamine-dependent NAD+ synthetase [Acinetobacter sp. RUH2624]
          Length = 541

 Score =  498 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 225/556 (40%), Positives = 321/556 (57%), Gaps = 21/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTQKMIEQANQAKKQDADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQ-DQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L          +V GF  Q +     NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQLSEV---KDIVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   + +  LN+SPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTVLVLNSSPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL I+YVNQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRKQTLSELAKQLHLNIVYVNQVGGQDDLIFDGTSFVSNQNGEIALQAPSFKEDL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           ++ E+  D +L +    +          L+     Y   V++ RDYV+++ F  VI+GLS
Sbjct: 237 YIAEFDRDTKLYKVTESAPA--------LETFAEIYQGLVMATRDYVERSGFPGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +VN
Sbjct: 289 GGIDSALTLAIAVDAIGAERVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSIVN 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSE+SVGY TLYG
Sbjct: 349 SFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSELSVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF  LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q DQ
Sbjct: 409 DMVGGFAVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LD I+   +E +    +   + ++ E V  V  L+  +EYKRRQ  +G +IT
Sbjct: 462 DSLPAYDVLDAILYAYIEEDLGQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGPRIT 521

Query: 540 AKSFGRDRLYPISNKF 555
           +++F R+R YPI N +
Sbjct: 522 SRAFSRERRYPIVNGW 537


>gi|159043154|ref|YP_001531948.1| NAD synthetase [Dinoroseobacter shibae DFL 12]
 gi|157910914|gb|ABV92347.1| glutamine-dependent NAD(+) synthetase [Dinoroseobacter shibae DFL
           12]
          Length = 557

 Score =  498 bits (1281), Expect = e-138,   Method: Composition-based stats.
 Identities = 234/558 (41%), Positives = 327/558 (58%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    ++ + QLNP +G ++ N  KA RA +E    G   +   E+F++GY  +DLV + 
Sbjct: 1   MSDTFRLTLGQLNPTLGALSENAQKALRAWQEGKLAGAQFVALPEMFLTGYQTQDLVMRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F       +  L  D  D G  + +G P      + NS  IL+ G + A   K +LPN 
Sbjct: 61  AFAADAERVLQGLARDCAD-GPALGIGCPLVQGGKLYNSYAILEGGAVKARVLKHHLPNS 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E+R F +G  + P     +R+G  ICED W      + L +  AE LF  N SPY+
Sbjct: 120 DVFDEERLFTAGPVSGPYRIGPLRIGTPICEDAWYPDV-AETLAESAAEILFVPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++  ++    LP+IY+N VGGQD+ +FDGASF  +    LA Q+    E  
Sbjct: 179 RGKHDTRLNLMVARVIETGLPLIYLNMVGGQDDQMFDGASFALNTHGALAMQLPAMEE-- 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +      Q    W                E EADY   V SLRDY++K+ F KV++GLS
Sbjct: 237 VIAHLDLTQTAEGWRIEDARKDPLP----DEWEADYRVMVESLRDYLRKSGFGKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ AAIA DA+G +NV+ +MLP +YTS +SLEDA A A+ LGC+ D LPI     
Sbjct: 293 GGIDSAIVAAIAADAIGPQNVRCVMLPSEYTSQESLEDAEAVARNLGCRIDTLPITGPRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
               +++ F    PSGI  EN+QSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AVTEVLAPFFNGTPSGIAEENVQSRLRGVLLMALSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN       LGP  E+IP  ++EK PSAELR  Q D+
Sbjct: 413 DMAGGYNPIKDLYKTRVFETCRWRNETHRPWMLGPEGELIPDRVIEKPPSAELRADQKDE 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I++ +++ E S        ++ +TV+ +EHL++ SEYKR Q+  G ++T
Sbjct: 473 DSLPPYGVLDAILEGLIDREASVAELVADGFDLDTVKKIEHLIFISEYKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 KRAFWLDRRYPIVNRWRD 550


>gi|313200694|ref|YP_004039352.1| nad+ synthetase [Methylovorus sp. MP688]
 gi|312440010|gb|ADQ84116.1| NAD+ synthetase [Methylovorus sp. MP688]
          Length = 540

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 228/552 (41%), Positives = 325/552 (58%), Gaps = 17/552 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +++AIAQ+N VVGD+AGN A+      EA   G  L+L  EL +SGY P+DL+ ++ F  
Sbjct: 1   MQVAIAQINCVVGDLAGNAARILSYAHEAKAAGASLMLTPELALSGYSPQDLLLREDFTH 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
            C   +  L          +VVG P ++     N+  +L  G I+    K  LPN+S F 
Sbjct: 61  HCQRELQALAKALPA-DITVVVGHPHREHGRCYNAASVLQGGRIVLTYHKHALPNHSVFD 119

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E R F  G        + +R GILIC D+W      K  K+ GAE L  LNASP++  K 
Sbjct: 120 EVRYFSPGNKAGVFEHQGVRCGILICADVW-EPGPAKVSKQAGAELLLVLNASPFHLEKQ 178

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           ++R++++  ++    LP++Y N VGGQDEL+FDG S   D       Q+  F+EQ  +  
Sbjct: 179 QQRYKVLGKRVEETGLPLVYANLVGGQDELVFDGNSVVIDRCGAPVQQLPAFTEQLALVS 238

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
                Q       ++   + +   L  EE+ Y A  L LRDYVQKN F   ++GLSGGID
Sbjct: 239 IDLSPQNR-----ANPLPAEIAPGLTREESAYQALTLCLRDYVQKNGFPGAVLGLSGGID 293

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL  AIAVDALG + V  +M+P ++T+  S++DA   A+ LG KY  LPI  L + F +
Sbjct: 294 SALTLAIAVDALGADKVHAVMMPSEFTADMSVDDARQMAQLLGVKYTELPIKPLFDQFCA 353

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +++        +  EN+Q+RIRG +LMALSN   +++LTT NKSE++VGY TLYGDM+G
Sbjct: 354 TLAEPFTGTSFDLTEENLQARIRGMLLMALSNKFGSIVLTTGNKSEMAVGYSTLYGDMAG 413

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF  LKD+ KT V++LA +RNS         L++VIP  I+ + PSAELR  QTDQ+SLP
Sbjct: 414 GFAVLKDISKTLVYRLARYRNS---------LSQVIPERIIIRPPSAELRHGQTDQDSLP 464

Query: 485 PYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY +LD I++  VE + S        Y ++ V  V +L+  +EYKRRQ+P+G ++T + F
Sbjct: 465 PYDVLDAIMEAYVERDSSRQEIIAMGYREQDVARVLNLIDRNEYKRRQSPIGVRVTERGF 524

Query: 544 GRDRLYPISNKF 555
           G DR YP+ ++F
Sbjct: 525 GLDRRYPVVSRF 536


>gi|226951210|ref|ZP_03821674.1| glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [Acinetobacter sp. ATCC 27244]
 gi|226838040|gb|EEH70423.1| glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [Acinetobacter sp. ATCC 27244]
          Length = 541

 Score =  497 bits (1280), Expect = e-138,   Method: Composition-based stats.
 Identities = 228/556 (41%), Positives = 319/556 (57%), Gaps = 21/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  KIA+AQ +P +G+I  N  K       A +Q  DLI+F EL   GYP EDL+ + +
Sbjct: 1   MKNFKIALAQFSPHIGNIDANTQKMVEQANLAKQQQADLIVFPELSTLGYPAEDLILRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQ-DQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +    A+  L          +V GF  Q +     NS  ++  G ++ + +K NLPNY
Sbjct: 61  LQKRTQKALAQLSEV---KDIVMVFGFVHQTEDGHRYNSAAVMKDGQVLGIYNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICED+W + N  K L +   E +  LNASPY 
Sbjct: 118 GVFDEKRYFQEGHQHLVFEYLGHKFGVLICEDVW-SLNTVKQLSQLNVETVLILNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     ++L I+YVNQVGGQD+LIFDG+SF  +   +LA Q   F E  
Sbjct: 177 VGKPQHRIQTLSELAKQLNLNIVYVNQVGGQDDLIFDGSSFVNNHNGELALQAPSFKEAV 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           + TE+   Q+            +     L      Y A V+S RDYVQ++ F  VI+GLS
Sbjct: 237 YFTEYDVAQK--------QFKKADAIPALDTFAEIYQALVMSTRDYVQRSGFPGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDA+G + VQ +M+PY YTS  S+EDA   A+ +G  + +  IH +VN
Sbjct: 289 GGIDSALTLAIAVDAIGADKVQAVMMPYTYTSQMSVEDATEQARRMGVTFGIAEIHPIVN 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSEISVGY TLYG
Sbjct: 349 SFMQTLFPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSEISVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF+ LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q DQ
Sbjct: 409 DMVGGFSVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LD I+   +E + S  +   + Y  + V  V  L+  +EYKRRQ  +G +I+
Sbjct: 462 DSLPAYDVLDAILYAYIEEDLSQADIIAKGYEADVVEKVIRLVDRNEYKRRQGAIGPRIS 521

Query: 540 AKSFGRDRLYPISNKF 555
           +++F R+R YPI N +
Sbjct: 522 SRAFSRERRYPIVNGW 537


>gi|169796959|ref|YP_001714752.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Acinetobacter baumannii
           AYE]
 gi|184157129|ref|YP_001845468.1| NAD synthase [Acinetobacter baumannii ACICU]
 gi|213156635|ref|YP_002318296.1| glutamine-dependent NAD+ synthetase [Acinetobacter baumannii
           AB0057]
 gi|215484420|ref|YP_002326653.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter
           baumannii AB307-0294]
 gi|239501190|ref|ZP_04660500.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter
           baumannii AB900]
 gi|260555750|ref|ZP_05827970.1| glutamine-dependent NAD+ synthetase [Acinetobacter baumannii ATCC
           19606]
 gi|301347384|ref|ZP_07228125.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter
           baumannii AB056]
 gi|301513386|ref|ZP_07238623.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter
           baumannii AB058]
 gi|301596831|ref|ZP_07241839.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter
           baumannii AB059]
 gi|332854834|ref|ZP_08435584.1| NAD+ synthase [Acinetobacter baumannii 6013150]
 gi|332876339|ref|ZP_08444111.1| NAD+ synthase [Acinetobacter baumannii 6014059]
 gi|169149886|emb|CAM87777.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Acinetobacter baumannii
           AYE]
 gi|183208723|gb|ACC56121.1| NAD synthase [Acinetobacter baumannii ACICU]
 gi|213055795|gb|ACJ40697.1| glutamine-dependent NAD+ synthetase [Acinetobacter baumannii
           AB0057]
 gi|213986356|gb|ACJ56655.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter
           baumannii AB307-0294]
 gi|260410661|gb|EEX03959.1| glutamine-dependent NAD+ synthetase [Acinetobacter baumannii ATCC
           19606]
 gi|322507027|gb|ADX02481.1| NadE [Acinetobacter baumannii 1656-2]
 gi|323516895|gb|ADX91276.1| NAD synthase [Acinetobacter baumannii TCDC-AB0715]
 gi|332727766|gb|EGJ59171.1| NAD+ synthase [Acinetobacter baumannii 6013150]
 gi|332735458|gb|EGJ66513.1| NAD+ synthase [Acinetobacter baumannii 6014059]
          Length = 541

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 225/556 (40%), Positives = 321/556 (57%), Gaps = 21/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTQKMIEQANQAKKQDADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQ-DQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L          +V GF  Q +     NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQLSEV---KDIVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   + +  LN+SPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTVLVLNSSPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL I+YVNQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRKQTLSELAKQLHLNIVYVNQVGGQDDLIFDGTSFVSNQNGEIALQAPSFKEDL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           ++ E+  D +L +    +          L+     Y   V++ RDYV+++ F  VI+GLS
Sbjct: 237 YIAEFDRDTKLYKVVESAPA--------LETFAEIYQGLVMATRDYVERSGFPGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +VN
Sbjct: 289 GGIDSALTLAIAVDAIGAERVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSIVN 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSE+SVGY TLYG
Sbjct: 349 SFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSELSVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF  LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q DQ
Sbjct: 409 DMVGGFAVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LD I+   +E +    +   + ++ E V  V  L+  +EYKRRQ  +G +IT
Sbjct: 462 DSLPAYDVLDAILYAYIEEDLGQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGPRIT 521

Query: 540 AKSFGRDRLYPISNKF 555
           +++F R+R YPI N +
Sbjct: 522 SRAFSRERRYPIVNGW 537


>gi|299771316|ref|YP_003733342.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter sp.
           DR1]
 gi|298701404|gb|ADI91969.1| Probable glutamine-dependent NAD(+) synthetase [Acinetobacter sp.
           DR1]
          Length = 541

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 226/556 (40%), Positives = 318/556 (57%), Gaps = 21/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTKKMIEQVNQAKKQNADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQ-DQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L          +V GF  Q +     NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQLAEV---KDIVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   + +  LNASPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTVLVLNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL I+YVNQVGGQD+LIFDG SF  +    +A Q   F E  
Sbjct: 177 VGKPQHRTQTLSELAKQLHLNIVYVNQVGGQDDLIFDGTSFVSNKDGGIALQAPSFKEDL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           ++ E+    +  +    +          L+     Y   VL+ RDYV+++ F  VI+GLS
Sbjct: 237 YIAEFDPKNKAFKVTESAPA--------LETFAEIYQGLVLATRDYVERSGFPGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +VN
Sbjct: 289 GGIDSALTLAIAVDAIGAEKVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSVVN 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +  F    P+    EN+Q+R RG +LM LSN    ++L T NKSE+SVGY TLYG
Sbjct: 349 SFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLATGNKSELSVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF  LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q DQ
Sbjct: 409 DMVGGFAVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LD I+   +E + S  +   + ++ E V  V  L+  +EYKRRQ  +G +IT
Sbjct: 462 DSLPAYDVLDAILYAYIEEDLSQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGPRIT 521

Query: 540 AKSFGRDRLYPISNKF 555
           +++F R+R YPI N +
Sbjct: 522 SRAFSRERRYPIVNGW 537


>gi|114797585|ref|YP_761267.1| glutamine-dependent NAD(+) synthetase [Hyphomonas neptunium ATCC
           15444]
 gi|114737759|gb|ABI75884.1| glutamine-dependent NAD(+) synthetase [Hyphomonas neptunium ATCC
           15444]
          Length = 555

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 251/560 (44%), Positives = 336/560 (60%), Gaps = 12/560 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L+I  AQLNPVVGDI GN+A AR A  EA  +G  L++ +E F+ GYP EDLV K 
Sbjct: 4   MSNNLRILAAQLNPVVGDIKGNLALAREAYGEARAKGAHLLVLSEHFLLGYPAEDLVLKP 63

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S ++    A+  L  +T D G  I++G P  ++  + NS   L  G I A  DK  LPNY
Sbjct: 64  SAVEQSMDAVRALAQETKD-GPAILIGTPWSEEGRLYNSACFLGGGLIKARYDKRELPNY 122

Query: 121 SEFHEKRTFISGYSND-PIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
             F EKR +  G      +    +R+G+ ICEDIW      +     GAE L   NASP+
Sbjct: 123 GVFDEKRHYTPGEGPPLVVELHGVRVGVAICEDIWLERVP-RATHAAGAELLIVPNASPW 181

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDG-QQQLAFQMKHFSE 238
                 +R      + + + LP ++VNQ+GGQDEL+FDGASF  +G   +    +  F  
Sbjct: 182 RRAIQAERANAF-DRWADLKLPYLFVNQMGGQDELVFDGASFATNGTHGERCGLVGQFET 240

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
              + E+                  +    L+   A+Y A +  L DYV+KN F  V++G
Sbjct: 241 GTALVEFD------PSTKQFSGLGQSCAADLEGWPAEYRAAMQGLGDYVRKNRFPGVVLG 294

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           +SGGIDSA+ AAIA DALG + V  +M+P KYTS  SLEDA ACA+ALGC+YD + IH  
Sbjct: 295 MSGGIDSAITAAIAADALGPDKVWCVMMPSKYTSNDSLEDAKACAQALGCRYDTINIHPG 354

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V    +++      + + I  ENIQSR+R   LMALSN    M++TT NKSE++VGY TL
Sbjct: 355 VEALDTMLGDVFAGKKADITEENIQSRLRAVTLMALSNKFGQMVVTTGNKSEMAVGYATL 414

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM GG+N LKD YKT+VF+L+ WRN+      L P  EVIP  I+ K PSAELR  Q 
Sbjct: 415 YGDMCGGYNALKDFYKTEVFELSKWRNAVHPKDALAPAGEVIPERIITKPPSAELREDQK 474

Query: 479 DQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           D++SLPPY +LDDI++ +V+ EE   +   + ++  TVR +EHL+Y +EYKRRQAP G K
Sbjct: 475 DEDSLPPYEVLDDILRGLVDLEEDVDDILARGHDAATVRRIEHLVYIAEYKRRQAPPGVK 534

Query: 538 ITAKSFGRDRLYPISNKFRD 557
           +  K+FGRDR YPI+N+FRD
Sbjct: 535 VGGKNFGRDRRYPITNRFRD 554


>gi|293394849|ref|ZP_06639139.1| NAD(+) synthase [Serratia odorifera DSM 4582]
 gi|291422600|gb|EFE95839.1| NAD(+) synthase [Serratia odorifera DSM 4582]
          Length = 540

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 235/556 (42%), Positives = 341/556 (61%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +  +E  + G DL++FTEL +SGYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNLLVGDIEGNSERMLQIVQEQQKAGADLVMFTELALSGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C   ++ L+  + +    I+VG P ++ + + N++ +   G + A   K  LPNY
Sbjct: 61  DFYQRCDLQLNRLQQASGE--VAILVGHPWREGDKLYNALSLFADGELRARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G  +  +  +  RLG+LICED+W         K  GAE + S+NASPY 
Sbjct: 119 GVFDEKRYFHAGQESCVVELKGYRLGLLICEDLWFPEP-IDAAKAAGAEIVLSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++ G     +LP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 REKPYIRKTLMAGHCRRTNLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQV 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                     L Q+N       +     L +    Y A VL++RDYV KN F   ++GLS
Sbjct: 238 ---------TLLQFNEREVVPMTAPAAELPQLAQIYEALVLAVRDYVNKNGFKGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGKE VQ +M+P++YT+  S+ DA   A+ LG ++DV+ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKEKVQALMMPFRYTADISIADAKEEAEILGVEFDVVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPMFAGTERDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN+         ++ VIP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRNT---------VSYVIPQRVIDRPPSAELAPDQVDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE + S ++     +++  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVERDMSVVDLVAAGFDEAIVRKVIRLVDINEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|310816658|ref|YP_003964622.1| glutamine-dependent NAD(+) synthetase [Ketogulonicigenium vulgare
           Y25]
 gi|308755393|gb|ADO43322.1| glutamine-dependent NAD(+) synthetase [Ketogulonicigenium vulgare
           Y25]
          Length = 554

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 246/560 (43%), Positives = 343/560 (61%), Gaps = 9/560 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +  ++ +AQLNPVVGDI  N A+ARR   +A   G D I+  E+F+ GY  +DLV + 
Sbjct: 1   MGETFRLTLAQLNPVVGDIEANAARARRVFHDARAAGSDFIVLPEMFLIGYQAQDLVLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F +  ++A+  L  DT DGG  + +G P ++ + + N+  IL  G + A+  K  LPNY
Sbjct: 61  AFQRDAAAALAQLARDT-DGGPALGIGLPWREGDELFNAYAILSGGKVQAMVRKHELPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDI-RLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
             F E+R F +G  + P+ F    R+G+ ICED W      + + + GAE L   N SPY
Sbjct: 120 GVFDERRYFAAGPISGPVAFEGGPRIGLPICEDAWFPDV-AEAMAESGAEILVVPNGSPY 178

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
              K   R + +  +++   LP++Y+N VGGQD+ +FDG SF       LA Q+  F+E 
Sbjct: 179 SRGKYDVRVQRMVSRVTENDLPLVYLNMVGGQDDQVFDGGSFVLGHGGGLAAQLPFFTET 238

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
                 H D    +        ++  ++P  E   DY A   +LRDYV+K+ F +V++GL
Sbjct: 239 VS----HIDFTRCETGGWQPQRSTLAHVP-DEHALDYQAMTTALRDYVRKSGFSRVLLGL 293

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL AAIAVDALG ENV+ +MLP +YTS  SLEDA  CA+ALG K D + I   V
Sbjct: 294 SGGIDSALVAAIAVDALGAENVRGVMLPSRYTSDHSLEDAEVCARALGIKLDTVEIAGPV 353

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
               + ++       + +  ENIQSR+RG +LMA SN    MLLTT NKSE+ VGY T+Y
Sbjct: 354 AAAEAALAPLFAGHDADLTEENIQSRMRGLLLMAQSNKFGEMLLTTGNKSEMCVGYATIY 413

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GG+NP+KDLYKT+VF +A+WRN++      GP  EVIP  I+ K PSAELRP Q D
Sbjct: 414 GDMNGGYNPIKDLYKTRVFAVAAWRNANHFDWMAGPAGEVIPTRIITKPPSAELRPDQKD 473

Query: 480 QESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           ++SLPPYP+LD I+  +V+ + S  +     YN ETV+ VEHL+  SEYKR Q+  G K+
Sbjct: 474 EDSLPPYPVLDAILDLMVDRDASVADCVAAGYNRETVKRVEHLVAISEYKRFQSAPGVKL 533

Query: 539 TAKSFGRDRLYPISNKFRDH 558
           + ++   DR YPI N++RD 
Sbjct: 534 SRRALWLDRRYPIVNRWRDK 553


>gi|114321696|ref|YP_743379.1| NAD+ synthetase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228090|gb|ABI57889.1| DNA-directed RNA polymerase, subunit H [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 541

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 227/557 (40%), Positives = 325/557 (58%), Gaps = 25/557 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANR-QGMDLILFTELFISGYPPEDLVFK 59
           M   L++ +AQL   VGDI GN  +   A E A   +G  L++F EL ++GYPP+DL+ +
Sbjct: 1   MS--LRVTMAQLTCPVGDIEGNTRRIVGAIETARDREGAQLVVFPELAVTGYPPDDLLLR 58

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
             F +A  +A+  +++ +   G   VVG P +D+ G+ N+ V++  G +IA   K  LP 
Sbjct: 59  DDFTRAAENALQAIQAASR--GVTAVVGVPLRDRRGLHNAAVVVQDGRVIARYAKRELPT 116

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           YS F + R F++G S   +     R+G+ ICEDIW  +   +     GAEF+ +LNASP+
Sbjct: 117 YSVFDDSRHFVAGDSPCVVDVAGTRVGLSICEDIWWPTP-AREAVAAGAEFVVNLNASPF 175

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           +  K  +R  ++  +    H P++YVN VGG DE+++DG S   D    +  +   F   
Sbjct: 176 HRRKQAEREAVLRERALDTHRPLLYVNMVGGHDEVVYDGGSLAVDAGGTVQARAPRFRSG 235

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
               E   D           +          EE A Y A V  LRDYVQ+N F  V++GL
Sbjct: 236 LCTVEVDTD---------HGNVNGEQSTQPSEEGAVYQALVTGLRDYVQRNGFPGVVLGL 286

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSA+ AA+AVDALG + VQ +M+P +YT+P SL+DA A A+ LG +Y    I  + 
Sbjct: 287 SGGIDSAVAAAVAVDALGADRVQAVMMPSRYTAPMSLDDAQAIARMLGIRYQTTSIEPIF 346

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F S ++   +     +  EN+QSRIRG +LMALSN +  M+L   NKSE++VGY TLY
Sbjct: 347 QSFLSSLAPSFEGLDPDVTEENLQSRIRGTLLMALSNKTGRMVLACGNKSELAVGYATLY 406

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GG+ PLKD+YKT+V++LA +R S         L    P +I  + P+AEL   Q D
Sbjct: 407 GDMCGGYAPLKDVYKTEVYRLARYRQS---------LKPAFPDNIFSRPPTAELAAGQKD 457

Query: 480 QESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           ++SLPPYP+LDDI++R VE++ES        +   TV  V  LL  +EYKRRQ+  G K+
Sbjct: 458 EDSLPPYPVLDDILERYVEHDESEALIVAAGHEPATVAQVTRLLRRNEYKRRQSAPGPKV 517

Query: 539 TAKSFGRDRLYPISNKF 555
           T ++FGRDR YPIS+ +
Sbjct: 518 TPRAFGRDRRYPISSGW 534


>gi|89055837|ref|YP_511288.1| NAD synthetase [Jannaschia sp. CCS1]
 gi|88865386|gb|ABD56263.1| NH(3)-dependent NAD(+) synthetase [Jannaschia sp. CCS1]
          Length = 552

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 224/558 (40%), Positives = 323/558 (57%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    ++ +AQLNP +GD+ GN    R A  EA  +  D + F E+FI+GY   DLV K+
Sbjct: 1   MADTFRLTLAQLNPTLGDLGGNAKLVREAFAEAKAEDSDFLAFPEMFITGYQLLDLVMKQ 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F +     I  L ++ HD G    +G P    +   N+  I + G I A   K +LPNY
Sbjct: 61  AFAEDVQRVIADLAAELHD-GPAFGIGGPMWGGDKPYNAYYICEGGKIAATILKHHLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R + S     P+    +R+G  ICED W      + L++ GAE L S N SPY+
Sbjct: 120 AVFDEVRYYHSADPQGPVNINGVRIGFPICEDAWFEDVC-ETLEESGAEILISPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K++ R  +V  ++    LP+ Y+N +GGQD+ +FDG SF  +    LA QM  F    
Sbjct: 179 RGKMELRQSVVVSRVVETGLPMAYLNLLGGQDDQVFDGGSFVLNRGGALAVQMPQFEAGL 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              ++      ++ +              +  EADY   V++L DY++K  F  V++GLS
Sbjct: 239 EQVDF------ARGDDGWVAKDGVKARLPEAYEADYRVMVMALGDYLRKTGFTSVVLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A IA DA+G ENV  +MLP ++TS  SL+DA   A  LGC+ D +PI     
Sbjct: 293 GGIDSAIVACIAADAIGPENVHCVMLPSRFTSEVSLDDARDVAARLGCRLDTIPITPARE 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++   +     +  ENIQSR+RG +LMALSN   +MLLTT NKSE++VGY T+YG
Sbjct: 353 AVTASLAPLFEGLEEDVTEENIQSRLRGVMLMALSNKFGSMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN       L P  E+IPP +++K P+AELR  Q D+
Sbjct: 413 DMAGGYNPIKDLYKTRVFETCRWRNREHRDWMLAPAGEIIPPRVIDKPPTAELREDQKDE 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY  LD +++ +++ + S        Y+ E VR +E L+Y SEYKR QA  G ++T
Sbjct: 473 DSLPPYAELDVMLEMLIDKDLSVAEVVAAGYDPEWVRKIERLIYLSEYKRFQAAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            K+F  DR YP++N++RD
Sbjct: 533 QKAFWLDRRYPVANRWRD 550


>gi|284044933|ref|YP_003395273.1| NAD+ synthetase [Conexibacter woesei DSM 14684]
 gi|283949154|gb|ADB51898.1| NAD+ synthetase [Conexibacter woesei DSM 14684]
          Length = 587

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 214/589 (36%), Positives = 322/589 (54%), Gaps = 39/589 (6%)

Query: 1   MLKK---LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           M      L++A+ Q+N  VGDIAGN  K       A  Q  +L+LF EL ++GYPPEDL+
Sbjct: 4   MSTPPGPLRLALCQMNATVGDIAGNERKISDGIAAARGQQAELVLFPELALTGYPPEDLL 63

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
            K+ F+Q    A+D L ++T   G   +VGFP +D + V N++ +L  G +  +  K  L
Sbjct: 64  LKEHFLQDTRRALDRLAAET--HGIVALVGFPERDDD-VYNALAVLADGAVQGIYRKNYL 120

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           PNY  F E+R F +G     I   ++++G+ ICEDIW+           GA  + +L+AS
Sbjct: 121 PNYGVFDEQRYFATGDGGALIEVGEVKIGLTICEDIWEPGAPASDEAYAGASVIVNLSAS 180

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY+  K  +R  ++  +       + +   VGGQDEL+FDG S   D + ++  +   F+
Sbjct: 181 PYHAGKAVERERMLIQRARDSMCVVAFCGLVGGQDELVFDGHSLVVDHRGEVIARAGQFT 240

Query: 238 EQNFMTEWH------YDQQLSQWNYMSDDSASTMYI--------PLQEE----------- 272
           E+  +          Y  + ++      D+     I        P  +E           
Sbjct: 241 EELLVATVDPLAPRTYRLRDARHRAAGRDARPVPTIARLELPETPADDEHPLTRGPIAPL 300

Query: 273 ----EADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPY 328
                  Y A V  LRDYV+KN F +V++GLSGG+DSAL A +AVDALG + V   ++P 
Sbjct: 301 LEPTAEVYTALVCGLRDYVRKNGFDRVVLGLSGGVDSALVACVAVDALGPDGVAVAVMPS 360

Query: 329 KYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRG 388
            Y+S ++  DA   A  LG +     I   +  + S ++         +  EN+Q+RIRG
Sbjct: 361 PYSSQETQADARQLADNLGVERYEFNIQPAMRAYASTLADTFAGRKPDLTEENLQARIRG 420

Query: 389 NILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG 448
           N+LMALSN    ++L T NKSE+SVGY TLYGD++GGF  +KD  K +V++L  +R++  
Sbjct: 421 NLLMALSNKFGWLVLATGNKSEMSVGYSTLYGDLAGGFAVIKDCPKLRVYELTRYRDALA 480

Query: 449 ITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-ND 507
             +      E++P  I+++ PSAELRP Q D++SLPPY +LD I+   VE +        
Sbjct: 481 RETT---GRELVPAMIIDRPPSAELRPDQKDEDSLPPYAVLDPILDGYVEQDLGRDQLIL 537

Query: 508 QEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           + + ++ V  V  L+  +EYKRRQAP G KIT+++FGRDR  PI+NK+R
Sbjct: 538 RGFREQDVDKVIALVDRAEYKRRQAPPGIKITSRAFGRDRRVPITNKYR 586


>gi|239815343|ref|YP_002944253.1| NAD+ synthetase [Variovorax paradoxus S110]
 gi|239801920|gb|ACS18987.1| NAD+ synthetase [Variovorax paradoxus S110]
          Length = 564

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 235/564 (41%), Positives = 318/564 (56%), Gaps = 18/564 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            LK+AIAQLN VVGD+AGN  K   A  +A+ QG  L+L  EL I+GY  EDL  + +F 
Sbjct: 2   TLKLAIAQLNFVVGDLAGNARKIVDAARQAHAQGARLLLTPELSIAGYAAEDLFLRPAFT 61

Query: 64  QACSSAIDTLKSDTHDG-GAGIVVGFP----RQDQEG----VLNSVVILDAGNIIAVRDK 114
           +AC  A+  + +   D     +VVG P     + +        N+  ++  G I+    K
Sbjct: 62  EACDDAVKGIAAALADLKDMVVVVGHPTGGSLRSRSVAVQMRYNAASVIKEGRILETYAK 121

Query: 115 INLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSL 174
             LPNY  F E+R F  G          + +G+LICED W +    +  +  GAE L  +
Sbjct: 122 RELPNYQVFDERRYFTPGQGTCVFEAGGVSVGVLICEDAWFDEP-AELARAAGAEVLAVI 180

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           NASPY+  K  +R   +  +   V LP++Y + VGGQDE++FDGASF       LA Q +
Sbjct: 181 NASPYHVGKEGERVARMADRARAVGLPLVYAHLVGGQDEVVFDGASFALQADGALAMQAE 240

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHK 294
            F E           + S        + S +  P + E   ++A VL +RDY+ KN F  
Sbjct: 241 SFKESLVF----MQMERSPQGVEVVAAPSAIAAPREAEAQLWDALVLGVRDYIGKNGFPG 296

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
            I+GLSGGIDSAL  AIAVDALGK+ V+ +M+P  YT+  S  DA   A  LG +YD + 
Sbjct: 297 AILGLSGGIDSALVLAIAVDALGKDKVRAVMMPSPYTADISWIDAREMATRLGVRYDEIS 356

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I      F   ++   +  P     ENIQ+RIRG +LMALSN   +++LTT NKSE++ G
Sbjct: 357 IKHTFESFKGALADEFKGLPEDTAEENIQARIRGTLLMALSNKFGSIVLTTGNKSEMATG 416

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
           Y TLYGDM+GGF  +KDL KT VF LA WRN+H      G     IP  I+ + PSAELR
Sbjct: 417 YCTLYGDMAGGFAVIKDLLKTTVFALARWRNAHDPY---GTGASPIPDRIITRPPSAELR 473

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAP 533
           P QTDQ+SLPPY ILD I+ R ++++E         Y    V  V  L+  +EYKRRQAP
Sbjct: 474 PDQTDQDSLPPYDILDGILARYMQDDEGIDEIIAAGYERAVVERVARLIKINEYKRRQAP 533

Query: 534 VGTKITAKSFGRDRLYPISNKFRD 557
           VG ++T +SFG+D  YPI++KF +
Sbjct: 534 VGIRVTHRSFGKDWRYPITSKFNE 557


>gi|169634065|ref|YP_001707801.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Acinetobacter baumannii
           SDF]
 gi|169152857|emb|CAP01886.1| putative glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Acinetobacter
           baumannii]
          Length = 541

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 224/556 (40%), Positives = 320/556 (57%), Gaps = 21/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTQKMIEQANQAKKQDADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQ-DQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L          +V GF  Q +     NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQLSEV---KDIVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   + +  LN+SPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTVLVLNSSPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL  +YVNQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRKQTLSELAKQLHLNTVYVNQVGGQDDLIFDGTSFVSNQNGEIALQAPSFKEDL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           ++ E+  D +L +    +          L+     Y   V++ RDYV+++ F  VI+GLS
Sbjct: 237 YIAEFDRDTKLYKVVESAPA--------LETFAEIYQGLVMATRDYVERSGFPGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +VN
Sbjct: 289 GGIDSALTLAIAVDAIGAERVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSIVN 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSE+SVGY TLYG
Sbjct: 349 SFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSELSVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF  LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q DQ
Sbjct: 409 DMVGGFAVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LD I+   +E +    +   + ++ E V  V  L+  +EYKRRQ  +G +IT
Sbjct: 462 DSLPAYDVLDAILYAYIEEDLGQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGPRIT 521

Query: 540 AKSFGRDRLYPISNKF 555
           +++F R+R YPI N +
Sbjct: 522 SRAFSRERRYPIVNGW 537


>gi|326316969|ref|YP_004234641.1| NAD+ synthetase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323373805|gb|ADX46074.1| NAD+ synthetase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 550

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 223/556 (40%), Positives = 311/556 (55%), Gaps = 17/556 (3%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           I+IAQ N +VGD+ GN  K   A  EA+ QG  L+L  EL + GY  EDL  + +F+ AC
Sbjct: 5   ISIAQFNFIVGDVEGNARKIISAAHEAHAQGAALLLTPELALCGYAAEDLFLRPAFLDAC 64

Query: 67  SSAIDTLKSDT-HDGGAGIVVGFPRQD----QEGVLNSVVILDAGNIIAVRDKINLPNYS 121
             A+  +   T   G   +VVG P +      E   N+  +L  G I     K  LPNY+
Sbjct: 65  DRALQDIAQATSACGDLAVVVGHPWRSVAGGAERCHNAASVLRGGRIEQTYAKQELPNYA 124

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E+R F  G        + +R+G+LICED W      +  +         LNASP++ 
Sbjct: 125 VFDEQRYFDPGTQPCVFDVQGVRVGLLICEDAWFPGPAARAAQAGAQLLAT-LNASPFHL 183

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K  +R +I+  +++   LP++Y + VGGQDE++F+G SF  D    +  +   F+E   
Sbjct: 184 GKSAEREQIMRERVAETGLPLVYAHLVGGQDEVVFEGRSFALDANGFVGVRAPGFTEALV 243

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
               H    + ++            IP   E   ++A VL +RDYV KN F  V++GLSG
Sbjct: 244 RVVAHAGDGVLRFE------PDVAPIPA-PEADLWSALVLGVRDYVGKNGFPGVLLGLSG 296

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSAL  AIAVDALG + V+ +M+P  YT+  S  DA   A+ LG +YD + I      
Sbjct: 297 GIDSALVLAIAVDALGADKVRAVMMPSPYTADISWIDARDMAERLGVRYDEIAIAPQFEA 356

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F + ++            EN+Q+RIRG +LMALSN   +++LTT NKSE++ GY TLYGD
Sbjct: 357 FKAALASEFAGRAEDATEENLQARIRGTLLMALSNKFGSVVLTTGNKSEMATGYCTLYGD 416

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGF  +KD+ KT V+ LA WRN+H      G     IP  I+ + PSAELRP Q DQ+
Sbjct: 417 MAGGFAVIKDVAKTAVYGLARWRNAHDP---FGTGASPIPERIITRPPSAELRPDQKDQD 473

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPY +LD I+ R +EN+E   +     Y    V  V  L+  +EYKRRQAPVG ++T 
Sbjct: 474 SLPPYDVLDAIVGRYMENDEPIESIIAAGYARADVERVTRLIQVNEYKRRQAPVGIRVTR 533

Query: 541 KSFGRDRLYPISNKFR 556
           +SFG+D  YPI+N+FR
Sbjct: 534 RSFGKDWRYPITNRFR 549


>gi|303246918|ref|ZP_07333194.1| NAD+ synthetase [Desulfovibrio fructosovorans JJ]
 gi|302491625|gb|EFL51508.1| NAD+ synthetase [Desulfovibrio fructosovorans JJ]
          Length = 580

 Score =  496 bits (1277), Expect = e-138,   Method: Composition-based stats.
 Identities = 210/583 (36%), Positives = 303/583 (51%), Gaps = 39/583 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +   ++A+ Q+NP VGD+ GN+AK     ++A R G DL++F E+ + GYPPEDL+ K  
Sbjct: 1   MAAFRLALCQINPTVGDVGGNVAKVLAGLDQARRIGADLVVFPEMVVPGYPPEDLLLKSD 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC +    +       G   V G P  + + ++N+ ++   G I  +  K  LPNY 
Sbjct: 61  FVDACMAGARRIAGQAR--GLTAVFGCPWFEDD-LVNAAIVAHDGEIAGITAKRYLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNS-NICKHLKKQGAEFLFSLNASPYY 180
            F E R F +G  +          G+ +CEDIW       +     GA  L +++ASPY+
Sbjct: 118 VFDENRYFATGRGSAVYDRDGFVFGVSVCEDIWYPGGPPAEQAHGGGARLLVNISASPYH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  +++ + S     + Y N VGGQDEL+FDG S  F     L  + K F+E  
Sbjct: 178 RGKGAGRERMLSTRASDNSAYVAYANMVGGQDELVFDGHSVVFGPDGGLVARGKQFAEDM 237

Query: 241 FMTEWH---------YDQQLSQWNYMSDDSASTMYIP------------------LQEEE 273
            + +            D +  +W    +     + +P                  L +  
Sbjct: 238 VVCDLDPGQPRRQRLLDPRCRKWEPELEHRPRRISLPHVADAVRAPLDAPAMPPLLDDVA 297

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             Y A VL   DYV+K+ F  V IGLSGGIDS+L A IA DALG ENV  + +P +Y+S 
Sbjct: 298 EVYEALVLCTGDYVRKSGFGGVCIGLSGGIDSSLTAVIAADALGPENVFGVAMPTRYSSD 357

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMA 393
            SLEDA   A+ LG  + V+ I ++   F   +S    + P  +  EN+Q RIRG +LMA
Sbjct: 358 DSLEDAKELAEKLGITFHVVAIEEIFKAFLGTLSPLFGDRPFDVTEENLQPRIRGTLLMA 417

Query: 394 LSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGL 453
           LSN    ++LTT NKSE+ VGY TLYGD +GGF+ +KD+ KT V+ L+ WRN    T   
Sbjct: 418 LSNKFGRLVLTTGNKSEVGVGYSTLYGDTAGGFSVIKDVPKTLVYALSRWRNERAGT--- 474

Query: 454 GPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYND 512
               +++P  +L K P+AELRP Q D +SLP Y  LD ++   VE             + 
Sbjct: 475 ----DLVPARVLVKPPTAELRPDQKDSDSLPEYDALDPVLAAYVERGLCPAAMKAAGMDA 530

Query: 513 ETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
             V  V  L+  +EYKRRQ+P G KIT ++FG+D   PI N++
Sbjct: 531 AVVDRVTRLVDRNEYKRRQSPPGPKITPRAFGKDWRLPIVNRY 573


>gi|237748647|ref|ZP_04579127.1| NAD+ synthase [Oxalobacter formigenes OXCC13]
 gi|229380009|gb|EEO30100.1| NAD+ synthase [Oxalobacter formigenes OXCC13]
          Length = 537

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 226/559 (40%), Positives = 317/559 (56%), Gaps = 24/559 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    K+AIAQ+N  VGD++GN  +      +A   G D++L  EL ++GYPPEDL+ + 
Sbjct: 1   MSP--KVAIAQINSTVGDLSGNRERIAEFVRKAAALGADIVLTPELSLTGYPPEDLLLQH 58

Query: 61  SFIQACSSAIDTLKSDTHDG-GAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
           SF  +    +D LK++  D     ++VG          N+  IL  G II    K  LPN
Sbjct: 59  SFHSSTQLELDRLKNELADLDNVFVLVGHHLIKGGLCYNACSILVNGTIIGTYFKQELPN 118

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           Y+ F EKR F  G        + +  GI ICED+W      K     GA+ +  +N+SPY
Sbjct: 119 YTVFDEKRYFAPGNEPLVFKVKGVCFGIGICEDVWFPLPPQKARAA-GADVMLVMNSSPY 177

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           +  K+ +R  IV   +    +  IY N VGGQDEL+FDG SF  +   ++  Q+K   E 
Sbjct: 178 HMGKMHQRPVIVRQNVIGQGMSAIYANLVGGQDELVFDGCSFAMNTDGKVCVQLKQCEED 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
             +  +   Q ++                   E   Y A VL +RDYV KN F  VIIGL
Sbjct: 238 LEIVSFDNKQPVNGRMEEHPTV----------ESEVYRALVLGVRDYVTKNGFPGVIIGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGG+DSAL  AIAVDALG E V+ +M+P  YTS  S  DA+  A  L   YD +PI D  
Sbjct: 288 SGGVDSALVLAIAVDALGPEKVRAVMMPSPYTSDISQIDASDMAGRLKVAYDEIPISDCF 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           + F S ++    + P     EN+Q+RIRG +LMALSN   +++LTT NKSE++VGY TLY
Sbjct: 348 SSFLSTLAPQFNKLPEDSTEENLQARIRGTLLMALSNKFGSIVLTTGNKSEMAVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGF  +KD+YKT V++L  +RNS         +++VIP  +L ++P+AEL+P+Q D
Sbjct: 408 GDMAGGFAVIKDIYKTLVYRLCHYRNS---------ISDVIPERMLTRAPTAELKPNQFD 458

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q++LPPY +LD I++  +E   S     +  YN   V  +  L+  +EYKRRQAP+G +I
Sbjct: 459 QDTLPPYEVLDTIVRMFMEENRSVGEIVKNGYNTTVVERIVRLMRINEYKRRQAPIGIRI 518

Query: 539 TAKSFGRDRLYPISNKFRD 557
           T + FGRD   PI++K+RD
Sbjct: 519 TPRGFGRDWRCPITSKYRD 537


>gi|39935055|ref|NP_947331.1| NAD synthetase [Rhodopseudomonas palustris CGA009]
 gi|39648906|emb|CAE27427.1| NH3-dependent NAD synthetase [Rhodopseudomonas palustris CGA009]
          Length = 584

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 278/568 (48%), Positives = 374/568 (65%), Gaps = 15/568 (2%)

Query: 1   MLK--KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVF 58
           M +  +L I++AQLNP VGDIAGN  KAR AR  A   G DL+++ ELFI+GYPPEDLV 
Sbjct: 1   MTEAARLTISLAQLNPTVGDIAGNADKARAARRRAAADGADLVVYPELFIAGYPPEDLVL 60

Query: 59  KKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLP 118
           K +F  AC +AI+ L  +T DGG  +++G P  D   + N+  +LD G I A+R K+NLP
Sbjct: 61  KPAFQAACRAAIEDLARETADGGPAMLIGSPWVDNGKLYNACALLDGGRIAAIRHKVNLP 120

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIW-----KNSNICKHLKKQGAEFLFS 173
           NY  F EKR F  G  + P+  R +R+G+ ICED W        N+ + L + GAE L  
Sbjct: 121 NYGVFDEKRVFARGPVSGPVTIRGVRIGVPICEDTWLEESEDYENVVECLAETGAELLVV 180

Query: 174 LNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQM 233
            N SPY   K   R  +   +++   LP++YVNQVGGQDEL+FDGASF  +  + LA Q+
Sbjct: 181 PNGSPYARGKNDMRMSVSVARVTESDLPLVYVNQVGGQDELVFDGASFVLNADRTLAAQL 240

Query: 234 KHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFH 293
             F E   +T   + +  + W          +   ++ +EADY ACVL LRDYV+KN F 
Sbjct: 241 PGFVES--VTTLSFVKGAAGWRC-----DGPVAPVIEGDEADYAACVLGLRDYVRKNGFP 293

Query: 294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVL 353
            V++G+SGGIDSALCAAIAVDALG + V+ +MLP++YT+  SL+DA   A ALG  Y+VL
Sbjct: 294 GVLLGISGGIDSALCAAIAVDALGADKVRGVMLPFRYTAQISLDDAGRLASALGFGYEVL 353

Query: 354 PIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISV 413
           PI   V  F +++++        I  EN+Q+R RG +LMA+SN + AM++TT NKSE+SV
Sbjct: 354 PIAQAVEGFEAILAKPFAGLERDITEENLQARTRGTLLMAISNKTGAMVVTTGNKSEMSV 413

Query: 414 GYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAEL 473
           GY TLYGDM+GGFNP+KD+YKTQVF+L+S RN       LGP  EVIP SI+ + P+AEL
Sbjct: 414 GYATLYGDMNGGFNPIKDIYKTQVFRLSSLRNRWKPDDALGPDGEVIPESIIIRPPTAEL 473

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQA 532
           R +QTDQ+SLPPY +LD I++R+VE EE   +     ++ +TV  ++ LL  +EYKRRQA
Sbjct: 474 RENQTDQDSLPPYDVLDAILERLVEREEPLASIVADGFDKDTVVRIDRLLNIAEYKRRQA 533

Query: 533 PVGTKITAKSFGRDRLYPISNKFRDHIS 560
             G K+T K+FGRDR YPI+N+FRD   
Sbjct: 534 APGVKVTRKNFGRDRRYPITNRFRDKAE 561


>gi|120611780|ref|YP_971458.1| NAD+ synthetase [Acidovorax citrulli AAC00-1]
 gi|120590244|gb|ABM33684.1| NAD+ synthetase [Acidovorax citrulli AAC00-1]
          Length = 550

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 220/556 (39%), Positives = 311/556 (55%), Gaps = 17/556 (3%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           I+IAQ N +VGD+ GN  K   A  EA+ QG  L+L  EL + GY  EDL  + +F+ AC
Sbjct: 5   ISIAQFNFIVGDVEGNARKIISAAHEAHAQGAALLLTPELALCGYAAEDLFLRPAFLDAC 64

Query: 67  SSAIDTLKSDTHD-GGAGIVVGFPRQD----QEGVLNSVVILDAGNIIAVRDKINLPNYS 121
             A+  +   T   G   +VVG P +      E   N+  +L  G +     K  LPNY+
Sbjct: 65  DRALQDIAQATAACGDLAVVVGHPWRSVAGGAERCHNAASVLRGGRVEQTYAKQELPNYA 124

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F E+R F  G        + +R+G+LICED W      +  +         LNASP++ 
Sbjct: 125 VFDEQRYFDPGTQPCVFDVQGVRVGLLICEDAWFPGPAARAAQAGAQLLAT-LNASPFHL 183

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K  +R +I+  +++   LP++Y + VGGQDE++F+G SF  D    +  +   F+E   
Sbjct: 184 GKSAEREQIMRERVAETGLPLVYAHLVGGQDEVVFEGRSFALDATGFVGVRAPGFAEALV 243

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
                 +  + ++            IP   E   ++A VL +RDYV KN F  V++GLSG
Sbjct: 244 RVVARAEDGVLRFE------PDVAPIPA-PEADLWSALVLGVRDYVGKNGFPGVLLGLSG 296

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSAL  AIAVDALG + V+ +M+P  YT+  S  DA   A+ LG +YD + I      
Sbjct: 297 GIDSALVLAIAVDALGPDKVRAVMMPSPYTADISWIDARDMAERLGVRYDEIAIAPQFEA 356

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F + ++            EN+Q+RIRG +LMALSN   +++LTT NKSE++ GY TLYGD
Sbjct: 357 FKAALASEFAGRAEDATEENLQARIRGTLLMALSNKFGSVVLTTGNKSEMATGYCTLYGD 416

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGF  +KD+ KT V+ LA WRN+H      G     IP  I+ + PSAELRP Q DQ+
Sbjct: 417 MAGGFAVIKDVAKTTVYGLARWRNAHDP---FGTGASPIPERIITRPPSAELRPDQKDQD 473

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPY +LD I+ R +EN+E   +     Y    V  V  L+  +EYKRRQ+PVG ++T 
Sbjct: 474 SLPPYDVLDAIVGRYMENDEPIESIIAAGYARADVERVTRLIQVNEYKRRQSPVGIRVTR 533

Query: 541 KSFGRDRLYPISNKFR 556
           +SFG+D  YPI+N+FR
Sbjct: 534 RSFGKDWRYPITNRFR 549


>gi|149201961|ref|ZP_01878935.1| NAD synthetase [Roseovarius sp. TM1035]
 gi|149145009|gb|EDM33038.1| NAD synthetase [Roseovarius sp. TM1035]
          Length = 555

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 243/558 (43%), Positives = 339/558 (60%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGD+AGN   AR A ++    G DL+   E+FI+GY  +DLV K 
Sbjct: 1   MADRFRLTLAQLNPTVGDLAGNARLARDAWDKGRAAGADLVALPEMFITGYNTQDLVQKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F QA  +AI+ L  D  D G  + +G P  D   + N+  IL  G++ A   K +LPN 
Sbjct: 61  AFHQAAIAAIEALARDCAD-GPALAIGGPALDGVSLHNAYYILQGGSVRARVLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R + SG    P     +R+G  ICED W      + L + GAE L   N SP+Y
Sbjct: 120 TVFDEVRLYDSGPVAGPYTVAGVRIGSPICEDAWHEDV-AETLAETGAEILLVPNGSPHY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K+  R  ++  ++    LP+IY+N VGGQD+ +FDG SF  +    LA Q+  F E  
Sbjct: 179 RDKMDLRQNMMVARVIETGLPLIYLNMVGGQDDQMFDGGSFVLNPGGALAVQLPMFQEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     ++    W  +  D A        + E DY A VLSLRDY++K+ F KV++GLS
Sbjct: 238 -VAHVDLERGPEGWRALPGDLAHLP----DDMEQDYTAMVLSLRDYLRKSGFSKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ A IAVDA+G ENV+ +MLP +YTS +SLEDA A A+ LGC+YD +PI     
Sbjct: 293 GGVDSAIVATIAVDAVGAENVRCVMLPSEYTSAESLEDAKAVAENLGCRYDFVPIDAGRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++         +  EN+QSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITATLAPLFDGRAPDLTEENLQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF++  WRN+      LGP   VIP  ++ K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFEICRWRNAQYRGWMLGPKGAVIPEQVISKPPSAELRADQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I++ +V+ + S  +     Y+    + VEHLLY SEYKR QA  GT+++
Sbjct: 473 DSLPDYPVLDGILEILVDQDGSISDCVAAGYDLADAKRVEHLLYISEYKRFQAAPGTRLS 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 KRAFWLDRRYPIVNRWRD 550


>gi|126724772|ref|ZP_01740615.1| NAD synthetase [Rhodobacterales bacterium HTCC2150]
 gi|126705936|gb|EBA05026.1| NAD synthetase [Rhodobacterales bacterium HTCC2150]
          Length = 552

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 234/559 (41%), Positives = 320/559 (57%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +K +I +AQLNP +GD+  N  KAR A         D +   E+F++GY  +DL  + 
Sbjct: 1   MAEKFRITLAQLNPTLGDLTQNATKAREAWAAGKAANADFVALPEMFLTGYQLQDLAMRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+   +  +  L +D  D G  + +G P        N  +IL  G I     K +LP  
Sbjct: 61  AFLADVADVLKGLAADVAD-GPALGIGAPMIVDGKRHNCYLILQNGEIATQVLKHHLPID 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F SG  + P     +R+G  ICED W +    +   + GAE LF  N SPY 
Sbjct: 120 DVFDEARIFASGDVSGPYRIGPLRIGSPICEDAWFDDVT-ETHAESGAEILFVPNGSPYM 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++  ++    LP+IY+N VGGQD+ +FDGASF  +    LA QMK   E  
Sbjct: 179 RAKQDHRIALMVARVVETGLPLIYLNLVGGQDDQVFDGASFALNRGGALAAQMKTLDED- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     +     W                E E DYN  V +LRDY+ K  F KV++G+S
Sbjct: 238 -ICHLDLELGDEGWTIKQGPLEPRP----DEYEQDYNVMVTALRDYMGKTGFKKVLLGMS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL A IAVDALG ENV+ +MLP +YTS  SLEDA   A+ALG + D LPI     
Sbjct: 293 GGIDSALVATIAVDALGPENVRCVMLPSEYTSSHSLEDAEKAARALGVRMDTLPIAGPRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +     +  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AVTEALAPLFEGTKPDLTEENIQSRLRGLMLMALSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYK +VFQ   WRN +     LGP  EVIP  I++K PSAELR  Q D+
Sbjct: 413 DMAGGYNPIKDLYKMRVFQTCRWRNENHRDWMLGPQAEVIPQRIIDKPPSAELRDDQKDE 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I++ +V+ + S  +     ++ ETV+ +EHL+Y SE+KR Q+  G ++T
Sbjct: 473 DSLPPYEVLDAILEMLVDQDFSVADVVAAGFDRETVKRIEHLIYISEHKRFQSAPGARLT 532

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++F  DR YPI N++RD+
Sbjct: 533 GRAFWLDRRYPIVNRWRDN 551


>gi|294649596|ref|ZP_06727014.1| glutamine-dependent NAD(+) synthetase [Acinetobacter haemolyticus
           ATCC 19194]
 gi|292824505|gb|EFF83290.1| glutamine-dependent NAD(+) synthetase [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 541

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 228/556 (41%), Positives = 318/556 (57%), Gaps = 21/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  KIA+AQ +P +G+I  N  K       A +Q  DLI+F EL   GYP EDL+ + +
Sbjct: 1   MKNFKIALAQFSPHIGNIDANTQKMVEQANLAKQQQADLIVFPELSTLGYPAEDLILRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQ-DQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L          +V GF  Q +     NS  ++  G ++ + +K NLPNY
Sbjct: 61  LQKRTQKAFAQLSEV---KDIVMVFGFVHQTEDGHRYNSAAVMKDGQVLGIYNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICED+W + N  K L +   E +  LNASPY 
Sbjct: 118 GVFDEKRYFQEGHQHLVFEYLGHKFGVLICEDVW-SLNTVKQLSQLNVETMLILNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     ++L I+YVNQVGGQD+LIFDG+SF  +   +LA Q   F E  
Sbjct: 177 VGKPQHRIQTLSELAKQLNLNIVYVNQVGGQDDLIFDGSSFVNNHNGELALQAPSFKEAV 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           + TE+   Q+            +     L      Y A V+S RDYVQ++ F  VI+GLS
Sbjct: 237 YFTEYDVTQK--------QFKKADAIPALDTFAEIYQALVMSTRDYVQRSGFPGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDA+G + VQ +M+PY YTS  S++DA   A+ +G  + +  IH +VN
Sbjct: 289 GGIDSALTLAIAVDAIGADKVQAVMMPYTYTSQMSVKDATEQARRMGVTFGIAEIHPIVN 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSEISVGY TLYG
Sbjct: 349 SFMQTLFPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSEISVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF+ LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q DQ
Sbjct: 409 DMVGGFSVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LD I+   +E + S  +   + Y  E V  V  L+  +EYKRRQ  +G +I+
Sbjct: 462 DSLPAYDVLDAILYAYIEEDLSQADIIAKGYEAEVVEKVIRLVDRNEYKRRQGAIGPRIS 521

Query: 540 AKSFGRDRLYPISNKF 555
           +++F R+R YPI N +
Sbjct: 522 SRAFNRERRYPIVNGW 537


>gi|307293500|ref|ZP_07573344.1| NAD+ synthetase [Sphingobium chlorophenolicum L-1]
 gi|306879651|gb|EFN10868.1| NAD+ synthetase [Sphingobium chlorophenolicum L-1]
          Length = 553

 Score =  496 bits (1276), Expect = e-138,   Method: Composition-based stats.
 Identities = 250/560 (44%), Positives = 337/560 (60%), Gaps = 13/560 (2%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  KL IA+AQ+   VGD+  N       R  A     DLI++ EL + GYPPEDLV K 
Sbjct: 1   MTDKLVIALAQMTQSVGDLTANADAMLEWRGRAMD--ADLIVYPELQLIGYPPEDLVLKP 58

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           + +   +  +D L   T DGG  ++VG     Q  + N V +L+ G + A+R K  LPNY
Sbjct: 59  ALVDRANHELDRLAQATADGGPAMLVGTVVASQGVLFNVVALLEGGAVTAIRQKRELPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G    PI FR +++G+ ICEDIW       HL+ +GAE L S N SP+ 
Sbjct: 119 GTFDEKRLFAPGPLPAPIDFRGVKIGVPICEDIWFPFVTA-HLRSEGAEILISPNGSPFE 177

Query: 181 HNKLKKRHEIVT-GQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
            +K  +R   V   ++    LP++Y+N+VGGQDEL+FDGASF  +G   +A Q+  + E 
Sbjct: 178 VDKDDRRINAVAGTRVRETGLPLVYLNRVGGQDELVFDGASFVMNGDLSIAQQLPDWEEA 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
             +T W       +W           ++  +     YNA VL LRDYV KN F  V++GL
Sbjct: 238 LVLTTWE------KWEGQWVCLPGERHVLDERPADIYNAMVLGLRDYVNKNRFPGVVLGL 291

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL AA+AVDALG + V  +M+P ++TS +SL+DA  CA+ LG +YD +PI   V
Sbjct: 292 SGGIDSALSAAVAVDALGADRVWCVMMPSRFTSQESLDDAVECARLLGVRYDSIPIEPAV 351

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F S+++         +  ENIQSRIRG  LM LSN    MLLTT NKSE+SVGY T+Y
Sbjct: 352 EAFDSMLANVFTGRQRDLTEENIQSRIRGVTLMGLSNKYGHMLLTTGNKSEMSVGYATIY 411

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSG--LGPLTEVIPPSILEKSPSAELRPHQ 477
           GDM+GG++ LKD YKT VF L  WRN +  + G   GP   ++P  ++ K PSAELR +Q
Sbjct: 412 GDMAGGYSVLKDAYKTTVFDLCRWRNENVPSLGEAFGPKGPIMPDRVITKPPSAELRDNQ 471

Query: 478 TDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            D++SLPPY +LD I+  +VE E S      + ++ +TV  +E LLY +EYKRRQ+P G 
Sbjct: 472 KDEDSLPPYEVLDPILYGLVEEELSVEQLVARGFDKDTVARIERLLYVAEYKRRQSPPGV 531

Query: 537 KITAKSFGRDRLYPISNKFR 556
           K+  ++FGRDR YPI+N FR
Sbjct: 532 KLGMRNFGRDRRYPITNAFR 551


>gi|262280051|ref|ZP_06057836.1| glutamine-dependent NAD+ synthetase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262260402|gb|EEY79135.1| glutamine-dependent NAD+ synthetase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 541

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 224/556 (40%), Positives = 319/556 (57%), Gaps = 21/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTKKMIEQVNQAKKQDADLIIFPELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQ-DQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L          +V GF  Q +     NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQLAEV---KDIVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   + +  LNASPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTVLVLNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL I+YVNQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRTQTLSELAKQLHLNIVYVNQVGGQDDLIFDGTSFVSNKNGEIALQAPSFKEDL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           ++ E+ +  +  +    +          L+     Y   V++ RDYV+++ F  VI+GLS
Sbjct: 237 YIAEFDHKNKSFKVTESAPA--------LETFAEIYQGLVMATRDYVERSGFPGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +VN
Sbjct: 289 GGIDSALTLAIAVDAIGAEKVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSVVN 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +  F    P+    EN+Q+R RG +LM LSN    ++L T NKSE+SVGY TLYG
Sbjct: 349 SFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLATGNKSELSVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF  LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q DQ
Sbjct: 409 DMVGGFAVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LD I+   +E +    +   + ++ E V  V  L+  +EYKRRQ  +G +IT
Sbjct: 462 DSLPAYDVLDAILYAYIEEDLGQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGPRIT 521

Query: 540 AKSFGRDRLYPISNKF 555
           +++F R+R YPI N +
Sbjct: 522 SRAFSRERRYPIINGW 537


>gi|237745825|ref|ZP_04576305.1| NAD+ synthase [Oxalobacter formigenes HOxBLS]
 gi|229377176|gb|EEO27267.1| NAD+ synthase [Oxalobacter formigenes HOxBLS]
          Length = 537

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 232/559 (41%), Positives = 323/559 (57%), Gaps = 24/559 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    K+AIAQ+N  VGD++GN A+  +   EA  +G D++L  EL ++GYPPEDL+ + 
Sbjct: 1   MSP--KVAIAQINSTVGDLSGNRARIAQFAREAAAKGADIVLTPELSLTGYPPEDLLLQH 58

Query: 61  SFIQACSSAIDTLKSDTHDG-GAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
           SF  A    +D LK++  D     ++VG          N+  IL  G+II    K  LPN
Sbjct: 59  SFHSATRLELDRLKNELADLDNVHVLVGHHCIRDGLCYNACSILANGSIIGTYFKQELPN 118

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           Y+ F EKR F  G        + +  G+ ICEDIW      +     GA+ L  +N+SPY
Sbjct: 119 YTVFDEKRYFTPGTEPLVFHVKGVSFGVTICEDIWFPEPAERTRAA-GADVLLIMNSSPY 177

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           +  K+ +R  IV   + H  L  +YVN VGGQDELIFDG SF  +   ++  Q+K   E 
Sbjct: 178 HMGKMHQRPVIVRQNVIHHGLAALYVNLVGGQDELIFDGCSFAMNRDGKVCVQLKQCEED 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
             +  +             +     M      E+  Y A VL +RDYV KN F  VIIGL
Sbjct: 238 MEIVSFE----------NGNPVNGRMEEHPTVEKEVYRALVLGVRDYVNKNGFPGVIIGL 287

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGG+DSAL  AIAVDALG E V+TIM+P  YTS  S  DA+  A  +   YD +PI D  
Sbjct: 288 SGGVDSALVLAIAVDALGPEKVRTIMMPSPYTSEISRIDASDMAARMKVSYDEIPITDCF 347

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           + F   ++      P     EN+Q+RIRG +LMALSN   +++LTT NKSE++VGY TLY
Sbjct: 348 SSFLQTLAPQFANLPEDSTEENLQARIRGTLLMALSNKFGSIVLTTGNKSEMAVGYCTLY 407

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGF  +KD+YKT V++L  +RN+         +++VIP  +L ++P+AEL+P+Q D
Sbjct: 408 GDMAGGFAVIKDIYKTLVYRLCRYRNT---------ISDVIPERMLTRAPTAELKPNQFD 458

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q++LPPY +LD I+K  +E  +S     +  Y+   V  +  L+  +EYKRRQAP+G +I
Sbjct: 459 QDTLPPYEVLDAIVKMFMEENKSVNEIVRNGYSHIVVERIVRLMRINEYKRRQAPIGIRI 518

Query: 539 TAKSFGRDRLYPISNKFRD 557
           T + FGRD   PI++KFRD
Sbjct: 519 TPRGFGRDWRCPITSKFRD 537


>gi|149915731|ref|ZP_01904256.1| NAD(+) synthase [Roseobacter sp. AzwK-3b]
 gi|149810313|gb|EDM70158.1| NAD(+) synthase [Roseobacter sp. AzwK-3b]
          Length = 552

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 237/559 (42%), Positives = 328/559 (58%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    ++ +AQ NP +GD+ GN   ARRA       G +L+   E+FI+GY  +DLV K 
Sbjct: 1   MADSFRLTLAQWNPTMGDLDGNADLARRAWRTGREAGANLVALPEMFITGYNTQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F  A  +AI++L  D  D G  + +G P      + N+  IL  G I +   K +LPN 
Sbjct: 61  AFHTAAIAAIESLARDCAD-GPALAIGGPALQDGVLYNAYYILQEGRIASRVFKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F EKR + +G    P     +R+G  ICED W      + L + GA+ L   N SPYY
Sbjct: 120 TVFDEKRIYAAGAVTGPYAVDGLRIGSPICEDSWYEDV-AETLAETGAQILLVPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  RH+I+  ++    LP+IY+N VGGQD+ +FDG SF  +    LA QM    E  
Sbjct: 179 RQKLSHRHQIMVARVIETGLPLIYLNLVGGQDDQVFDGGSFALNPGGALALQMPLMQEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                   +    W     D A          E DY+A VLSLRDY++K  F KV++GLS
Sbjct: 238 -TAHLDLTRTEDGWRITPSDLAPVP----DAMEQDYHAMVLSLRDYLRKTGFRKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL A +AVDALG ENV+ +MLP  YTS  SL+DA   A+ LGC+YD +PI +   
Sbjct: 293 GGIDSALVACVAVDALGPENVRCVMLPSDYTSQASLDDAETLARTLGCRYDTVPIAEGRQ 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +     I  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITRTLAPLFEGTAPDITEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NPLKD+YKT+VF    WRN+      +GP+  VIP  ++++ PSAEL P Q D+
Sbjct: 413 DMAGGYNPLKDMYKTRVFDTCRWRNTVHRDWMMGPVGAVIPQRVIDRPPSAELAPDQRDE 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LD I++ +V+ + S  +     ++      VEHLLY SEYKR Q+  GT+++
Sbjct: 473 DSLPAYSVLDGILEILVDQDGSIADCVAAGFDRADASRVEHLLYISEYKRFQSAPGTRLS 532

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++F  DR YPI+N++RD 
Sbjct: 533 KRAFWLDRRYPIANRWRDK 551


>gi|257054803|ref|YP_003132635.1| NAD+ synthetase [Saccharomonospora viridis DSM 43017]
 gi|256584675|gb|ACU95808.1| NAD+ synthetase [Saccharomonospora viridis DSM 43017]
          Length = 577

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 221/584 (37%), Positives = 328/584 (56%), Gaps = 37/584 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L+IA+AQ+N  VGD++GN          A   G  ++LF E+ + GYP EDL  + +
Sbjct: 1   MPQLRIALAQVNTTVGDLSGNSDLVVEWTRRAASDGAHVVLFPEMALPGYPVEDLALRGA 60

Query: 62  FIQACSSAIDTLKSDTHDGG---AGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLP 118
           F +A  +A+  L +   D G     +VVG+   D  G  N+V  L  G ++A + K +LP
Sbjct: 61  FTEASRAAVTELATAIADAGHGDVCVVVGYLDADDVGPRNAVAALYRGEVVATQYKHHLP 120

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           NY  F E+R F  G +   +    + LG+ ICED+W+       L   G + + +LNASP
Sbjct: 121 NYGVFDERRYFEPGTTLTVLRTHGVDLGLAICEDLWQEGGPVAALGAFGVDLVLALNASP 180

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K   R  +VT + + V  P+ Y N VGGQD+L+FDG SF  D    L  +   F+E
Sbjct: 181 YERAKSDVRVPLVTRRAAEVKAPVAYANLVGGQDDLVFDGGSFVVDADGVLLARAPQFAE 240

Query: 239 QNFMTEWHYDQQ---------------LSQWNYMSDDSASTMYI---------PLQEEEA 274
              + +    ++               L+    +  D     Y          PL +E  
Sbjct: 241 HLLVVDLDLPERRGTGDRSRGEARVEGLAVRRRVLSDVPLDPYPVTYRPELAEPLSDEAE 300

Query: 275 DYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQ 334
            ++A V++L+DYV+KNNF  V++G SGGIDSA+ AA+A DALG + V  + +P KY+S  
Sbjct: 301 IWSALVMALQDYVRKNNFRSVLLGFSGGIDSAVVAALAADALGSDAVYGVSMPSKYSSAH 360

Query: 335 SLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMAL 394
           S  DAA  A+ LGC + V P+ ++V  +   +      +  G+  ENIQ+R+RG +LMAL
Sbjct: 361 SRSDAAELARRLGCHFRVEPVENIVAAYVDQL------QLEGVAEENIQARVRGMMLMAL 414

Query: 395 SNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLG 454
           SN    ++L T NK+E++VGY T+YGD  GGF P+KD++KTQV++LA WRN+     G  
Sbjct: 415 SNMEGHLVLATGNKTELAVGYSTIYGDAVGGFAPIKDVFKTQVWELARWRNAEAEKRGET 474

Query: 455 PLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDE 513
           P    IPP+ + K PSAELRP Q D +SLP Y +LD++++  V  +  F +     ++ E
Sbjct: 475 P---PIPPNSITKPPSAELRPGQLDTDSLPDYALLDELLENYVGGDRGFADLLAAGFDAE 531

Query: 514 TVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           TV  V  ++  +EYKRRQ P G KIT K+FGRDR  P++N + +
Sbjct: 532 TVDRVVRMVDRAEYKRRQYPPGPKITFKAFGRDRRLPLTNAWHE 575


>gi|217970173|ref|YP_002355407.1| NAD synthetase [Thauera sp. MZ1T]
 gi|217507500|gb|ACK54511.1| NAD+ synthetase [Thauera sp. MZ1T]
          Length = 542

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 228/557 (40%), Positives = 333/557 (59%), Gaps = 25/557 (4%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            + IA+AQLN  VGD+ GN      A ++A   G  L+L  EL +SGYPPEDL+ +  F 
Sbjct: 8   PVSIAVAQLNLTVGDLVGNADHIIAALDDARAAGAQLLLTPELALSGYPPEDLLLRPDFY 67

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +AC+  ++ + +     G  +V+G P +D     N+  +L  G ++    K  LPNY  F
Sbjct: 68  RACAREVERIAAAAR--GVTVVLGHPVEDGGERYNAASVLRDGAVLTRYHKSLLPNYEVF 125

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F +G +        +R G+ IC D+W      +  +  GA+ L +LNASPY+ NK
Sbjct: 126 DEERYFEAGGTACVFECAGVRFGVNICADVW-ERGPAEAARAAGAQVLLALNASPYHMNK 184

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
             +R E++  +++   LP++Y N VGGQDEL+FDGASF  D    +  Q+  F E+  + 
Sbjct: 185 QAQRLEVLRARVAETGLPVLYCNMVGGQDELVFDGASFALDAGGAVGLQLGSFVERVAIV 244

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEE-ADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
           +           Y S   +   ++P +  E   Y A  + +RDY+ KN F   IIGLSGG
Sbjct: 245 D-----------YASGGWSGGEHVPARTLEAEVYEALRIGVRDYLAKNRFPGAIIGLSGG 293

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL  AIAVDALG + V+ +M+P  YT+  SL+D+      LG +YD + I   +  F
Sbjct: 294 IDSALTLAIAVDALGADKVRAVMMPSPYTAQMSLDDSRDMVARLGVRYDEIAIEPAMKVF 353

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
             L++      P+    EN+Q+RIRG +LMALSN + A++LTT NKSE++ GY TLYGDM
Sbjct: 354 AELLADQFAGLPADTTEENLQARIRGMLLMALSNKTGAIVLTTGNKSEMATGYATLYGDM 413

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF  LKDLYKT VF+L++WRN+         ++ VIP +I+++ PSAEL+P Q DQ+S
Sbjct: 414 AGGFAVLKDLYKTFVFRLSNWRNT---------VSPVIPQNIIDRPPSAELKPDQKDQDS 464

Query: 483 LPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY +LD II+  +E +ES  +     + +  VR V  +L  +EYKRRQAPVG ++T +
Sbjct: 465 LPPYDMLDAIIQAYMERDESPRDIVAAGFPEGEVRRVVGMLKRNEYKRRQAPVGIRVTQR 524

Query: 542 SFGRDRLYPISNKFRDH 558
            FGRD  YPI+++++D 
Sbjct: 525 GFGRDWRYPITSRYQDE 541


>gi|71906925|ref|YP_284512.1| NAD synthetase [Dechloromonas aromatica RCB]
 gi|71846546|gb|AAZ46042.1| NH(3)-dependent NAD(+) synthetase [Dechloromonas aromatica RCB]
          Length = 538

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 228/555 (41%), Positives = 326/555 (58%), Gaps = 20/555 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L+IA+AQ N  VGD+ GN+ +  +   EA  +G  ++L  EL + GYPPEDL+ +  F +
Sbjct: 2   LRIAVAQFNATVGDLTGNVERIIKCASEAKVRGAQVLLTPELALCGYPPEDLLLRPDFYR 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+D L   +   G  +VVG P + +    N+  +++ G   AV  K+ LPNY  F 
Sbjct: 62  ACQRALDNLV--SRVEGIAVVVGHPEEHEGRCYNAATVIENGRSKAVYRKMRLPNYEVFD 119

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G     +    +R GI IC DIW  +   +   + GAE L  LNASP +  K 
Sbjct: 120 EKRYFEPGTEACVVTLAGVRCGINICADIW-EAGAAELAHEAGAELLLVLNASPCHLEKH 178

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           ++R +++  +I    +P +Y N VGGQDEL+FDGASF  D ++    ++  F E   + +
Sbjct: 179 QQRIQVLGDRIDATGIPAVYCNLVGGQDELVFDGASFALDARKNCCMRLPQFEEALGIVD 238

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           +   +  S            M   L  E   Y A V+ +RDY+ K  F   IIGLSGGID
Sbjct: 239 FDAGRLHSD----------DMADELSLEAEAYKALVVGVRDYIGKTGFKGAIIGLSGGID 288

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL   +AVDALG + V+ +M+P  YT+  SL+D+    + LG +YD + I   +  + +
Sbjct: 289 SALTLCVAVDALGADKVRAVMMPSPYTAQMSLDDSREMIRVLGVQYDEIAIAPAMEVYGA 348

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
           ++       P+    ENIQ+RIRGNILMALSN + A++LTT NKSE++VGY TLYGDM+G
Sbjct: 349 MLDPLFAGLPADTTEENIQARIRGNILMALSNKTGALVLTTGNKSEMAVGYCTLYGDMAG 408

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF  +KD+YKT V++L+ +RN+      L     VIP +I+ + PSAEL+P QTDQ+SLP
Sbjct: 409 GFAVIKDVYKTLVYRLSVYRNT------LCQGDPVIPENIIVRPPSAELKPDQTDQDSLP 462

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY ILD I++  +E + S          +  VR V  LL  +EYKRRQAP+G +IT + F
Sbjct: 463 PYEILDAIVRAYMEEDRSPREIIAAGLQEADVRRVVRLLRIAEYKRRQAPIGIRITPRGF 522

Query: 544 GRDRLYPISNKFRDH 558
           G+D  YPI+N++ D 
Sbjct: 523 GKDWRYPITNRYADE 537


>gi|91976537|ref|YP_569196.1| NAD synthetase [Rhodopseudomonas palustris BisB5]
 gi|91682993|gb|ABE39295.1| NH(3)-dependent NAD(+) synthetase [Rhodopseudomonas palustris
           BisB5]
          Length = 585

 Score =  495 bits (1274), Expect = e-138,   Method: Composition-based stats.
 Identities = 279/569 (49%), Positives = 374/569 (65%), Gaps = 16/569 (2%)

Query: 1   MLKK---LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           M      L I++AQLNP VGDIAGN A AR AR +A  +G +L++F ELFISGYPPEDLV
Sbjct: 1   MTDTAARLTISLAQLNPTVGDIAGNAAMARAARAQAAAEGAELVVFPELFISGYPPEDLV 60

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
            K +F  AC +A++ L  +T DGG  +++G P  D   + N+  +LD G I A+R K+NL
Sbjct: 61  LKPAFQTACRAAVEDLARETADGGPAMLIGSPWLDGGKLYNACALLDGGRIAAIRTKVNL 120

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIW-----KNSNICKHLKKQGAEFLF 172
           PNY  F EKR F  G  + P+  R +R+G+ ICED W        N+ + L + GAE L 
Sbjct: 121 PNYGVFDEKRVFSRGPVSGPMTIRGVRVGVPICEDTWLEESEDYENVVECLAETGAEILI 180

Query: 173 SLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQ 232
             N SPY   K   R  +   +++   LP++Y+NQVGGQDEL+FDGASF  +  + LA Q
Sbjct: 181 VPNGSPYARGKSDLRLSVQVARVTESDLPLVYLNQVGGQDELVFDGASFVLNADRSLAAQ 240

Query: 233 MKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNF 292
           +  F+E   +T  H+ +  S W          +   L  +E DY ACVL LRDYV+KN F
Sbjct: 241 LPAFAES--ITTLHWQKGASGWRC-----DGPVAPTLDGDEGDYAACVLGLRDYVRKNGF 293

Query: 293 HKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDV 352
             V++G+SGGIDSALCAAIAVDALG + V+ +MLP++YT+  SL+DA   A+ALG  Y+V
Sbjct: 294 PGVLLGISGGIDSALCAAIAVDALGADKVRGVMLPFRYTAQISLDDADGLARALGFGYEV 353

Query: 353 LPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEIS 412
           LPI   VN F  ++++        I  EN+Q+R RG +LMA+SN + AM++TT NKSE+S
Sbjct: 354 LPIAAAVNGFEDILAKPFAGLERDITEENLQARTRGTLLMAISNKTGAMVVTTGNKSEMS 413

Query: 413 VGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAE 472
           VGY TLYGDM+GGFNP+KD+YKT+VF+L+S RN       LGP  EVIP SI+ + P+AE
Sbjct: 414 VGYATLYGDMNGGFNPIKDIYKTEVFRLSSLRNRWKPDGALGPDGEVIPESIIVRPPTAE 473

Query: 473 LRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQ 531
           LR +QTDQ+SLPPY +LD I++R+VE EE         ++ +TV  ++ LL  +EYKRRQ
Sbjct: 474 LRENQTDQDSLPPYEVLDAILERLVEREEPLATIVAEGFDRDTVVRIDRLLNIAEYKRRQ 533

Query: 532 APVGTKITAKSFGRDRLYPISNKFRDHIS 560
           A  G K+T K+FGRDR YPI+N+FRD   
Sbjct: 534 AAPGVKVTRKNFGRDRRYPITNRFRDKAE 562


>gi|254517171|ref|ZP_05129229.1| NAD+ synthetase [gamma proteobacterium NOR5-3]
 gi|219674676|gb|EED31044.1| NAD+ synthetase [gamma proteobacterium NOR5-3]
          Length = 540

 Score =  495 bits (1274), Expect = e-137,   Method: Composition-based stats.
 Identities = 226/555 (40%), Positives = 325/555 (58%), Gaps = 21/555 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMD--LILFTELFISGYPPEDLVFKKSF 62
           + I +AQ+N  VGD  GN  +   A E+A  Q  D  +++F EL +SGYPPEDL+ + + 
Sbjct: 1   MHILMAQINTTVGDFTGNTDQVIVAAEQACAQH-DSPIVVFPELTLSGYPPEDLLLRPAL 59

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
            +  S A++ L SD   G A ++VG+P + +  + N   ++  G ++A   K  LPNY  
Sbjct: 60  CKRVSDALERLCSDLP-GSAWVIVGYPIRREGALYNCAGVIHQGELVAEYRKCELPNYQV 118

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F +G     +    +R+G+ ICEDIW            GA+ L +LNASPY+  
Sbjct: 119 FDEKRYFTAGSQPCVLDIEGVRVGLSICEDIWVPGPTA-ATAAAGAQLLINLNASPYHRG 177

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K ++R E+V+ +     L ++YVNQVGGQDEL+FDG SF  + +  +A Q   F      
Sbjct: 178 KQQQRLELVSQRCKDNKLAVVYVNQVGGQDELVFDGGSFAMNPEGSVAVQAPRFQNATTW 237

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
            E+  +              S++  PL E  A + A VL +RDYV KN F  V++GLSGG
Sbjct: 238 CEYSGEAGAGALR------TSSIEPPLDELAAIWQALVLGMRDYVNKNGFPGVVLGLSGG 291

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           +DSAL  A+AVDALG E VQ +M+P++YTS  S+ DAA  +  LG ++ V+ I  +   F
Sbjct: 292 VDSALTLAVAVDALGPERVQAVMMPFRYTSDISIADAAQQSATLGVRHSVISIEPIYESF 351

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            + +             EN+Q+R RG +LM+LSN  ++++LTT NKSE++VGY TLYGDM
Sbjct: 352 LAALQDEFAGLEPDTTEENLQARCRGVLLMSLSNKKRSLVLTTGNKSELAVGYSTLYGDM 411

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF+ LKD+ KT V+ L  +RNS         L   IP  ++E+ PSAEL P Q D++S
Sbjct: 412 AGGFDVLKDVPKTLVYALCHYRNS---------LGPCIPERVIERPPSAELAPDQKDEDS 462

Query: 483 LPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY +LD I++  VE + S      +  +   V     L+  +EYKRRQAPVG +IT +
Sbjct: 463 LPPYEVLDRILELYVERDYSAEAIIAEGIDRADVERAVRLVDINEYKRRQAPVGVRITQR 522

Query: 542 SFGRDRLYPISNKFR 556
            FGRDR YPI++ +R
Sbjct: 523 GFGRDRRYPITSAWR 537


>gi|86750492|ref|YP_486988.1| NAD synthetase [Rhodopseudomonas palustris HaA2]
 gi|86573520|gb|ABD08077.1| NH(3)-dependent NAD(+) synthetase [Rhodopseudomonas palustris HaA2]
          Length = 585

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 273/569 (47%), Positives = 367/569 (64%), Gaps = 16/569 (2%)

Query: 1   MLKK---LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLV 57
           M        I++AQLNP VGDI GN A AR AR +A  +  D+I+F ELFISGYPPEDLV
Sbjct: 1   MTNTAARFTISLAQLNPTVGDITGNAAMARAARAQAAAENADVIVFPELFISGYPPEDLV 60

Query: 58  FKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINL 117
            K +F  AC +A++ L  +T DGG  +++G P  D   + N+  +LD G I A+R K+NL
Sbjct: 61  LKPAFQAACRAAVEELARETADGGPAMLIGSPWVDGGKLYNACALLDGGRIAAIRFKVNL 120

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIW-----KNSNICKHLKKQGAEFLF 172
           PNY  F EKR F  G    P+  R +R+G+ ICED W        N+ + L + GAE L 
Sbjct: 121 PNYGVFDEKRVFARGPVAGPVTIRGVRVGVPICEDTWLEESEDYENVVECLAETGAEILI 180

Query: 173 SLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQ 232
             N SPY   K   R  +   +++   LP++Y+NQVGGQDEL+FDGASF  +  + LA Q
Sbjct: 181 VPNGSPYARGKGDLRLSVQVARVTESDLPLVYLNQVGGQDELVFDGASFALNADRSLAAQ 240

Query: 233 MKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNF 292
           +  F+E   +T   + +    W          +      +E DY ACVL LRDYV+KN F
Sbjct: 241 LPAFAE--CITTLVWQKSADGWRC-----DGPVAAVPDGDEGDYAACVLGLRDYVRKNGF 293

Query: 293 HKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDV 352
             V++G+SGGIDSALCAAIAVDALG   V+ +MLP++YT+  SL+DA+  A ALG  Y+V
Sbjct: 294 PGVLLGISGGIDSALCAAIAVDALGAGRVRGVMLPFRYTAQISLDDASRLANALGFGYEV 353

Query: 353 LPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEIS 412
           LPI   V  F +++++        I  EN+Q+R RG +LMA+SN + AM++TT NKSE+S
Sbjct: 354 LPIAQAVEGFEAILAKPFAGLARDITEENLQARTRGTLLMAISNKTGAMVVTTGNKSEMS 413

Query: 413 VGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAE 472
           VGY TLYGDM+GGFNP+KD+YKTQVF+L+S RN       LGP  EVIP SI+ + P+AE
Sbjct: 414 VGYATLYGDMNGGFNPIKDIYKTQVFRLSSLRNRWKPDGALGPDGEVIPESIIVRPPTAE 473

Query: 473 LRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQ 531
           LR +QTDQ+SLPPY +LD I++R+VE E+   +     ++ +TV  ++ LL  +EYKRRQ
Sbjct: 474 LRENQTDQDSLPPYEVLDAILERLVEREQPLASIVAEGFDKDTVMRIDRLLNIAEYKRRQ 533

Query: 532 APVGTKITAKSFGRDRLYPISNKFRDHIS 560
           A  G K+T K+FGRDR YPI+N+FRD   
Sbjct: 534 AAPGVKVTRKNFGRDRRYPITNRFRDKAE 562


>gi|320539255|ref|ZP_08038925.1| putative NAD+ synthetase [Serratia symbiotica str. Tucson]
 gi|320030647|gb|EFW12656.1| putative NAD+ synthetase [Serratia symbiotica str. Tucson]
          Length = 540

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 236/556 (42%), Positives = 344/556 (61%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +  +E    G DLI+FTEL + GYPPEDL+++ 
Sbjct: 1   MSRSLSIALAQLNLLVGDIEGNTERMLQIAQEQQEAGADLIMFTELALCGYPPEDLLYRN 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C++ +  L+    D    I+VG P ++ + + N++ +   G ++    K  LPNY
Sbjct: 61  DFYQRCAAQLQRLQQAASD--VAILVGHPWREGDKLYNALSLFAEGRLLTRYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G     +  +  RLG+LICED+W    +       GAE + S+NASPY+
Sbjct: 119 GVFDEKRYFHAGSETCVVELKGYRLGLLICEDLWFPEPMDAAKAA-GAELILSINASPYH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
           + K   R+ ++ G     HLP++Y+NQ+GGQDELIFDG S  FD    +  ++  F+EQ 
Sbjct: 178 YEKPYIRNTLMVGHCQRTHLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFTEQV 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              E+         N +     S     L +    Y A VL++RDYV KN F+  ++GLS
Sbjct: 238 AQLEF---------NELDVVPMSAPATQLPQLAQVYAALVLAVRDYVTKNGFNGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK++VQ +M+P++YT+  S+ DA   A+ LG ++D++ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDSVQALMMPFRYTADISIADAKEEAEILGVEFDIVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +S            EN+Q+R RG ILMALSN  ++++LTT NKSE++VGY TLYG
Sbjct: 349 AFIGQLSPMFAGTERDTTEENLQARCRGVILMALSNKRRSIVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L+ +RN          ++ VIP  ++E+ PSAEL P Q+DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFKLSEYRN---------GVSYVIPQRVIERPPSAELAPDQSDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S  +   + +++  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEGDKSVADLVAEGFDEAIVRQVIRLVDINEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|256375054|ref|YP_003098714.1| NAD+ synthetase [Actinosynnema mirum DSM 43827]
 gi|255919357|gb|ACU34868.1| NAD+ synthetase [Actinosynnema mirum DSM 43827]
          Length = 571

 Score =  494 bits (1272), Expect = e-137,   Method: Composition-based stats.
 Identities = 211/579 (36%), Positives = 311/579 (53%), Gaps = 32/579 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+AQ+N  VGD+AGN A       +A   G  L++F E+ ++GYP EDLV ++S
Sbjct: 1   MPQLRLALAQVNACVGDLAGNSALVVDWTRKAVEAGAHLVVFPEMVLTGYPVEDLVLRES 60

Query: 62  FIQACSSAIDTLKSDTHD---GGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLP 118
           F  A  +A+  L +       GG  +  G+   D+ G  NS  +L  G ++A + K +LP
Sbjct: 61  FTSASKAALTDLAATLDREGLGGIAVFAGYLDGDERGKRNSAAVLHGGQVVARQHKHHLP 120

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           NY  F E+R F  G + + +    + +G++ICED+W++      L + G + + S NASP
Sbjct: 121 NYGVFDERRYFRRGDALEVVRLHGVEVGLVICEDLWQDGGPVAALGQAGVDLVVSPNASP 180

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K   R  +V  + +    P+ YVN +GGQDEL+FDG +        L  +   F E
Sbjct: 181 YERKKDDVRLPLVARRAAEAGAPLAYVNLIGGQDELVFDGDTMVVGADGSLLTRAPQFVE 240

Query: 239 QNFMTEWHYDQQLSQ-------------------WNYMSDDSASTMYIPLQEEEADYNAC 279
              + +       ++                                 PL +E   ++A 
Sbjct: 241 HLVVLDLDLPGGAARTEGDVAGFHVTRKVISDEPLPRYEPLPVPASAEPLSDEAEVWHAL 300

Query: 280 VLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDA 339
           V  LRDYV KN F  V++GLSGGIDSA+ A++AVDALG ++V  + +P  Y+S  S  DA
Sbjct: 301 VTGLRDYVHKNGFRSVVLGLSGGIDSAVVASLAVDALGADSVHGVSMPSVYSSDHSRSDA 360

Query: 340 AACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSK 399
              A+  G  Y   PI  +V  F   +        +G+  EN+Q+R RG  LM LSN   
Sbjct: 361 EDLAQRTGLHYSEQPIPTMVAAFVDQLG------LTGLAEENVQARCRGMTLMGLSNQHG 414

Query: 400 AMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEV 459
            ++L T NK+E++VGY T+YGD  GGF P+KD+ KT V+ LA WRN+     G  P    
Sbjct: 415 HLVLATGNKTELAVGYSTIYGDAVGGFAPIKDVLKTLVWDLARWRNAEAEKRGELP---P 471

Query: 460 IPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYV 518
           IP + + K PSAELRP Q D +SLP Y +LD ++   VE ++ +    D  +  E V  V
Sbjct: 472 IPENSISKPPSAELRPGQVDTDSLPDYELLDSVLDDYVEGDKGYRALLDSGFAPELVDRV 531

Query: 519 EHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
             ++  +EYKRRQ P GTKI+ K+FGRDR  PI+N +R+
Sbjct: 532 LRMVDRAEYKRRQYPPGTKISNKAFGRDRRLPITNGWRE 570


>gi|15606275|ref|NP_213654.1| NH(3)-dependent NAD+ synthetase [Aquifex aeolicus VF5]
 gi|6093465|sp|O67091|NADE_AQUAE RecName: Full=Probable glutamine-dependent NAD(+) synthetase;
           AltName: Full=NAD(+) synthase [glutamine-hydrolyzing]
 gi|2983464|gb|AAC07044.1| NH(3)-dependent NAD+ synthetase [Aquifex aeolicus VF5]
          Length = 567

 Score =  494 bits (1271), Expect = e-137,   Method: Composition-based stats.
 Identities = 216/575 (37%), Positives = 320/575 (55%), Gaps = 35/575 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           L + +AQLN  VGD+ GN  K  +  +E   +   +I F EL +SGYPPEDL+ +  F++
Sbjct: 2   LNLTLAQLNFTVGDVEGNKEKILKVIDE-YSEKSHIIAFPELSLSGYPPEDLLLQPHFLK 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
            C  A D +   T +    + VG P  + + + N++ ++  G ++ +  K  LPNYS F 
Sbjct: 61  ECEKAFDQIIHHTRNYDVIVAVGLPYYEFD-LYNALAVIHRGEVLGIYKKHFLPNYSVFD 119

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E R F  G     I     ++   ICEDIW    + +     GAE + ++NASPY+ NK 
Sbjct: 120 EYRYFRKGEEPLMIEVNGHKVSFSICEDIWYPDGVERQTALSGAELIVNVNASPYHVNKY 179

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             +   +  +       + YVN VGGQDEL+FDG S       +L  + K F E      
Sbjct: 180 SFKESFLKSRAEDNLCFVAYVNLVGGQDELVFDGRSIVISPFGKLVARAKAFEEDILTVT 239

Query: 245 WHY---------DQQLSQWNYMSDDSASTMYIPLQEEEA--------------DYNACVL 281
                       D +  + +Y  +       + L ++E                Y A  L
Sbjct: 240 LDLGEAKRKRLLDLRWREGSYGREKVNVKRSVSLPDKEFFRGRIEENPKEEEEIYAALKL 299

Query: 282 SLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAA 341
           SLRDYV+KN F KV++GLSGGIDS+  A +AVDALG+ENV+ + +P +++S +S EDA A
Sbjct: 300 SLRDYVRKNGFEKVVLGLSGGIDSSFVACLAVDALGRENVKGVYMPSQFSSKESYEDAKA 359

Query: 342 CAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAM 401
            A+ LG ++ V+PI ++   +F+   + + E    +  ENIQ+RIR NIL   SN  + +
Sbjct: 360 LAQNLGIEFHVIPIKEIYRAYFNEFEKEICEITFDVADENIQARIRANILFYFSNKFRYL 419

Query: 402 LLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIP 461
           +L+TSNKSE +VGY T+YGDM+GGF P+KD+YKT V++LA +RNS             IP
Sbjct: 420 VLSTSNKSETAVGYTTIYGDMAGGFAPIKDVYKTWVYKLARYRNSISPD---------IP 470

Query: 462 PSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEH 520
             + +K PSAELRP+QTDQ+ LPPY ILD I+   +E   S      +    + V    +
Sbjct: 471 ERVFKKPPSAELRPNQTDQDVLPPYEILDQILMLYIEENLSPEEIIRKGLPRDAVYKTIN 530

Query: 521 LLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           ++  +EYKR+QAP+G KIT+++FG+D   P++NKF
Sbjct: 531 MIRKNEYKRKQAPIGPKITSRAFGKDWRMPVTNKF 565


>gi|283851424|ref|ZP_06368705.1| NAD+ synthetase [Desulfovibrio sp. FW1012B]
 gi|283573162|gb|EFC21141.1| NAD+ synthetase [Desulfovibrio sp. FW1012B]
          Length = 587

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 210/583 (36%), Positives = 303/583 (51%), Gaps = 39/583 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +   ++A+ Q+NP VGD+ GN AK     E A R G ++++F E+ +SGYPPEDL+ K  
Sbjct: 1   MAAFRLALCQINPTVGDVDGNTAKILAHLESARRAGAEMVVFPEMAVSGYPPEDLLIKPD 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F+ AC      +   +   G  +V G P  D + ++N+ ++   G    +  K  LPNY 
Sbjct: 61  FLDACMDRAGEIIRAS--TGLTVVFGCPWLDGD-LVNAAIVAHDGRAAGLTAKRYLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNS-NICKHLKKQGAEFLFSLNASPYY 180
            F E R F +G  +          G+ +CEDIW       +     GA  L +++ASPY+
Sbjct: 118 VFDENRYFAAGRGSAVYDRDGFVFGVSVCEDIWYPGGPPSEQAHGGGARLLVNISASPYH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R  ++  + S     + Y N VGGQDEL+FDG S  F     L  + + F E  
Sbjct: 178 GGKGLGRERMLATRASDNGTFVAYANLVGGQDELVFDGHSLVFGPDGTLLARGRQFEEDL 237

Query: 241 FMTEWH---------YDQQLSQWNYMSDDSAS-----------------TMYIPLQ-EEE 273
            + +            D +  +W    +                         PL    E
Sbjct: 238 VVCDLDPGAPTRMRLLDPRSRKWEPQLESCPVRVDLPPLAAPARPPLPGCPVAPLCGSVE 297

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             Y A VL+ RDYV+K+ F  V +GLSGGIDS+L A IA DALG ENV  + +P +++S 
Sbjct: 298 EAYRALVLATRDYVRKSGFSAVAMGLSGGIDSSLTAVIAADALGPENVMGVAMPTRFSSD 357

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMA 393
            SLEDA A A+ LG    V+ I ++   F   ++    + P  +  EN+Q RIRG +LMA
Sbjct: 358 DSLEDAEALAEKLGITLHVVAIENIFKAFLEALAPLFGDRPFDVAEENLQPRIRGTLLMA 417

Query: 394 LSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGL 453
           LSN    ++LTT NKSE+ VGY TLYGD +GG+  +KD+ KT V+ L+ WRN    T   
Sbjct: 418 LSNKLGRLVLTTGNKSEVGVGYSTLYGDTAGGYAVIKDVPKTLVYALSRWRNEQAGT--- 474

Query: 454 GPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINND-QEYND 512
               ++IP  +L K P+AELRP+Q D +SLP Y +LD ++K  VE   S         + 
Sbjct: 475 ----DLIPERVLVKPPTAELRPNQKDSDSLPEYDVLDPVLKAYVELSLSPTAMAGAGMDP 530

Query: 513 ETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
             +  V  L+  +EYKRRQ+P G KIT ++FG+D   PI N++
Sbjct: 531 AVIDRVTKLVDRNEYKRRQSPPGPKITPRAFGKDWRLPIVNRY 573


>gi|90022198|ref|YP_528025.1| Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
           [Saccharophagus degradans 2-40]
 gi|89951798|gb|ABD81813.1| NAD+ synthetase [Saccharophagus degradans 2-40]
          Length = 540

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 228/556 (41%), Positives = 324/556 (58%), Gaps = 20/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  L IA+AQ+NP+VGDI GN          A     D+I+F EL ++GYPPEDL+ + S
Sbjct: 1   MSTLNIALAQINPLVGDIDGNTQLIIDEA-LALANKHDVIVFPELTLTGYPPEDLLLRPS 59

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
                  AI  +     +  A +VVG+P+++   + N   +L  G ++    K  LPNY 
Sbjct: 60  IALRVDRAIQQILDS--NISAAVVVGYPKREGGKLFNMAGVLAQGQVLFEYAKQCLPNYQ 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F EKR F +G          + LG+ ICEDIW + +    L+      + +LNASP++ 
Sbjct: 118 VFDEKRYFEAGSKPGVFQLNGVNLGLSICEDIW-DGSPLDQLQSADVHAVLNLNASPFHQ 176

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K  +R  ++  +   +  PI+YVNQVGGQDEL+FDG S     Q ++  + + F     
Sbjct: 177 EKQAEREALIAARAKKLGAPILYVNQVGGQDELVFDGGSMVATAQGEIVGRTELFKNACL 236

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
             E                 AS    P       Y A V+ +RDYV KN F  V++GLSG
Sbjct: 237 SVELD------TATKQVSPQASKSGHPADPLADTYEALVVGVRDYVNKNRFKGVVLGLSG 290

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSAL  AIAVDALGKE V+ +M+P+KYTS  SL+ A   A+ LG KY V+ I  + + 
Sbjct: 291 GIDSALTLAIAVDALGKERVEAVMMPFKYTSQLSLDGAEDEARRLGVKYRVIHIEPMYDA 350

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F   +++  + +      ENIQ+R RG +LMALSN    ++LTT NKSE++VGY TLYGD
Sbjct: 351 FTQALNEAFEGQQKDTTEENIQARSRGVLLMALSNKLGYLVLTTGNKSEMAVGYATLYGD 410

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GG + LKD+ KTQVF L+ +RN+         L EVIPP+++++ PSAEL P Q D++
Sbjct: 411 MAGGLDVLKDVPKTQVFALSRYRNT---------LGEVIPPAVIDRPPSAELAPDQKDED 461

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPY ILD I++  +E +ES  +   + ++ E V  V  L+  +EYKRRQAPVG +I+ 
Sbjct: 462 SLPPYEILDQILELYIEQDESAESIVAKGFDKEQVYRVLRLVDLNEYKRRQAPVGIRISK 521

Query: 541 KSFGRDRLYPISNKFR 556
           ++FGRDR YPI+N ++
Sbjct: 522 RAFGRDRRYPITNGWK 537


>gi|319793214|ref|YP_004154854.1| NAD+ synthetase [Variovorax paradoxus EPS]
 gi|315595677|gb|ADU36743.1| NAD+ synthetase [Variovorax paradoxus EPS]
          Length = 565

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 232/564 (41%), Positives = 320/564 (56%), Gaps = 17/564 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            LK+AIAQLN VVGD+ GN  K   A  E++ QG  L+L  EL I+GY  EDL  + +F 
Sbjct: 2   TLKLAIAQLNFVVGDVDGNARKIVDAARESHAQGARLLLTPELSIAGYAAEDLFLRPAFT 61

Query: 64  QACSSAIDTLKSDTHDG-GAGIVVGFP----RQDQEG----VLNSVVILDAGNIIAVRDK 114
           +AC  A+  + +   D     +VVG P     + +        N+  ++  G I+    K
Sbjct: 62  EACDDAVKGIAAALADLKDMVVVVGHPTGGSLRSRSVAVQMRHNAASVIKEGRILDTYAK 121

Query: 115 INLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSL 174
             LPNY  F E+R F  G          + +G+LICED W +    +  +  GAE L  +
Sbjct: 122 RELPNYQVFDERRYFTPGQGTCVFEAGGVSVGLLICEDAWFDQP-AELARAAGAEVLAVI 180

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           NASPY+  K  +R   +  +   V LP++Y + VGGQDE++FDGASF       LA Q++
Sbjct: 181 NASPYHVGKEGERVARMADRAHAVGLPLVYAHLVGGQDEVVFDGASFALQAGGALAMQVE 240

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHK 294
            F E+    +    ++  +           +  P   E   ++A VL +RDY+ KN F  
Sbjct: 241 SFQEKLVFAQL---ERTPEGGVGFVVEPGAVAAPRDAEAQLWDALVLGVRDYIGKNGFPS 297

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
            I+GLSGGIDSAL  AIAVDALGK+ V+ +M+P  YT+  S  DA   A  LG +YD + 
Sbjct: 298 AILGLSGGIDSALVLAIAVDALGKDKVRAVMMPSPYTADISWIDAREMANRLGVRYDEIS 357

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I      F   +++  ++ P     ENIQ+RIRG +LMALSN   +++LTT NKSE++ G
Sbjct: 358 IKHTFESFKGALAEEFKDRPEDTAEENIQARIRGTLLMALSNKFGSIVLTTGNKSEMATG 417

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
           Y TLYGDM+GGF  +KDL KT VF LA WRN+H      G     IP  I+ + PSAELR
Sbjct: 418 YCTLYGDMAGGFAVIKDLLKTTVFALARWRNAHDPY---GTGAAPIPDRIITRPPSAELR 474

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAP 533
           P QTDQ+SLPPY ILD I+ R ++++E         Y    V  V  L+  +EYKRRQAP
Sbjct: 475 PDQTDQDSLPPYDILDGILARYMQDDEGIDEIIAAGYERAVVERVARLIKVNEYKRRQAP 534

Query: 534 VGTKITAKSFGRDRLYPISNKFRD 557
           VG ++T +SFG+D  YPI++KF +
Sbjct: 535 VGIRVTHRSFGKDWRYPITSKFNE 558


>gi|120553808|ref|YP_958159.1| NAD+ synthetase [Marinobacter aquaeolei VT8]
 gi|120323657|gb|ABM17972.1| DNA-directed RNA polymerase, subunit H [Marinobacter aquaeolei VT8]
          Length = 554

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 221/556 (39%), Positives = 325/556 (58%), Gaps = 21/556 (3%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEA-NRQGMDLILFTELFISGYPPEDLVFKKS 61
           +KL++ +AQL+ +VGDI GN      A + A      D+++F EL ++GYPPEDL+ + S
Sbjct: 15  RKLRVVMAQLDFLVGDIPGNTDLILEATQRAWAEHQADIVVFPELCLTGYPPEDLLLRPS 74

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
                  A++ L+S        +V+G P +    + N+ ++++AG I     K   PNY 
Sbjct: 75  LDLRVREALEKLQSAA--LPPAMVIGAPIRSGGLLYNAALVIEAGQIRGRYFKRFPPNYQ 132

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F EKR F  G     +  +   +GI +CED+WK+    +     GA  + +LNASPY  
Sbjct: 133 VFDEKRYFAEGSDTLVLDIKGQPVGITVCEDLWKDGP-LEDAAAAGARLILNLNASPYDI 191

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
           +K  +R  ++  +     + I+YVN VGGQDEL+FDG S  +D    L+ ++  F E  +
Sbjct: 192 DKQARRKALLERKSRENRVSIVYVNLVGGQDELVFDGGSMAYDHSGGLSAEVPQFEEGLY 251

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
             ++     L + +             L  E   YNA V  +RDYV KN F  V++GLSG
Sbjct: 252 PVDF-----LCEHHCQPISRPLPPEPQL--EANVYNALVTGVRDYVNKNGFRSVVLGLSG 304

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSA+  A+AVDALGKE V+ +M+P++YTS  SLEDA A A ALG +YDV  I  + + 
Sbjct: 305 GIDSAVTLAVAVDALGKERVRAVMMPFRYTSSISLEDAEAEATALGVQYDVFSIEPMYDA 364

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F + +++           EN+Q+R+RG +LM+LSN   +++LTT NKSE++VGY TLYGD
Sbjct: 365 FMAALAEPFAGTKPDTTEENLQARLRGVLLMSLSNKFGSLVLTTGNKSEMAVGYSTLYGD 424

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGF+ LKD+ KT VF+LA +RN+         L+ VIP  ++ + PSAEL P Q D++
Sbjct: 425 MAGGFDVLKDVPKTLVFRLARYRNT---------LSPVIPERVITRPPSAELAPDQKDED 475

Query: 482 SLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLP Y +LD I+   VE + S        +  E V  V  L+  +EYKRRQAP+G +IT 
Sbjct: 476 SLPGYDVLDQILNLYVERDYSADAIVAEGFEREDVDRVVRLVDINEYKRRQAPIGVRITE 535

Query: 541 KSFGRDRLYPISNKFR 556
           + FG+DR YPI+N ++
Sbjct: 536 RGFGKDRRYPITNGWK 551


>gi|316934840|ref|YP_004109822.1| NAD+ synthetase [Rhodopseudomonas palustris DX-1]
 gi|315602554|gb|ADU45089.1| NAD+ synthetase [Rhodopseudomonas palustris DX-1]
          Length = 585

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 278/563 (49%), Positives = 373/563 (66%), Gaps = 13/563 (2%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           +L I++AQLNP+VGDIAGN  KAR AR +A   G DLI++ ELFI+GYPPEDLV K +F 
Sbjct: 7   RLTISLAQLNPMVGDIAGNADKARAARRQAAADGADLIVYPELFIAGYPPEDLVLKPAFQ 66

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
            AC +AI+ L  +T DGG  +++G P  D   + N+  +LD G I A+R K+NLPNY  F
Sbjct: 67  AACRAAIEELARETADGGPAMLIGSPWVDGGKLYNACALLDGGRIAALRFKVNLPNYGVF 126

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIW-----KNSNICKHLKKQGAEFLFSLNASP 178
            EKR F  G    P+  R +R+G+ ICED W     +  N+ + L + GAE L   N SP
Sbjct: 127 DEKRVFSRGPVAGPMTIRGVRIGVPICEDTWLEESDEYENVVECLAETGAEILIVPNGSP 186

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K   R  +   +++   LP++Y+NQVGGQDEL+FDGASF  +  + LA Q+  F E
Sbjct: 187 YAGGKTDLRMSVSVARVTESDLPLVYLNQVGGQDELVFDGASFVLNADRTLAAQLPGFVE 246

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
              +T   + +  + W          +   L+ +EADY ACVL LRDYV+KN F  V++G
Sbjct: 247 S--ITTLSFVRGAAGWRC-----DGPVAPVLEGDEADYAACVLGLRDYVRKNGFPGVLLG 299

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           +SGGIDSALCAAIAVDALG   V+ +MLP++YT+  SL+DA   A ALG  Y+VLPI   
Sbjct: 300 ISGGIDSALCAAIAVDALGAGKVRGVMLPFRYTAQVSLDDAGRLAGALGFGYEVLPIAQA 359

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           V  F +++++        I  EN+Q+R RG +LMA+SN + AM++TT NKSE+SVGY TL
Sbjct: 360 VEGFEAILAKPFAGLARDITEENLQARTRGTLLMAISNKTGAMVVTTGNKSEMSVGYATL 419

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGFNP+KD+YKTQVF+L+S RN       LGP  EVIP SI+ + P+AELR +QT
Sbjct: 420 YGDMNGGFNPIKDIYKTQVFRLSSLRNRWKPDDALGPDGEVIPESIIIRPPTAELRENQT 479

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLPPY +LD I++R+VE EE   +     ++ +TV  ++ LL  +EYKRRQA  G K
Sbjct: 480 DQDSLPPYDVLDAILQRLVEREEPLASIVAEGFDKDTVVRIDRLLNIAEYKRRQAAPGVK 539

Query: 538 ITAKSFGRDRLYPISNKFRDHIS 560
           +T K+FGRDR YPI+N+FRD   
Sbjct: 540 VTRKNFGRDRRYPITNRFRDKAE 562


>gi|306840502|ref|ZP_07473261.1| NAD+ synthetase [Brucella sp. BO2]
 gi|306289517|gb|EFM60735.1| NAD+ synthetase [Brucella sp. BO2]
          Length = 518

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 282/522 (54%), Positives = 361/522 (69%), Gaps = 7/522 (1%)

Query: 38  MDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVL 97
            DLILFTELFISGYPPED+V K +F+ AC  A+  L +DT DGG G+++G P     G  
Sbjct: 3   ADLILFTELFISGYPPEDMVLKPAFVAACEKAVRMLAADTADGGPGVIIGTPLHRDSGSH 62

Query: 98  NSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNS 157
           N+V +LD G IIA R K++LPNY EF EKR F  G    P+ FR +RLGI +CEDIW   
Sbjct: 63  NAVAVLDGGEIIAERFKVDLPNYGEFDEKRVFEPGPMPGPVNFRGVRLGIPVCEDIWGEL 122

Query: 158 NICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFD 217
            + + L + GAE L   N SPY+  K+ +RH++V  Q+    LPI+Y NQVGGQDEL+FD
Sbjct: 123 GVAETLAESGAEILLVPNGSPYHRAKMDRRHQVVLKQVIETGLPIVYANQVGGQDELVFD 182

Query: 218 GASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYN 277
           G SF F+  + L  QM  F+EQ  +TEW  D     W     + AS      +   ADY 
Sbjct: 183 GGSFVFNADKSLCLQMPQFAEQIALTEWQRDGD--GWRCGDGEKASLP----EGLAADYA 236

Query: 278 ACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLE 337
           AC+L LRDYV KN F  V++GLSGGIDSA+CAA+ VDALGK+ V+ +MLPY+YTS +SL 
Sbjct: 237 ACMLGLRDYVNKNGFKDVVLGLSGGIDSAICAALGVDALGKDRVRCVMLPYRYTSEESLA 296

Query: 338 DAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNH 397
           DAA CA+ALG +YD++PI + V  F + +        SG+  EN+QSR RG ILMA+SN 
Sbjct: 297 DAADCARALGVRYDIVPIAEPVEGFMNALQPLFSGTDSGVTEENLQSRARGTILMAISNK 356

Query: 398 SKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLT 457
             +M++TT NKSE+SVGY TLYGDM+GGFNP+KD+YK QV+ L+ WRN H     LGP  
Sbjct: 357 FGSMVVTTGNKSEMSVGYATLYGDMNGGFNPIKDVYKMQVYALSQWRNHHLPQGALGPAG 416

Query: 458 EVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVR 516
           EVIP +I+ K+PSAELR +QTDQ+SLPPYP+LDDI++ +VENE S      + +  ETV+
Sbjct: 417 EVIPQNIISKAPSAELRENQTDQDSLPPYPVLDDILECLVENEMSNAEIVARGHALETVQ 476

Query: 517 YVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
            +EHLLY +EYKRRQ+  G KIT K+FGRDR YPI+N+FRD 
Sbjct: 477 RIEHLLYLAEYKRRQSAPGVKITKKNFGRDRRYPITNRFRDR 518


>gi|296136241|ref|YP_003643483.1| NAD+ synthetase [Thiomonas intermedia K12]
 gi|295796363|gb|ADG31153.1| NAD+ synthetase [Thiomonas intermedia K12]
          Length = 560

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 236/568 (41%), Positives = 324/568 (57%), Gaps = 25/568 (4%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            L++A+ Q NP VGD+AGN A+  R   +A  QG  +++  EL ++GYPPEDL+ + +F+
Sbjct: 2   TLQLAVIQCNPTVGDLAGNAAQIARLTRQAYAQGARVVVTPELALTGYPPEDLLLRPAFL 61

Query: 64  QACSSAIDTLKSDTHDGG-AGIVVGFPR----QDQEGV--------LNSVVILDAGNIIA 110
           QA ++A+  L  D  D     +VVG P      +   +         N+  +L  G + A
Sbjct: 62  QASAAALKQLAHDLSDLPELALVVGHPLGLAAAEAPRIASTQQAVACNAASLLRGGVVEA 121

Query: 111 VRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEF 170
              K  LPNY  F E+R F  G             GI ICED W      +  +  GA+ 
Sbjct: 122 TYCKHELPNYQVFDERRYFAPGDQPVVFEAGGTHFGINICEDAWLPHAP-RMARAAGAQV 180

Query: 171 LFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLA 230
           L  LNASPY+  K  +R  ++  +     + ++    VGGQDE++FDGASF  D   +L 
Sbjct: 181 LLVLNASPYHRGKTAERERVMRERCLENGMALVASQMVGGQDEIVFDGASFVLDHAGELV 240

Query: 231 FQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKN 290
            +   F E     +    + L Q           +     +    Y A VL +RDY+ KN
Sbjct: 241 ARSPQFVEDILRVDVTGGEVLKQTPA-------HVAPLKSDHAEVYAALVLGVRDYLGKN 293

Query: 291 NFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKY 350
            F   +IGLSGG DSAL  AIAVDALG E V+ +M+P +YT+  SL+DAA  A+ LG +Y
Sbjct: 294 GFPGALIGLSGGADSALVLAIAVDALGAEKVRAVMMPSQYTAQISLDDAAEMAQRLGVQY 353

Query: 351 DVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSE 410
           DVLPI  L   F + ++  L E P     ENIQ+RIRG +LM LSN+S  ++LTT NKSE
Sbjct: 354 DVLPITPLFETFRTTLAPLLHEHPGDTTLENIQARIRGTLLMGLSNNSGRIVLTTGNKSE 413

Query: 411 ISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPS 470
           +++GY TLYGDM+GGF  +KD+ KT V++LA WRN+H    G     EVIP  I+ ++PS
Sbjct: 414 MAMGYATLYGDMAGGFAVIKDVTKTLVWELARWRNAHAAAMG---EAEVIPQRIITRAPS 470

Query: 471 AELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKR 529
           AELR  QTDQ+SLPPY +LD I++R +E +E         Y    V  V HLL  SEYKR
Sbjct: 471 AELRADQTDQDSLPPYDVLDGILQRYMEQDERVETVLAAGYARADVERVVHLLKLSEYKR 530

Query: 530 RQAPVGTKITAKSFGRDRLYPISNKFRD 557
           RQAP G ++T ++FGRD  YPI++KFR+
Sbjct: 531 RQAPPGIRVTHRAFGRDWRYPITSKFRE 558


>gi|253988810|ref|YP_003040166.1| NAD synthetase [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253780260|emb|CAQ83421.1| nh(3)-dependent nad+ synthetase [Photorhabdus asymbiotica]
          Length = 540

 Score =  493 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 235/556 (42%), Positives = 337/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN ++GDI GN  +  +  +E  +QG DL++F+EL +SGY PEDL+F+ 
Sbjct: 1   MSRTLNIALAQLNWMIGDIEGNCERMLQTVQEQQQQGADLVMFSELALSGYSPEDLLFRA 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C   +  L++ +      I+VG P +    + N++ +   G I+    K  LPNY
Sbjct: 61  DFHQRCREQLARLQAASDQ--VAILVGHPWEQDGEIYNALSLFWQGEILTRYFKQRLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G  +  + F+   LG+LICED+W +      L++ GA+ + S+NASPY 
Sbjct: 119 GVFDEKRYFKAGDQSCVVPFKGYNLGLLICEDLWFDEP-IDALQQAGADLILSINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R+E++        LP++Y+NQVGGQDELIFDG S  F+   ++  ++  F+EQ 
Sbjct: 178 REKPYIRYELIREHCQRTDLPMVYLNQVGGQDELIFDGCSKVFNASGEITHRLAAFNEQI 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
               +         N +  +        L   +  Y A VLS+RDYV+KN F  V++GLS
Sbjct: 238 QQCCF---------NELKIEPMVNPAPELPPLQQVYQALVLSVRDYVRKNGFQGVLLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDALGKE VQ +M+P++YTS  S+EDA   A  LG +++V+ I  + +
Sbjct: 289 GGIDSGLTLAIAVDALGKEYVQAVMMPFRYTSEMSIEDAKEQADMLGVEFNVVSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F                 EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 349 AFMVQFEPMFVGTVKDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFN LKD+ KT VF+LA +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFNALKDVPKTLVFELAKYRNT---------VSPAIPQRVIDRPPSAELAPGQLDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE ++S        +++E VR V  L+  +EYKRRQAPVG +IT
Sbjct: 460 DSLPPYDILDAILEGYVEQDKSVDELMAAGFDEEVVRKVIRLVDINEYKRRQAPVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 520 PRNFGKDRRYPITSGF 535


>gi|294340476|emb|CAZ88857.1| Glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) [Thiomonas sp. 3As]
          Length = 560

 Score =  493 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 234/568 (41%), Positives = 323/568 (56%), Gaps = 25/568 (4%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            L++A+ Q NP VGD+AGN A+  R   +A  QG  +++  EL ++GYPPEDL+ + +F+
Sbjct: 2   TLQLAVIQCNPTVGDLAGNAAQIARLTRQAYAQGARVVVTPELALTGYPPEDLLLRPAFL 61

Query: 64  QACSSAIDTLKSDTHDGG-AGIVVGFPR----QDQEGV--------LNSVVILDAGNIIA 110
           QA ++A+  L  D  D     +VVG P      +   +         N+  +L  G + A
Sbjct: 62  QASAAALKQLAHDLSDLPELALVVGHPLGLAAAEAPRIASTQQAVACNAASLLRGGVVEA 121

Query: 111 VRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEF 170
              K  LPNY  F E+R F  G             GI ICED W      +  +  GA+ 
Sbjct: 122 TYCKHELPNYQVFDERRYFAPGDQPVVFEAGGTHFGINICEDAWLPHAP-RMARAAGAQV 180

Query: 171 LFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLA 230
           L  LNASPY+  K  +R  ++  +     + ++    VGGQDE++FDGASF  D   +L 
Sbjct: 181 LLVLNASPYHRGKTAERERVMRERCLENGMALVASQMVGGQDEIVFDGASFVLDRAGELV 240

Query: 231 FQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKN 290
            +   F E     +    + L Q           +     +    Y A VL + DY+ KN
Sbjct: 241 ARSPQFVEDILRVDVTGGEVLKQTPA-------HVAPLKSDHAEVYAALVLGVHDYLGKN 293

Query: 291 NFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKY 350
            F   +IGLSGG DSAL  AIAVDALG + V+ +M+P +YT+  SL+DAA  A+ LG +Y
Sbjct: 294 GFPGALIGLSGGADSALVLAIAVDALGADKVRAVMMPSQYTAQMSLDDAAEMAQRLGVRY 353

Query: 351 DVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSE 410
           DVLPI  L   F + ++  L E P     ENIQ+RIRG +LM LSN+S  ++LTT NKSE
Sbjct: 354 DVLPITPLFETFRTTLAPLLHEHPGDTTLENIQARIRGTLLMGLSNNSGRIVLTTGNKSE 413

Query: 411 ISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPS 470
           +++GY TLYGDM+GGF  +KD+ KT V++LA WRN+H    G     EVIP  I+ ++PS
Sbjct: 414 MAMGYATLYGDMAGGFAVIKDVTKTLVWELARWRNAHAAAMG---EAEVIPQRIITRAPS 470

Query: 471 AELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKR 529
           AELR  QTDQ+SLPPY +LD I++R +E +E         Y    V  V HLL  SEYKR
Sbjct: 471 AELRADQTDQDSLPPYDVLDGILQRYMEQDERVETVLAAGYARADVERVVHLLKLSEYKR 530

Query: 530 RQAPVGTKITAKSFGRDRLYPISNKFRD 557
           RQAP G ++T ++FGRD  YPI++KFR+
Sbjct: 531 RQAPPGIRVTHRAFGRDWRYPITSKFRE 558


>gi|187929635|ref|YP_001900122.1| NAD synthetase [Ralstonia pickettii 12J]
 gi|309781599|ref|ZP_07676333.1| phenylalanyl-tRNA synthetase, beta subunit [Ralstonia sp.
           5_7_47FAA]
 gi|187726525|gb|ACD27690.1| NAD+ synthetase [Ralstonia pickettii 12J]
 gi|308919574|gb|EFP65237.1| phenylalanyl-tRNA synthetase, beta subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 545

 Score =  493 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 226/564 (40%), Positives = 323/564 (57%), Gaps = 30/564 (5%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            + +A+AQ+N  VGD AGN A+   A  EA++ G  ++L  EL ++GYPPEDL+ + +FI
Sbjct: 2   TVSVALAQINCTVGDFAGNAARIVAAAREAHQAGARILLTPELSLTGYPPEDLLLRPAFI 61

Query: 64  QACSSAIDTL-KSDTHDGGAGIVVGFPRQDQE--------GVLNSVVILDAGNIIAVRDK 114
            A + A+D L        G  +++G P+   E           NS  +   G ++   DK
Sbjct: 62  DASARALDALIAELAAFPGLHVLIGHPQLSLEAPAPGVLPKPTNSATVALDGRVVGRYDK 121

Query: 115 INLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSL 174
           + LPN   F EKR F  G           R G++ICED W  +    + K  GA+ +   
Sbjct: 122 LELPNNEVFDEKRYFQPGTEPFVFEVDGTRFGVIICEDAW-YATATAYAKAAGAQVVLIP 180

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           NASPY+ +K   R  I+  ++    LP +Y N VGGQDEL+FDG SF  D +  +  +M 
Sbjct: 181 NASPYHLDKEDLRERIIGARVKESGLPHVYANLVGGQDELVFDGGSFVLDAEGNVVLRMG 240

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHK 294
            F E     ++   + L                PL  E   Y A  L +RDY+ KN F  
Sbjct: 241 QFVEGVGYVQFDGGRAL--------PGTIVPEPPL--EAQVYEALKLGVRDYLGKNGFPG 290

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
            IIGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA   A  LG +YD + 
Sbjct: 291 AIIGLSGGVDSALVLAIAVDALGADRVRAVMMPSRYTADISWVDARDMAARLGVQYDEIA 350

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I  + + F   +++  +  P     ENIQ+RIRG +LMALSN S  ++LTT NKSEI+VG
Sbjct: 351 ISPMFDAFKGALAEEFRGLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSEIAVG 410

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
           Y TLYGDM+GGF  +KD++KT V++L  +RNS         L+EVIP  IL ++PSAELR
Sbjct: 411 YCTLYGDMAGGFAVIKDIFKTLVYRLCRYRNS---------LSEVIPERILTRAPSAELR 461

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAP 533
            +QTDQ+SLP Y  LD I++R +E  +   +     + +  V+ +  L+  +EYKRRQAP
Sbjct: 462 ENQTDQDSLPEYDALDAIVQRYMEQNQPVADIIAAGFAEADVQKIVRLIKINEYKRRQAP 521

Query: 534 VGTKITAKSFGRDRLYPISNKFRD 557
           VG ++T ++FGRD  YPI+++F++
Sbjct: 522 VGIRVTPRAFGRDWRYPITSRFKE 545


>gi|294629011|ref|ZP_06707571.1| glutamine-dependent NAD(+) synthetase [Streptomyces sp. e14]
 gi|292832344|gb|EFF90693.1| glutamine-dependent NAD(+) synthetase [Streptomyces sp. e14]
          Length = 591

 Score =  493 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 211/592 (35%), Positives = 306/592 (51%), Gaps = 44/592 (7%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
            +L++A+ Q++  VGD+A N     R    +  QG  L+ F E+ ++GYP EDL  + SF
Sbjct: 9   PQLRLALNQIDSRVGDLAANAESILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSF 68

Query: 63  IQACSSAIDTLKSDTHDGGAG---IVVGFPRQDQ----------EGVLNSVVILDAGNII 109
           + A  +A+  L +     G G   +VVG+  + +              N+  +L  G ++
Sbjct: 69  VTASRTALRELAARLAGEGLGELPVVVGYLDRSESAQPKYGMPAGAPRNAAAVLHRGEVV 128

Query: 110 AVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAE 169
               K +LPNY  F E R F+ G +   +    + + + ICED+W++       +   A 
Sbjct: 129 LTFAKHHLPNYGVFDEFRYFVPGDTMPVLRVHGVDVALAICEDLWQDGGRVPAARTARAG 188

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            L S+NASPY   K   R E+V  +         Y+   GGQDEL+FDG S       ++
Sbjct: 189 LLLSVNASPYEREKDDTRLELVRKRAQEAGCTTAYLAMTGGQDELVFDGDSIVVGADGEV 248

Query: 230 AFQMKHFSEQNFMTEWHY------------DQQLSQWNYMSDDSASTMYIP--------- 268
             +   F E   + +               D  L     +  +     Y P         
Sbjct: 249 IARAAQFEETCVVLDLELPAAAADAPSGVVDDGLRVDRVVLSEEPLPAYEPVPAAGCGER 308

Query: 269 LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPY 328
           L ++E  Y A V  LR YV KN F  V+IGLSGGIDSAL AAIA DA+G ENV  + +P 
Sbjct: 309 LDDDEEVYTALVTGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDAVGPENVYGVSMPS 368

Query: 329 KYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRG 388
           KY+S  S +DAA  A+  G  +  +PI  + + +   +        +G+  EN+QSR+RG
Sbjct: 369 KYSSEHSKDDAAELARRTGLNFRTVPIVPMFDAYMDSLG------LTGLAEENLQSRLRG 422

Query: 389 NILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG 448
            +LMALSN    ++L   NKSE++VGY TLYGD  G + P+KD+YKT VF+LA WRN   
Sbjct: 423 TLLMALSNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSVFRLAKWRNRAA 482

Query: 449 ITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-D 507
              G  P    IP + + K PSAELRP Q D +SLP YP+LD I++  V+ ++       
Sbjct: 483 AERGQTP---PIPENSISKPPSAELRPGQVDTDSLPDYPVLDAILELYVDRDKGADEIVA 539

Query: 508 QEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
             Y+ E V     ++  +EYKRRQ P GTKI+ K FG+DR  PI+N +R+H+
Sbjct: 540 AGYDPELVARTLRMVDTAEYKRRQYPPGTKISPKGFGKDRRLPITNGWREHL 591


>gi|82703650|ref|YP_413216.1| NAD+ synthetase [Nitrosospira multiformis ATCC 25196]
 gi|82411715|gb|ABB75824.1| NAD+ synthetase [Nitrosospira multiformis ATCC 25196]
          Length = 538

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 224/560 (40%), Positives = 320/560 (57%), Gaps = 29/560 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+AIAQ+N  VGD+ GN  K      +A   G  L++  EL +SGYPPEDL+ +  F  
Sbjct: 1   MKLAIAQINCTVGDLGGNTRKILDYANQAKNAGARLVVTPELALSGYPPEDLLLRHGFRH 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC +A+  L      G   +VVG P    + + N+  ++  G IIA   K  LPN S F 
Sbjct: 61  ACQNALTELAG--KTGDITVVVGHPHLAADKLYNAASVIRNGKIIATYLKNLLPNDSVFD 118

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E+R F  G+         IR  I IC+DIW+  +  +  K+ GAE L  LNASPY+ NK 
Sbjct: 119 ERRYFEPGFRPCVFELDGIRFAINICQDIWQEGSATRA-KEGGAEVLLVLNASPYHMNKQ 177

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R+++   +I    L I+Y N +GGQDELIFDGASF  + +  +  Q     E   M E
Sbjct: 178 ALRYDLARKRIDETGLSIVYANLIGGQDELIFDGASFAMNARGDVTHQFDALVEALGMVE 237

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEA-DYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
                             +T   PL+  EA  Y A  L ++DY+ KN    V++GLSGG+
Sbjct: 238 LE-----------GAAPVTTEIAPLESLEANVYKALCLGVKDYIGKNRIPGVLLGLSGGV 286

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IA DALG + V+ +M+P ++T+  SL DA   A+ LG +Y   PI  +   F 
Sbjct: 287 DSALTMTIAADALGADKVKAVMMPSRFTADMSLLDARTMAQTLGVRYTEFPIEPVFGEFK 346

Query: 364 SLMSQFLQ----EEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             +++        +   +  EN+Q+RIRG +LMALSN S A++L T NKSE +VGY TLY
Sbjct: 347 DTLAKEFAALPPSDVPDLTEENLQARIRGTLLMALSNKSGAIVLITGNKSETAVGYSTLY 406

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GD +GGF  LKD+ KT V++L  +RN          + +VIP  +L ++PSAELRP QTD
Sbjct: 407 GDTAGGFAVLKDVTKTMVYKLCQYRN---------GVGKVIPDRVLSRAPSAELRPDQTD 457

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLPPY +LD I++  VE++ S     +  Y++   R V  L+  +EYKRRQ+P G ++
Sbjct: 458 QDSLPPYAVLDAILEEYVEHDMSLEEILRMGYDERDARRVVQLIRQNEYKRRQSPPGIRV 517

Query: 539 TAKSFGRDRLYPISNKFRDH 558
           T+++FG+D  YPI+ +++D 
Sbjct: 518 TSRAFGKDWRYPITARYQDQ 537


>gi|75906642|ref|YP_320938.1| NAD synthetase [Anabaena variabilis ATCC 29413]
 gi|75700367|gb|ABA20043.1| NH(3)-dependent NAD(+) synthetase [Anabaena variabilis ATCC 29413]
          Length = 566

 Score =  492 bits (1267), Expect = e-137,   Method: Composition-based stats.
 Identities = 219/569 (38%), Positives = 319/569 (56%), Gaps = 34/569 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQ+NP++GD+ GN  K     ++A ++G  L+L  EL + GYPP DL+    F++
Sbjct: 1   MKIAIAQINPIIGDLTGNAQKILEMAQQAIKKGARLLLTPELSLCGYPPRDLLLNPIFVE 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQD-------QEGVLNSVVILDAGNIIAVRDKINL 117
           A S  +  L  D       ++VG    +        + + NS  +L+ G +  +  K  L
Sbjct: 61  AMSVTLQQLARDLP-VNLAVLVGTVELNCQAHTTGGKPLFNSTALLENGKVKQMFHKRLL 119

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNIC----------KHLKKQG 167
           P Y  F E R F +G   +     +I +G+ ICED+W +                L   G
Sbjct: 120 PTYDVFDEHRYFEAGQQANYFALDNINIGVTICEDLWNDEEFWGKRSYTANPISDLAILG 179

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
            + + +L+ASPY   K   R  ++         P+IY NQVGG D+LIFDG SF  + Q 
Sbjct: 180 VDLIVNLSASPYSLGKQSFREAMLRHSAVRFQQPVIYANQVGGNDDLIFDGRSFALNRQG 239

Query: 228 QLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYV 287
           ++  + K F+      ++   Q+  Q + ++        I   E+E  + A VL +RDY 
Sbjct: 240 EVMCRAKGFASDLITVDFDESQRDLQLSSVAP-------IYESEDEEIWQALVLGVRDYA 292

Query: 288 QKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALG 347
           QK  F +V++GLSGGIDSAL A IA +ALGKENV  +++P  Y+S  S+ DA A A  LG
Sbjct: 293 QKCRFSQVVLGLSGGIDSALVATIATEALGKENVFGVLMPSPYSSEHSISDALALADNLG 352

Query: 348 CKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSN 407
            K  +LPI DL+  F   + +       G+  ENIQSRIRGN+LMA++N    +LL+T N
Sbjct: 353 IKTQILPIGDLMQSFDHSLVELFAGTEFGLAEENIQSRIRGNLLMAIANKFGYLLLSTGN 412

Query: 408 KSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEK 467
           KSE++VGY TLYGDM+GG   + D+ KT+V+ L  W NSH         + VIP +IL K
Sbjct: 413 KSEMAVGYCTLYGDMNGGLAVIADVPKTRVYSLCKWLNSHQ--------SPVIPENILTK 464

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSE 526
           +PSAEL+P Q DQ+SLPPY ILDDI++R++ N +S        ++   V  V  ++  +E
Sbjct: 465 APSAELKPGQVDQDSLPPYEILDDILQRLIHNHQSVGEIVAAGHDPMVVDKVIQMVARAE 524

Query: 527 YKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           +KRRQAP G KIT ++FG     PI++ +
Sbjct: 525 FKRRQAPPGLKITDRAFGTGWRMPIASNW 553


>gi|326386431|ref|ZP_08208054.1| NAD synthetase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209092|gb|EGD59886.1| NAD synthetase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 555

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 257/560 (45%), Positives = 336/560 (60%), Gaps = 11/560 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  KL I +AQLN  VGD+A N    R+    A     DLI+F E+ + GYPPEDL+ K 
Sbjct: 1   MADKLIITLAQLNQNVGDLAANAESVRKV--RAAAMHSDLIVFPEMHLIGYPPEDLIQKP 58

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           + I+  +  +  L   T DGG  ++VG        + N V +L+ G I AVR K  LPNY
Sbjct: 59  ALIERAAHEMQELAKLTADGGPALLVGSVFVRDGALHNGVALLEGGRIAAVRFKYELPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F+ G   +P++F+   LG+ ICEDIW      +HL + GAE    +N SPY 
Sbjct: 119 GTFDEKRYFLPGPLPEPVLFKGAMLGLPICEDIWHPDVC-RHLAQLGAEIFICVNGSPYE 177

Query: 181 HNKLKKRHEIVTGQIS-HVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
            +K   R + V  + +    +P+ Y+N+VGGQDE++FDGASF    +  L  Q   + E 
Sbjct: 178 IDKDVLRIDGVAKRRAIDTGIPLAYLNRVGGQDEIVFDGASFVVGPEGALWIQAPDWEEA 237

Query: 240 NFMTEWHYDQ--QLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
              TEW+  +     +W   + D       P    E  Y A VL+LRDYV KN F  V++
Sbjct: 238 VIHTEWNRVKVGNGHRWRCQAGDVHEPTEHP----EDIYCAMVLALRDYVNKNRFPGVVL 293

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSA+ AAIAVDALG E V  +MLP +YTS +SL+DA  CA+ LG + D +PI  
Sbjct: 294 GLSGGIDSAITAAIAVDALGPERVWCVMLPSRYTSQESLDDAEGCARMLGVRLDTIPIEP 353

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
            V+ F  +++    +    +  EN+QSRIRG  LMALSN    MLLTT NKSE+SVGY T
Sbjct: 354 AVDGFAEMLAPVFADRKPDLTEENLQSRIRGTTLMALSNKFGPMLLTTGNKSEMSVGYAT 413

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           +YGDM+GG+NPLKD YKT VF ++ WRN      GLGP   V+P  IL K PSAELRP Q
Sbjct: 414 IYGDMNGGYNPLKDAYKTTVFAISEWRNRARPKIGLGPDGPVMPERILTKPPSAELRPDQ 473

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            D +SLP YP+LD I+  +VE E S        Y+  TV  +E LL+ +EYKRRQAP G 
Sbjct: 474 KDSDSLPDYPVLDAILMDLVEQERSVDQIVAEGYDRATVERIERLLHIAEYKRRQAPPGV 533

Query: 537 KITAKSFGRDRLYPISNKFR 556
           K+  ++FGRDR YPI++ FR
Sbjct: 534 KLGMRNFGRDRRYPITHAFR 553


>gi|86139281|ref|ZP_01057851.1| NAD(+) synthase [Roseobacter sp. MED193]
 gi|85824125|gb|EAQ44330.1| NAD(+) synthase [Roseobacter sp. MED193]
          Length = 552

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 244/558 (43%), Positives = 340/558 (60%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQ+NP VGD+AGN AKAR A  E      DL+   E+F++GY  +DLV K 
Sbjct: 1   MADRFRVTLAQMNPTVGDLAGNAAKARTAWAEGRAASADLVALPEMFLTGYNTQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F QA  +A + L  D  D G  + +G P  +   + N+ +IL  G I +   K +LPN 
Sbjct: 61  VFQQAAMAAAEQLALDCAD-GPALAIGCPWAEGGKLYNAYLILKDGKIASRCLKHHLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F +G    P    D R+G  ICED W      + L++ GAEFL   N SPYY
Sbjct: 120 TVFDEVRIFDAGPLGGPYAVGDTRIGSPICEDGWHEDV-AETLEETGAEFLLIPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK++ R   +  +     LP+IY+N VGGQD+ +FDG +F  +    LA QM  F E  
Sbjct: 179 RNKMEVRQNHMVARAVETGLPVIYLNLVGGQDDQVFDGGTFVLNPNGALALQMPVFDEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T+    +    W  +  D A    +     E DY   V SLRDY+ K  F K ++GLS
Sbjct: 238 -VTQLDLHRTPEGWRAVEGDKAHLPDV----WEQDYRTMVESLRDYMGKTGFKKALLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSA+ AAIAVDA+G ENV+ +MLP +YTS +SL+DA A A+ALG  YD +PI +  +
Sbjct: 293 GGVDSAIVAAIAVDAIGAENVRCVMLPSEYTSRESLDDAEAVAEALGVHYDYVPIAEGRD 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++         +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITNTLAPLFNGREEDLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVI P++++K PSAELR  Q D 
Sbjct: 413 DMNGGYNPIKDLYKTRVFETCRWRNANHRPWMMGPAGEVIRPNVIDKPPSAELRDDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP LD I++ +V+ E S  +   + +  ETV+ VEHL+Y SEYKR Q+  G +++
Sbjct: 473 DSLPDYPELDAILEILVDQEGSVADCVAKGFARETVKRVEHLIYISEYKRFQSAPGARLS 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N+FRD
Sbjct: 533 PRAFWLDRRYPIVNRFRD 550


>gi|126461777|ref|YP_001042891.1| NAD synthetase [Rhodobacter sphaeroides ATCC 17029]
 gi|126103441|gb|ABN76119.1| NH(3)-dependent NAD(+) synthetase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 554

 Score =  492 bits (1266), Expect = e-137,   Method: Composition-based stats.
 Identities = 246/558 (44%), Positives = 349/558 (62%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M ++ ++ +AQLNP VGD+AGN A ARRA +EA   G D++  TE+F++GY  +DLV ++
Sbjct: 1   MTERFRLTLAQLNPTVGDLAGNAALARRAWDEARAAGSDMLALTEMFVTGYQTQDLVMRR 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++   + I+ L +D  + G  I +G P  +   ++N+  +L+ G + A   K +LPN 
Sbjct: 61  AFVEEAMATIERLAADCAE-GPAIGIGGPCLEDGRLMNAYWVLEGGRVSARVFKHHLPNA 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F SG  + P     +R+GI ICED W      + L + GAE L   N SPY+
Sbjct: 120 EVFDEKRVFASGEVHGPCRVGPLRIGIPICEDSWHPDVC-ETLAETGAEILLVPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R  ++  ++    LP++Y+N VGGQD+ +FDGASF  +   +L  Q+  F E  
Sbjct: 179 REKLDVRVNLMVTRVVETGLPLVYLNMVGGQDDQVFDGASFVLNPHGRLMAQLPAFEEAL 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              ++  +     W  +     +         EADY+A VLSLRDY+ K+ F +V++GLS
Sbjct: 239 VHVDF--EATDEGWRALPAPIVAQP----DLWEADYHAMVLSLRDYLGKSGFSRVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL AAIA DALG E V+ +MLP ++TS  SLEDAAA A+ALGC+ D + I     
Sbjct: 293 GGIDSALVAAIAADALGPEAVRCVMLPSRFTSQASLEDAAAVARALGCRLDEVGIGGPQE 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + +    +    G+  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AVGAALGPLFEGTEPGVTEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYCTIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VFQ+  WRN H      GP  EVIPP +++K PSAELR  Q D+
Sbjct: 413 DMNGGYNPIKDLYKTRVFQMCRWRNGHHCPWMKGPEGEVIPPRVIDKPPSAELREDQKDE 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY  LD I++ +V+ EES      + +  ETV  +E L+ GSE+KR Q+  GT++T
Sbjct: 473 DSLPPYATLDAILEGLVDREESVAELVARGFERETVARIERLILGSEWKRFQSAPGTRLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YP+ N++RD
Sbjct: 533 RRAFWLDRRYPMVNRWRD 550


>gi|134098194|ref|YP_001103855.1| glutamine-dependent NAD(+) synthetase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|291009113|ref|ZP_06567086.1| glutamine-dependent NAD(+) synthetase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|133910817|emb|CAM00930.1| glutamine-dependent NAD(+) synthetase [Saccharopolyspora erythraea
           NRRL 2338]
          Length = 610

 Score =  491 bits (1265), Expect = e-137,   Method: Composition-based stats.
 Identities = 229/599 (38%), Positives = 324/599 (54%), Gaps = 52/599 (8%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L+IA+AQ+N  VGDIAGN +       EA +QG  L+ F E  ++GYP EDL  +KS
Sbjct: 18  MPQLRIALAQVNASVGDIAGNSSMVLDWTREAVQQGAHLVAFPETVLAGYPVEDLALRKS 77

Query: 62  FIQACSSAIDTLKSDTHDGGAG---IVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLP 118
           F  A  + +++L       G G   +VVG   +D EGV NS  +L  G ++A  DK +LP
Sbjct: 78  FAAANRAEVESLAQRLQQAGCGDALVVVGHLDRDDEGVRNSASLLYDGRVVATYDKHHLP 137

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           NY  F E R F  G+    +    + +G++ICEDIW+N      L + G + +  +N+SP
Sbjct: 138 NYGVFDEARYFAPGFDLPIVRLHGLDVGVVICEDIWQNGGPVSALGEVGVDLVVCINSSP 197

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K  +R  +V G+ +    P+ YVN VGGQDEL+FDG S       Q+  +   F+E
Sbjct: 198 YERAKDDQRTPLVAGRAAEAGAPMAYVNMVGGQDELVFDGDSMVVGTDGQVLARAPQFTE 257

Query: 239 QNFMTEWHYD---------------------------------------QQLSQWNYMSD 259
              + +                                            Q         
Sbjct: 258 HLLVLDMDLTAGGHTATTVPEPEVPAEGGMQFVPASRFLRPAFDITRTVLQADPLPGYEP 317

Query: 260 DSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKE 319
             A  +  PL +E   + A V  LRDYVQKN F  V  G SGGIDSA+CAA+  DA+G +
Sbjct: 318 LPAQPLPEPLSDEAEVWAALVTGLRDYVQKNGFRSVTFGFSGGIDSAVCAALCADAIGAD 377

Query: 320 NVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVA 379
           ++  + +P  Y+S  S  DAA  A+ LGC +DV PI D+V+ F S +      E SG+  
Sbjct: 378 SLYGVSMPSHYSSEHSRSDAADLARRLGCHFDVQPIGDMVDVFVSRL------ELSGLAE 431

Query: 380 ENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQ 439
           EN+Q+R RG  LMALSN    ++L   NK+E++VGY T+YGD  GGF P+KD+ KT V++
Sbjct: 432 ENVQARCRGVTLMALSNQHGHLVLAPGNKTELAVGYSTIYGDAVGGFAPIKDVPKTLVWK 491

Query: 440 LASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVEN 499
           LA WRN+     G  P    IP + + K PSAELRP Q D +SLPPY ILD ++   VE 
Sbjct: 492 LAQWRNAEAEKRGEVP---PIPENSISKPPSAELRPDQVDTDSLPPYEILDVVLDGYVEG 548

Query: 500 EESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           +  + +   + ++   V  +  L+  +EYKRRQ P GTKIT K+FGRDR  P++N++R+
Sbjct: 549 DRGYADLVGEGFDAALVERIIQLVDRAEYKRRQYPPGTKITLKAFGRDRRLPVTNRWRE 607


>gi|21243946|ref|NP_643528.1| NAD synthetase [Xanthomonas axonopodis pv. citri str. 306]
 gi|21109556|gb|AAM38064.1| NH3-dependent NAD synthetase [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 546

 Score =  491 bits (1265), Expect = e-137,   Method: Composition-based stats.
 Identities = 222/560 (39%), Positives = 315/560 (56%), Gaps = 20/560 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFK 59
           M + L+IA+AQ +  VG +A N  +       A  +   D++LF EL ISGYPPEDL+ +
Sbjct: 1   MSQTLRIAMAQFDFPVGGVAQNTDRIIEYIAAARDEFEADIVLFPELAISGYPPEDLLLR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
             F+  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   K  LPN
Sbjct: 61  PGFLAHCEQALARIAAATR--GIVAVVGWPQSAGSVVYNAASVLRDGRIEATYRKRELPN 118

Query: 120 YSEFHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           Y+ F E+R F       N  +  + +R+G++ICED+W    +     + GAE +   NAS
Sbjct: 119 YAVFDERRYFDVDPDGENCVVTVKGVRVGVVICEDLWFAEPLANT-VRAGAELVLVPNAS 177

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      F 
Sbjct: 178 PYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAAFV 237

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           +Q  + ++   ++        DD   +M      +   + A V  L+DY +KN F KV +
Sbjct: 238 DQWLVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYCRKNGFSKVWL 291

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSAL  A+AVDALG +NV  + LP +YT+  S + A    +ALG K + + I  
Sbjct: 292 GLSGGIDSALVLAMAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALGVKLETIAIEP 351

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
                   +    +     I  EN+QSR RG ILMALSN    ++LTT NKSE +VGY T
Sbjct: 352 AFEGLLGALGPMFEGTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEYAVGYAT 411

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           +YGDM GG+ PLKDLYKT+VF LA WRN+ G          VIPP+++ + PSAELR +Q
Sbjct: 412 IYGDMCGGYAPLKDLYKTEVFGLAKWRNTVGG-------APVIPPAVISRPPSAELRDNQ 464

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           TDQ+SLPPY +LD I+ R V+ E+S  +     Y  +TV +V  L+  +E+KR Q+  G 
Sbjct: 465 TDQDSLPPYDVLDGILYRYVDQEQSRDDIVAAGYAADTVEHVLRLVRLNEWKRHQSAPGP 524

Query: 537 KITAKSFGRDRLYPISNKFR 556
           K++ ++FGR+R YPI+N +R
Sbjct: 525 KVSRRAFGRERRYPITNGYR 544


>gi|254785219|ref|YP_003072647.1| glutamine-dependent NAD+ synthetase [Teredinibacter turnerae T7901]
 gi|237686319|gb|ACR13583.1| glutamine-dependent NAD+ synthetase [Teredinibacter turnerae T7901]
          Length = 542

 Score =  491 bits (1265), Expect = e-136,   Method: Composition-based stats.
 Identities = 221/556 (39%), Positives = 324/556 (58%), Gaps = 20/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEA-NRQGMDLILFTELFISGYPPEDLVFKK 60
           +  L IA+AQ+NP+VGDI GN  K  R  ++    Q  D+++F EL ++GYPPEDL+ + 
Sbjct: 1   MTTLNIAMAQINPLVGDIDGNAKKILRVAQQLEREQHADIVVFPELTLTGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S  +    A++ L   +    + +V+G+P+     + N   ++  G +I    K  LPNY
Sbjct: 61  SCDRRVERALNWLCDQS--LASYVVIGYPKTIAGRMYNMAGVICGGRVICEYAKQALPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G  +     + + +G+ ICEDIW    I +   K GA+ L +LN SP+ 
Sbjct: 119 QVFDEKRYFSEGQESVTFDCKGVPVGLTICEDIWDGGPILRARAK-GADLLLNLNGSPFD 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R  +V  + S + +P++YVNQVGGQDEL+FDG SFC +   ++      F E +
Sbjct: 178 AEKHAERERLVAARASEIGIPVVYVNQVGGQDELVFDGGSFCANPGGEILRMAPMFREHS 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +  ++  +            ++   +        Y+A VL ++DYV KN F  V++GLS
Sbjct: 238 AVVAFNAQEGTLA------PVSNLQTLDDDPLAVTYDALVLGVKDYVNKNGFKGVVLGLS 291

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALG + V  +M+P++YTS  S  DA   A+ LG  Y  + I  + +
Sbjct: 292 GGIDSALTLAIAVDALGADRVNAVMMPFRYTSDMSKTDAEEEARRLGVSYQSISIEPMYD 351

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + ++            ENIQ+R RG +LMA+SN    ++LTT NKSE++VGY TLYG
Sbjct: 352 AFSAQLAGAFANTQRDTTEENIQARSRGVLLMAISNKLGYLVLTTGNKSEMAVGYATLYG 411

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG + LKD+ KT VF L+ +RN+         ++ VIP S++ + PSAEL P Q D+
Sbjct: 412 DMAGGLDVLKDVPKTLVFALSRYRNT---------VSAVIPESVITRPPSAELAPDQKDE 462

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I+   VE + S     +  YN + V  V  L+  +EYKRRQAPVG +I+
Sbjct: 463 DSLPPYEILDAILAMYVEQDLSAEAIIEAGYNRDDVMRVIRLIDINEYKRRQAPVGIRIS 522

Query: 540 AKSFGRDRLYPISNKF 555
           A++FGRDR YPI+N +
Sbjct: 523 ARAFGRDRRYPITNGW 538


>gi|294625816|ref|ZP_06704433.1| NAD + synthase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292599891|gb|EFF44011.1| NAD + synthase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
          Length = 546

 Score =  491 bits (1265), Expect = e-136,   Method: Composition-based stats.
 Identities = 221/560 (39%), Positives = 313/560 (55%), Gaps = 20/560 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFK 59
           M + L+IA+AQ +  VG +  N  +       A  +   D++LF EL ISGYPPEDL+ +
Sbjct: 1   MSQTLRIAMAQFDFPVGGVTQNTDRIIEYIAAARDEFEADIVLFPELAISGYPPEDLLLR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
             F+  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   K  LPN
Sbjct: 61  PGFLAHCEQALARIAAAT--HGIVAVVGWPQSAGSVVYNAASVLRDGRIEATYRKRELPN 118

Query: 120 YSEFHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           Y+ F E+R F       N  +  + +R+G++ICED+W    +     + GAE +   NAS
Sbjct: 119 YAVFDERRYFDVDPDGENCVVTVKGVRVGVVICEDLWFAEPLANT-VRAGAELVLVPNAS 177

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      F 
Sbjct: 178 PYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAAFV 237

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           +Q  + ++   ++        DD   +M      +   + A V  L+DY  KN F KV +
Sbjct: 238 DQWLVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYCHKNGFSKVWL 291

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSAL  A+AVDALG +NV  + LP +YT+  S + A    +ALG K + + I  
Sbjct: 292 GLSGGIDSALVLAMAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALGVKLETIAIEP 351

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
                   +    +     I  EN+QSR RG ILMALSN    ++LTT NKSE +VGY T
Sbjct: 352 AFEGLLGALGPMFEGTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEYAVGYAT 411

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           +YGDM GG+ PLKDLYKT+VF LA WRN+ G          VIPP+++ + PSAELR +Q
Sbjct: 412 IYGDMCGGYAPLKDLYKTEVFGLAKWRNTVGG-------APVIPPAVISRPPSAELRDNQ 464

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           TDQ+SLPPY +LD I+ R V+ E+S  +     Y  +TV +V  L+  +E+KR Q+  G 
Sbjct: 465 TDQDSLPPYDVLDGILYRYVDQEQSRDDIVAAGYAADTVEHVLRLVRLNEWKRHQSAPGP 524

Query: 537 KITAKSFGRDRLYPISNKFR 556
           K++ ++FGR+R YPI+N +R
Sbjct: 525 KVSRRAFGRERRYPITNGYR 544


>gi|332868347|ref|ZP_08438106.1| NAD+ synthase [Acinetobacter baumannii 6013113]
 gi|332733453|gb|EGJ64632.1| NAD+ synthase [Acinetobacter baumannii 6013113]
          Length = 541

 Score =  491 bits (1265), Expect = e-136,   Method: Composition-based stats.
 Identities = 225/556 (40%), Positives = 321/556 (57%), Gaps = 21/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  K+A+AQ +P +G+I  N  K      +A +Q  DLI+F EL + GYP EDL+ + +
Sbjct: 1   MKSFKVALAQFSPHIGNIDSNTQKMIEQANQAKKQDADLIIFHELSVIGYPAEDLLLRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQ-DQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L          +V GF  Q +     NS  ++  G ++ V +K NLPNY
Sbjct: 61  LNKRMQKAFAQLSEV---KDIVMVFGFVNQTEDGQRYNSAAVMKDGQVLGVFNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICEDIW + N  K L +   + +  LN+SPY 
Sbjct: 118 GVFDEKRYFQKGHQHLVFEYLGHKFGVLICEDIW-SINTVKQLSQLNVDTVLVLNSSPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + ++     +HL I+YVNQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRKQTLSELAKQLHLNIVYVNQVGGQDDLIFDGTSFVSNQNGEIALQAPSFKEDL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           ++ E+  D +L +    +          L+     Y   V++ RDYV+++ F  VI+GLS
Sbjct: 237 YIAEFDRDTKLYKVVESAPA--------LETFAEIYQGLVMATRDYVERSGFPGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDA+G E VQ +M+PY YTS  S+EDAA  A+ +G  + +  IH +VN
Sbjct: 289 GGIDSALTLAIAVDAIGAERVQAVMMPYTYTSQISVEDAAEQARRMGVTFGIAEIHSIVN 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSE+SVGY TLYG
Sbjct: 349 SFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSELSVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF  LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q DQ
Sbjct: 409 DMVGGFAVLKDVYKTIVFELAKYRNSLS-------ETPVIPERVITRPPSAELRPDQKDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LD I+   +E +    +   + ++ E V  V  L+  +EYKRRQ  +G +IT
Sbjct: 462 DSLPAYDVLDAILYAYIEEDLGQADIIAKGFDKEVVEKVIRLVDRNEYKRRQGAIGPRIT 521

Query: 540 AKSFGRDRLYPISNKF 555
           +++F R+R YPI N +
Sbjct: 522 SRAFSRERRYPIVNGW 537


>gi|262375848|ref|ZP_06069080.1| glutamine-dependent NAD+ synthetase [Acinetobacter lwoffii SH145]
 gi|262309451|gb|EEY90582.1| glutamine-dependent NAD+ synthetase [Acinetobacter lwoffii SH145]
          Length = 541

 Score =  491 bits (1265), Expect = e-136,   Method: Composition-based stats.
 Identities = 224/557 (40%), Positives = 323/557 (57%), Gaps = 21/557 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  KIAIAQ +P VG++  N  K      +A +   DLI+F EL   GYP EDL+ + S
Sbjct: 1   MKSFKIAIAQFSPHVGNLDANTQKMIDLANQAKKDKADLIIFPELSTLGYPAEDLLIRPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQ-DQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            ++   +A + L   T      +V GF  Q +     NS  ++  G ++ V +K  LPNY
Sbjct: 61  LVKRTKAAFEKL---TEVKDIVMVFGFVNQTEDGQRYNSAAVMKDGEVLGVYNKQVLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICED+W +    + L K   +    LNASPY 
Sbjct: 118 GVFDEKRYFGEGHQHLVFEYLGHKFGVLICEDVW-SLATVQQLAKLNIDTALVLNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R E +   +  +++ ++Y NQVGGQD+LIFDG SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRIETMAALVKQLNINLVYCNQVGGQDDLIFDGTSFVLNKSGEVALQAPTFQENL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + E++ +Q           S   +   L      Y + V++ RDYVQ++ F  VI+GLS
Sbjct: 237 TIAEFNAEQ--------LQFSKGAIAPALDTMAEIYQSLVMATRDYVQRSGFPGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALG + VQ +M+PY YT+  S+EDAAA AK +G  + +  I+ +V+
Sbjct: 289 GGIDSALTLAIAVDALGADKVQAVMMPYTYTAQISVEDAAAQAKNMGVTFGIAEINPVVS 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F  ++  F    P     EN+Q+R RG +LMALSN    ++L T NKSE++VGY TLYG
Sbjct: 349 GFMQVLFPFFGNAPVDATEENLQARSRGTLLMALSNKFGNLVLATGNKSELAVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GG+  LKD+YKT VF+LA +RNS          T VIP  ++ + PSAELRP Q DQ
Sbjct: 409 DMVGGYAVLKDVYKTIVFELAKYRNSIS-------ETPVIPERVITRPPSAELRPDQVDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFINND-QEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y ILD I+   +E + S  +   + ++ E V+ V  L+  +EYKRRQ  +G +I+
Sbjct: 462 DSLPAYDILDAILYSYIEEDMSQDDIITKGFDAEVVKKVIRLVDINEYKRRQGAIGPRIS 521

Query: 540 AKSFGRDRLYPISNKFR 556
           ++S+GR+R YPI N ++
Sbjct: 522 SRSYGRERRYPIVNGWK 538


>gi|254490943|ref|ZP_05104125.1| NAD synthase family [Methylophaga thiooxidans DMS010]
 gi|224463852|gb|EEF80119.1| NAD synthase family [Methylophaga thiooxydans DMS010]
          Length = 546

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 231/557 (41%), Positives = 332/557 (59%), Gaps = 21/557 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKK 60
           +  + + + Q+NPVVGD+AGN+ K   +  +A  Q G DL++F EL ++GYPPEDL+ + 
Sbjct: 1   MNDVTLVMGQINPVVGDVAGNVVKIITSAHQARDQFGADLVVFPELTLTGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPR-QDQEGVLNSVVILDAGNIIAVRDKINLPN 119
             ++  + A+DTL+      G  I++G P  + ++ + N+  ++  GN +A   K  LPN
Sbjct: 61  GLLKRVNKALDTLQKHVE--GVAIIIGHPDGEVRKELYNAASMIVDGNRVATYFKHKLPN 118

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           YS F EKR F+ G     + F+ IR G+ +CEDIW            GAE L +LNASPY
Sbjct: 119 YSVFDEKRYFVEGKEACVVDFKGIRFGLTLCEDIWFTEP-ACQAADAGAEILINLNASPY 177

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
              K + R   V  ++    LP++YVNQVGGQDEL+FDG SF  D + +   +   F   
Sbjct: 178 RMGKWQLREAEVKKRVLETGLPVVYVNQVGGQDELVFDGCSFALDHRGEKVARAPAFESG 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
                  Y   +++           M I   E    Y A    LRDY++KN+F  V+IGL
Sbjct: 238 L------YPLTVNRSENGIVQIHGQMAIKENEHAMIYKALTTGLRDYIEKNHFPGVVIGL 291

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  A+AVDA+G E V  +M+P +YT+  SL+DA A A  LG  Y V+ I  + 
Sbjct: 292 SGGIDSALTLALAVDAIGAEKVHAVMMPTRYTAQISLDDAKAMADGLGVHYSVMSIEPVF 351

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F + +S      P     ENIQ+R RG ILMALSN + +M+L T NKSE++VGY TLY
Sbjct: 352 ESFLTTLSDQFTGLPVDTTEENIQARCRGIILMALSNKTGSMVLATGNKSEMAVGYSTLY 411

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GG++PLKD+YKT V+QL+ +RN+  +         VIP  I+ + PSAEL   Q D
Sbjct: 412 GDMAGGYSPLKDVYKTMVYQLSHYRNTRSM---------VIPERIITRPPSAELAADQLD 462

Query: 480 QESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLPPY +LD I++R + ++  F +   + Y+ E V  V  ++  +EYKRRQAP G +I
Sbjct: 463 QDSLPPYELLDKILERYIADDSCFEDLVAEGYDAEVVARVIKMVDRNEYKRRQAPPGIRI 522

Query: 539 TAKSFGRDRLYPISNKF 555
           ++++FGRDR YPI++ +
Sbjct: 523 SSRAFGRDRRYPITSGY 539


>gi|77462885|ref|YP_352389.1| NAD synthetase [Rhodobacter sphaeroides 2.4.1]
 gi|77387303|gb|ABA78488.1| NH(3)-dependent NAD(+) synthetase [Rhodobacter sphaeroides 2.4.1]
          Length = 554

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 246/558 (44%), Positives = 348/558 (62%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M ++ ++ +AQLNP VGD+AGN A ARRA +EA   G D++  TE+F++GY  +DLV ++
Sbjct: 1   MTERFRLTLAQLNPTVGDLAGNAALARRAWDEARAAGSDMLALTEMFVTGYQTQDLVLRR 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++   + I+ L +D  + G  I +G P  +   ++N+  +L+ G + A   K +LPN 
Sbjct: 61  AFVEEAMATIERLAADCAE-GPAIGIGGPCLEDGRLMNAYWVLEGGRVSARVFKHHLPNA 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F SG  + P     +R+GI ICED W      + L + GAE L   N SPY+
Sbjct: 120 EVFDEKRVFSSGEVHGPCRVGPLRIGIPICEDSWHPDVC-ETLAETGAEILLVPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R  ++  ++    LP++Y+N VGGQD+ +FDGASF  +   +L  Q+  F E  
Sbjct: 179 REKLDVRVNLMVTRVVETGLPLVYLNMVGGQDDQVFDGASFVLNPHGRLMAQLPAFEEAL 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              ++  +     W  +     +         EADY+A VLSLRDY+ K+ F +V++GLS
Sbjct: 239 VHVDF--EAADEGWRALPAPIVAQP----DLWEADYHAMVLSLRDYLGKSGFSRVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL AAIA DALG E V+ +MLP ++TS  SLEDAAA A+ALGC+ D + I     
Sbjct: 293 GGIDSALVAAIAADALGPEAVRCVMLPSRFTSQASLEDAAAVARALGCRLDEVGIGGPQE 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + +    +    GI  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AVGAALGPLFEGTEPGITEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYCTIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VFQ+  WRN H      GP  EVIPP +++K PSAELR  Q D+
Sbjct: 413 DMNGGYNPIKDLYKTRVFQMCRWRNGHHRPWMKGPEGEVIPPRVIDKPPSAELREDQKDE 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY  LD I++ +V+ EE       + +  ETV  +E L+ GSE+KR Q+  GT++T
Sbjct: 473 DSLPPYATLDAILEGLVDREEGVAELVARGFERETVARIERLILGSEWKRFQSAPGTRLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YP+ N++RD
Sbjct: 533 RRAFWLDRRYPMVNRWRD 550


>gi|300783141|ref|YP_003763432.1| NAD+ synthase (glutamine-hydrolysing) [Amycolatopsis mediterranei
           U32]
 gi|299792655|gb|ADJ43030.1| NAD+ synthase (glutamine-hydrolysing) [Amycolatopsis mediterranei
           U32]
          Length = 573

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 220/579 (37%), Positives = 327/579 (56%), Gaps = 32/579 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L+IA+AQ+NP VGD+ GN          A   G  +++F E+ ++GYP EDL  +K+
Sbjct: 1   MPQLRIALAQVNPTVGDLDGNADLHVEWTRRAAEAGAHVVVFPEMSLTGYPIEDLSLRKT 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIV---VGFPRQDQEGVLNSVVILDAGNIIAVRDKINLP 118
           F  A    +++L     + G G V   VG+   D  G  ++   L  G I+A + K +LP
Sbjct: 61  FAAASRQGLESLARRLDEAGCGEVLTYVGYLDLDDVGPRDAAAALYRGEIVARQFKHHLP 120

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           NY  F E R +  G + D + F  + +G++ICED+W++      L + G + + + NASP
Sbjct: 121 NYGVFDEHRWYKPGTTLDVVRFHGLDIGMVICEDLWQDGGPISALGRAGVDLVVAPNASP 180

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y  +K ++R  ++  + +    P++Y NQ+GGQD+L+FDG S        L  +   F E
Sbjct: 181 YERSKDEQRLPLIARRAAEAGAPLVYTNQIGGQDDLVFDGDSLVVGADGTLLARAPQFVE 240

Query: 239 QNFMTEWHYDQQ-----------------LSQWNYMSDDSASTMYI--PLQEEEADYNAC 279
              + +    +                  LS+    + +  +T  I  PL +E   ++A 
Sbjct: 241 HLLVLDMDLPKTGYAGDGSYEGLHVRRHVLSEEPLPAYEPTATPVISEPLSDEAEVWHAL 300

Query: 280 VLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDA 339
           V+ LRDYV KN F  VI G SGGIDSA+CAA+A DALG  NV  + +P KY+S  S +DA
Sbjct: 301 VIGLRDYVHKNGFSSVIFGFSGGIDSAVCAALAADALGGGNVYGVSMPSKYSSGHSKDDA 360

Query: 340 AACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSK 399
           A  A+ +G  Y V P+ D+V  +   +S       +G+  ENIQ+R RG +LMALSN   
Sbjct: 361 ADLAQRIGAHYRVEPVEDMVRVYVDQLS------LTGLAEENIQARTRGMLLMALSNLDG 414

Query: 400 AMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEV 459
            ++L T NK+E++VGY T+YGD  G F P+KD++KT V+QLA WRN      G  P    
Sbjct: 415 HLVLATGNKTELAVGYSTIYGDAVGAFAPIKDVFKTHVWQLARWRNDTAAKRGETP---P 471

Query: 460 IPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYV 518
           IP + + K PSAELRP Q D +SLP Y +LDDI+   VE +  + +     ++ ET+  V
Sbjct: 472 IPENSITKPPSAELRPGQVDTDSLPDYALLDDILDDYVEGDRGYADLVSAGFDPETIDRV 531

Query: 519 EHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
             ++  +EYKRRQ P GTKIT K+FGRDR  P++N +R+
Sbjct: 532 VRMVDKAEYKRRQYPPGTKITFKAFGRDRRLPMTNLWRE 570


>gi|84683380|ref|ZP_01011283.1| glutamine-dependent NAD(+) synthetase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84668123|gb|EAQ14590.1| glutamine-dependent NAD(+) synthetase [Rhodobacterales bacterium
           HTCC2654]
          Length = 555

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 249/559 (44%), Positives = 342/559 (61%), Gaps = 8/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    ++ +AQLNPVVGDI GN   AR A   A   G D+++ TE F++GY P+DLV + 
Sbjct: 3   MADTFRLTLAQLNPVVGDIPGNADMARAAWTAAKEAGADMVMLTESFLTGYQPQDLVMRP 62

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F      A + L  D  D G  + +G P  D + + N+  +L+ G +     K  LPN 
Sbjct: 63  AFWSEAMEACEALAKDVAD-GPVMGIGCPYHDGKDLYNAYWVLEGGRVRRRILKQMLPNE 121

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F EKR F      DPI    + LGI ICED W    +C++L  +GAE L   N SPYY
Sbjct: 122 TVFDEKRLFSHAEPQDPIKIGPLTLGIPICEDAWWPDAVCENLADKGAEVLAVPNGSPYY 181

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K++ RH ++  ++    LP+IY+N VGGQD+ +FDGASF  D Q +LAFQ + F E  
Sbjct: 182 RGKVETRHGVMRARVEETGLPLIYLNMVGGQDDQVFDGASFGMDAQGELAFQFREFDE-- 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     ++    W  +  +    +   L   EADY   V SLRDY+ K  F KV++GLS
Sbjct: 240 VIRHVDLEKGDDGWRIVPGE----VVPALPAYEADYRVMVQSLRDYMGKTGFKKVLLGLS 295

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A IA DALG ENV+ +MLP +YTS  SL+DA A A+ LGC YD +PI    +
Sbjct: 296 GGIDSAIVATIAADALGPENVRCVMLPSEYTSQGSLDDAKAVAERLGCHYDFVPIKGPRD 355

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +     +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YG
Sbjct: 356 AVTEALAPLFEGYAPDLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYG 415

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYK +VF+   WRN++     +GP  EVIP SI++K PSAELR  Q D 
Sbjct: 416 DMAGGYNPIKDLYKMRVFETCRWRNANHRDWMMGPAGEVIPVSIIDKPPSAELRDDQKDS 475

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I++ +V+ E S      Q ++ +TV+ VEHL++ SEYKR Q+  G ++T
Sbjct: 476 DSLPPYEVLDAILEGLVDKELSVAELVAQGFDRDTVKKVEHLIFISEYKRFQSAPGARLT 535

Query: 540 AKSFGRDRLYPISNKFRDH 558
            +SF  DR YPI N++RD 
Sbjct: 536 MRSFWLDRRYPIVNRWRDK 554


>gi|75675418|ref|YP_317839.1| NAD synthetase [Nitrobacter winogradskyi Nb-255]
 gi|74420288|gb|ABA04487.1| NH(3)-dependent NAD(+) synthetase [Nitrobacter winogradskyi Nb-255]
          Length = 583

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 275/564 (48%), Positives = 360/564 (63%), Gaps = 14/564 (2%)

Query: 1   ML-KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFK 59
           M     KI + QLNP VGDI GN AKAR AR +A   G  L+   ELFI+GYPPEDLV +
Sbjct: 1   MTETTFKITLGQLNPTVGDIVGNAAKARAARAQAKADGAALVALPELFIAGYPPEDLVLR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
            +F  AC  AI+ L  +T DGG  +++G P  D   + N+  +LD G + A+R K+NLPN
Sbjct: 61  PAFQAACREAIEALARETSDGGPAMLIGTPWVDDGKLYNAYALLDEGRVAALRFKVNLPN 120

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWK-----NSNICKHLKKQGAEFLFSL 174
           Y  F EKR F  G    P+  R +R+G+ ICED W        N+ + L + GAE L   
Sbjct: 121 YGVFDEKRVFARGPVGGPLKIRGVRIGVPICEDTWVEESAEYENVVECLAETGAEILVVP 180

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           N SPY   K   R  I   +++   LP++Y+NQVGGQDEL+FDGASF  +  + LA Q+ 
Sbjct: 181 NGSPYAKGKSDIRLSISVARVTESDLPLVYLNQVGGQDELVFDGASFVLNADRSLAAQLP 240

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHK 294
            F E  F  +W   +    W          +   +  ++ADY ACVL LRDYV+KN F  
Sbjct: 241 FFEESVFTLQWT--RSAEGWRCAG-----PVAPQIDGDKADYAACVLGLRDYVRKNGFPG 293

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
           V++G+SGGIDSALCAAIAVDALG E V+ +MLP+++T+  SL+DAA  A ALG +YDVLP
Sbjct: 294 VLLGVSGGIDSALCAAIAVDALGAEQVRGVMLPFRFTAQVSLDDAARLATALGIRYDVLP 353

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I   VN F  ++S      P  I  EN+QSR RG +LMA+SN   AM++TT NKSE+SVG
Sbjct: 354 IAQAVNGFEEILSGVFAGAPRDITEENLQSRARGTLLMAMSNKLGAMVVTTGNKSEMSVG 413

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
           Y TLYGDM+GGFNP+KD+YKT+V ++AS RN+      LGP  EVIPP  + + P+AELR
Sbjct: 414 YATLYGDMNGGFNPIKDIYKTEVLRMASLRNAWKPDGALGPSGEVIPPGAISRPPTAELR 473

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAP 533
             Q DQ+SLPPY +LD I++R+VE EE         ++ + V  V+ LL  +EYKRRQA 
Sbjct: 474 EGQLDQDSLPPYDLLDAILERLVEREEPLAAIVAEGFDHDVVVRVDRLLNAAEYKRRQAA 533

Query: 534 VGTKITAKSFGRDRLYPISNKFRD 557
            G K+T ++FGRDR YPI+N+FRD
Sbjct: 534 PGVKVTRRNFGRDRRYPITNRFRD 557


>gi|294666976|ref|ZP_06732205.1| NAD + synthase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|292603265|gb|EFF46687.1| NAD + synthase [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 546

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 221/560 (39%), Positives = 314/560 (56%), Gaps = 20/560 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFK 59
           M + L+IA+AQ +  VG +  N  +       A  +   D++LF EL ISGYPPEDL+ +
Sbjct: 1   MSQTLRIAMAQFDFPVGGVTQNTDRIIEYIAAARDEFEADIVLFPELAISGYPPEDLLLR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
             F+  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   K  LPN
Sbjct: 61  PGFLAHCEQALARIAAAT--HGIVAVVGWPQSAGSVVYNAASVLRDGRIEATYRKRELPN 118

Query: 120 YSEFHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           Y+ F E+R F       N  +  + +R+G++ICED+W    +     + GAE +   NAS
Sbjct: 119 YAVFDERRYFDVDPDGENCVVTVKGVRVGVVICEDLWFAEPLANT-VRAGAELVLVPNAS 177

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      F 
Sbjct: 178 PYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAAFV 237

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           +Q  + ++   ++        DD   +M      +   + A V  L+DY +KN F KV +
Sbjct: 238 DQWLVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYCRKNGFSKVWL 291

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSAL  A+AVDALG +NV  + LP +YT+  S + A    +ALG K + + I  
Sbjct: 292 GLSGGIDSALVLAMAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALGVKLETIAIEP 351

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
                   +    +     I  EN+QSR RG ILMALSN    ++LTT NKSE +VGY T
Sbjct: 352 AFEGLLGALGPMFEGTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEYAVGYAT 411

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           +YGDM GG+ PLKDLYKT+VF LA WRN+ G          VIPP+++ + PSAELR +Q
Sbjct: 412 IYGDMCGGYAPLKDLYKTEVFGLAKWRNTVGG-------APVIPPAVISRPPSAELRDNQ 464

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           TDQ+SLPPY +LD I+ R V+ E+S  +     Y  +TV +V  L+  +E+KR Q+  G 
Sbjct: 465 TDQDSLPPYDVLDGILYRYVDQEQSRDDIVAAGYAADTVEHVLRLVRLNEWKRHQSAPGP 524

Query: 537 KITAKSFGRDRLYPISNKFR 556
           K++ ++FGR+R YPI+N +R
Sbjct: 525 KVSRRAFGRERRYPITNGYR 544


>gi|271964118|ref|YP_003338314.1| NAD(+) synthase [Streptosporangium roseum DSM 43021]
 gi|270507293|gb|ACZ85571.1| NAD(+) synthase (glutamine-hydrolyzing) [Streptosporangium roseum
           DSM 43021]
          Length = 597

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 225/598 (37%), Positives = 321/598 (53%), Gaps = 47/598 (7%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           +L+IA+AQ +PVVGD+A N  K       A  +G  L++FTE+F++GYP EDLV + SF+
Sbjct: 6   QLRIALAQTDPVVGDLAANADKLVEWTRRAAGRGAHLVVFTEMFLTGYPVEDLVLRSSFV 65

Query: 64  QACSSAIDTLKSDTHDGG---AGIVVGFPRQDQ---------EGVLNSVVILDAGNIIAV 111
           +A ++A++ L     D G      VVG+  +              L++  +L  G ++  
Sbjct: 66  EASTAAVEALARRLADEGLGEIPAVVGYVDRADLAPRVGQPKGAPLDAAALLHRGRVVTK 125

Query: 112 RDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFL 171
             K +LPNY  F E R F+ G          + + I +CED+W+       + + GA  L
Sbjct: 126 TAKHHLPNYGVFDEYRYFVRGDRLPIFRLHGVDVAIAVCEDLWQEGGPVAVVAEAGAGLL 185

Query: 172 FSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAF 231
              NASPY   K   R  +V+ +       + Y NQVGGQDEL+FDG S       +L  
Sbjct: 186 VVPNASPYEKEKDDVRLALVSRRAREAGCALAYANQVGGQDELVFDGDSIIVSASGELVA 245

Query: 232 QMKHFSEQNFMTEWHYDQ------------------------QLSQWNYMSDDSASTMYI 267
           +   F+E+  +T+    +                        +LS +             
Sbjct: 246 RAAQFAEELLVTDLELPEARFGGLGTFQVDAGDGTVITVERLELSAFPVEPYAPEPPSIA 305

Query: 268 P-LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIML 326
           P L +    Y+A VL++RDYV KN F  VI+GLSGGIDSAL A IA DA+G + V  +M+
Sbjct: 306 PHLDDIAEVYSALVLAVRDYVAKNGFQSVILGLSGGIDSALTATIASDAIGPDRVHVVMM 365

Query: 327 PYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRI 386
           P +Y+S  SLEDA       G    ++PI D+V+ F   +      E SG+ AEN+Q+R+
Sbjct: 366 PSRYSSEHSLEDAWELVNRQGVNARIVPIADIVDSFEKEI------ELSGLAAENLQARV 419

Query: 387 RGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNS 446
           RG ILM LSN    ++LTT NKSE++ GY TLYGD +GGF P+KD+ KT V++L+ WRN+
Sbjct: 420 RGMILMGLSNQHGHLVLTTGNKSELATGYSTLYGDSAGGFAPIKDVLKTLVWKLSRWRNA 479

Query: 447 HGITSGL---GPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEE-S 502
               SG    G     IP + +EK PSAELRP Q D +SLP Y +LD ++   VE +  S
Sbjct: 480 QAGRSGAFLHGFAVPPIPENSIEKEPSAELRPDQRDTDSLPEYDVLDRLLDDYVEKDMGS 539

Query: 503 FINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHIS 560
                  ++   V  +  L+  +EYKRRQ P G KIT K+FGRDR  PI+N +R+ I+
Sbjct: 540 AELIAAGHDPALVARIIRLVDLAEYKRRQYPPGPKITPKNFGRDRRLPITNHWRETIA 597


>gi|166713131|ref|ZP_02244338.1| NAD synthetase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 546

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 225/560 (40%), Positives = 313/560 (55%), Gaps = 20/560 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFK 59
           M + L+IA+AQ +  VG +  N  +       A  +   D++LF EL ISGYPPEDL+ +
Sbjct: 1   MSQTLRIAMAQFDFPVGGVTQNTDRIIEYIAAARDEFEADIVLFPELAISGYPPEDLLLR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
             F+  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   K  LPN
Sbjct: 61  PGFLAHCEQALARIAAATR--GIVAVVGWPQSAGSVVYNAASVLRDGRIAATYRKRELPN 118

Query: 120 YSEFHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           Y+ F E+R F       N  +  + +++G++ICED+W    +     K GAE +   NAS
Sbjct: 119 YAVFDERRYFDVDPDGENCVVTVKGVQVGVVICEDLWFPEPLANT-VKAGAEVVLVPNAS 177

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      F 
Sbjct: 178 PYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGSVHPAAAAFV 237

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           +Q  + ++    +        DD   +M      +   + A V  L+DY +KN F KV +
Sbjct: 238 DQWLVVDYAAQARRFTPVVWVDDGDESM------DALAWRAVVRGLQDYCRKNGFGKVWL 291

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSAL  A+AVDALG +NV  + LP +YT+  S + AA    ALG K + + I  
Sbjct: 292 GLSGGIDSALVLAMAVDALGSDNVTAVRLPSRYTAGLSNDLAAEQCDALGVKLETVAIEP 351

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
                 + +          I  EN+QSR RG ILMALSN    +LLTT NKSE +VGY T
Sbjct: 352 AFEGLLAALGPLFAGTEPDITEENLQSRSRGVILMALSNKFGGLLLTTGNKSEYAVGYAT 411

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           +YGDM GG+ PLKDLYKT+VF LA WRN+ G          VIPP+++ + PSAELR +Q
Sbjct: 412 IYGDMCGGYAPLKDLYKTEVFGLAKWRNTVGG-------APVIPPAVISRPPSAELRDNQ 464

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           TDQ+SLPPY +LD I+ R V+ E+S  +     Y  ETV +V  L+  +E+KR QA  G 
Sbjct: 465 TDQDSLPPYDVLDGILYRYVDQEQSRDDIVAAGYAAETVEHVLRLVRLNEWKRHQAAPGP 524

Query: 537 KITAKSFGRDRLYPISNKFR 556
           K++ ++FGR+R YPI+N +R
Sbjct: 525 KVSRRAFGRERRYPITNGYR 544


>gi|332557776|ref|ZP_08412098.1| NAD synthetase [Rhodobacter sphaeroides WS8N]
 gi|332275488|gb|EGJ20803.1| NAD synthetase [Rhodobacter sphaeroides WS8N]
          Length = 554

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 248/558 (44%), Positives = 348/558 (62%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M ++ ++ +AQLNP VGD+AGN A ARRA +EA   G D++  TE+F++GY  +DLV ++
Sbjct: 1   MTERFRLTLAQLNPTVGDLAGNAALARRAWDEARAAGSDMLALTEMFVTGYQTQDLVMRR 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++   + I+ L +D  + G  I +G P  +   ++N   +LD G + A   K +LPN 
Sbjct: 61  AFVEEAMATIERLAADCAE-GPAIGIGGPCLEGGRLMNVYWVLDGGRVSARVFKHHLPNA 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F SG  + P     +R+GI ICED W      + L + GAE L   N SPY+
Sbjct: 120 EVFDEKRVFSSGEVHGPCRVGPLRIGIPICEDSWHADVC-ETLAETGAEILLVPNGSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R  ++  ++    LP++Y+N VGGQD+ +FDGASF  +   +L  Q+  F E  
Sbjct: 179 REKLDVRVNLMVTRVVETGLPLVYLNMVGGQDDQVFDGASFVLNPHGRLMAQLPAFEEAL 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              ++  +     W  +     +         EADY+A VLSLRDY+ K+ F +V++GLS
Sbjct: 239 VHVDF--EAADEGWRALPAPIVAQP----DLWEADYHAMVLSLRDYLGKSGFSRVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL AAIA DALG E V+ +MLP ++TS  SLEDAAA A+ALGC+ D + I     
Sbjct: 293 GGIDSALVAAIAADALGPEAVRCVMLPSRFTSRASLEDAAAVARALGCRLDEVGIGGPQE 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + +    +    GI  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AVGAALGPLFEGTEPGITEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYCTIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VFQ+  WRN H      GP  EVIPP +++K PSAELR  Q D+
Sbjct: 413 DMNGGYNPIKDLYKTRVFQMCRWRNGHHRPWMKGPEGEVIPPRVIDKPPSAELREDQKDE 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY  LD I++ +V+ EES      + +  ETV  +E L+ GSE+KR Q+  GT++T
Sbjct: 473 DSLPPYATLDAILEGLVDREESVAELVARGFERETVARIERLILGSEWKRFQSAPGTRLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YP+ N++RD
Sbjct: 533 RRAFWLDRRYPMVNRWRD 550


>gi|325922862|ref|ZP_08184586.1| DNA-directed RNA polymerase, subunit H [Xanthomonas gardneri ATCC
           19865]
 gi|325546655|gb|EGD17785.1| DNA-directed RNA polymerase, subunit H [Xanthomonas gardneri ATCC
           19865]
          Length = 546

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 220/560 (39%), Positives = 317/560 (56%), Gaps = 20/560 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFK 59
           M + L+IA+AQ +  VG +A N  +       A  + G D++LF EL ISGYPPEDL+ +
Sbjct: 1   MSQTLRIAMAQFDFPVGAVARNTDRIIEFIAAARDEFGADIVLFPELAISGYPPEDLLLR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
             F+  C  A+  + ++T   G   VVG+P+     V N+  +L  G+I A   K  LPN
Sbjct: 61  PGFLAHCEEALARIAANTR--GIVAVVGWPQSAGSVVYNAASVLRDGSIAATYRKRELPN 118

Query: 120 YSEFHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           Y+ F E+R F       N  +  + +++G++ICED+W    +     + GAE +   NAS
Sbjct: 119 YAVFDERRYFDVDPDGDNCVVTVKGVQVGVVICEDLWFAEPLA-GTVQAGAELVLVPNAS 177

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   D    +      F 
Sbjct: 178 PYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADADGTVHPAAAAFV 237

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           +Q  + ++   ++        DD   +M      +   + A V  L+DY +KN F KV +
Sbjct: 238 DQWLVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYCRKNGFTKVWL 291

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSAL  A+AVDALG +NV  + LP +YT+  S + A    +ALG K + + I  
Sbjct: 292 GLSGGIDSALVLAMAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALGVKLETIAIEP 351

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
                 + +    +     +  EN+QSR RG ILMALSN    +LLTT NKSE +VGY T
Sbjct: 352 AFEGLLAALGPLFEGTQPDVTEENLQSRSRGVILMALSNKFGGLLLTTGNKSEYAVGYAT 411

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           +YGDM GG+ PLKDLYKT+VF LA WRN+ G          VIPP+++ + PSAELR +Q
Sbjct: 412 IYGDMCGGYAPLKDLYKTEVFGLAKWRNTVGG-------APVIPPAVISRPPSAELRDNQ 464

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           TDQ+SLPPY +LD I+ R V+ E+S  +     Y  +TV +V  L+  +E+KR Q+  G 
Sbjct: 465 TDQDSLPPYDVLDGILYRYVDQEQSRDDIVAAGYAADTVEHVLRLVRLNEWKRHQSAPGP 524

Query: 537 KITAKSFGRDRLYPISNKFR 556
           K++ ++FGR+R YPI+N + 
Sbjct: 525 KVSRRAFGRERRYPITNGYS 544


>gi|302878486|ref|YP_003847050.1| NAD+ synthetase [Gallionella capsiferriformans ES-2]
 gi|302581275|gb|ADL55286.1| NAD+ synthetase [Gallionella capsiferriformans ES-2]
          Length = 534

 Score =  490 bits (1262), Expect = e-136,   Method: Composition-based stats.
 Identities = 230/555 (41%), Positives = 321/555 (57%), Gaps = 23/555 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+AIAQ+N V+GD+AGN AK   A + A + G  L+L  EL + GYPPEDL+ +  F +
Sbjct: 1   MKLAIAQINCVLGDLAGNSAKILHAAQRACQAGAQLMLTPELSLCGYPPEDLLLRNGFYK 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           +C++++  L  +  D    ++VG P +      N+  +L  G + A   K  LPNY+ F 
Sbjct: 61  SCAASLSELARNISD--IAVIVGHPHEQDGKRYNAASLLRDGRVEATYFKHFLPNYAVFD 118

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E+R F  G +        +  G+ ICED+W  S   +   + GA+ L  LNASPY   KL
Sbjct: 119 EERYFSCGNAPMVFEMSGVHFGVNICEDVW-GSEAARVAAQAGADVLLVLNASPYSVEKL 177

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             RHE+V  +++   + ++Y N VGGQDEL+FDG SF  D   +L  Q   F E      
Sbjct: 178 ASRHEVVRQRVAETDMAVVYANMVGGQDELVFDGGSFAMDRSGRLIAQSAIFEETLSYVS 237

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
                           S     +P+Q E A Y A VL LRDYV KN F  V++GLSGGID
Sbjct: 238 LD---------AHGVPSGEIAVLPMQ-EAAVYQAMVLGLRDYVGKNRFPGVLLGLSGGID 287

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL  A+AVDALG + V  +M+P  YT+  SL+D+    + LG +YD   I  ++  + S
Sbjct: 288 SALTLAVAVDALGADRVHAVMMPSPYTAQISLDDSREMIRILGVRYDEFSIEPVMESYLS 347

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
           ++       P     EN+Q+RIRGN+LMALSN   A++LTT NKSE+SVGY TLYGDM+G
Sbjct: 348 VLRASFAGRPEDTTEENLQARIRGNLLMALSNKLGALVLTTGNKSEMSVGYATLYGDMAG 407

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF+ LKD+ K  V++LA +RN+ G          VIP  I+ ++PSAELR  QTDQ++LP
Sbjct: 408 GFSVLKDVGKLLVYRLARYRNTQGQ---------VIPERIITRAPSAELRHDQTDQDNLP 458

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY +LD I+   VE   S        Y +  VR V  L+  SEYKRRQ+  G +IT + +
Sbjct: 459 PYEVLDGIMACYVEKNLSIPEVIAAGYQEADVRRVVRLIQSSEYKRRQSATGVRITERGY 518

Query: 544 GRDRLYPISNKFRDH 558
           G+D  YPI+ +++D 
Sbjct: 519 GKDWRYPITVRYQDQ 533


>gi|254482845|ref|ZP_05096082.1| NAD synthase family protein [marine gamma proteobacterium HTCC2148]
 gi|214036926|gb|EEB77596.1| NAD synthase family protein [marine gamma proteobacterium HTCC2148]
          Length = 543

 Score =  490 bits (1262), Expect = e-136,   Method: Composition-based stats.
 Identities = 218/557 (39%), Positives = 326/557 (58%), Gaps = 19/557 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMD-LILFTELFISGYPPEDLVFKK 60
           +  L I +AQ+N +VGD  GN  +     + A       +++F EL +SGYPPEDL+ + 
Sbjct: 1   MASLNILMAQMNTLVGDFDGNTKRVIEIVQSAIDTHEQPVVVFPELTLSGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S       +++ L S   +  A +V+G+P+++   + N+  ++  G ++A   K  LPNY
Sbjct: 61  SIELRVDQSLELLCSQLPEA-AWVVIGYPKREGGELYNAAGVIHDGKLVAEYRKQCLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F+ G +   +  + +++ + ICEDIW+         + GAE L +LN+SPY+
Sbjct: 120 QVFDEKRYFVPGSAPCVLNIQGVQVALSICEDIWEKHPTA-DAAEAGAEILLNLNSSPYH 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R E+V  +      PI+YVNQVGGQDEL+FDG SF       +A     F E  
Sbjct: 179 RGKRGERWEMVAERARQAAFPIVYVNQVGGQDELVFDGGSFAVTADGTVAAAAPSFEEGE 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           +   +  +      N     S   +  P+ E  A + A V+ +RDYV KN F  V++GLS
Sbjct: 239 YWLHYDNE------NKNQPFSGQAVNAPMNEMAATWQALVMGVRDYVNKNGFKGVVLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  A+AV+ALG E V+ IM+P++YTS  S++DAA  +K  G  + V+ I ++  
Sbjct: 293 GGIDSALTLAVAVEALGPERVEAIMMPFRYTSQMSVDDAAEQSKTQGVTHTVISIENIYA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + + +           EN+Q+R RG +LM++SN    ++LTT NKSE++VGY TLYG
Sbjct: 353 SFMASLEEEFAGTTPDTTEENLQARCRGVLLMSISNKKGVLVLTTGNKSEMAVGYSTLYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+L  +RN+         L   IP  ++++ PSAEL P Q D+
Sbjct: 413 DMAGGFDVLKDVPKTLVFELCRYRNT---------LGPCIPQRVIDRPPSAELAPDQKDE 463

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I++  VE + S     D  ++ E V+ V  L+  +EYKRRQAP+G +IT
Sbjct: 464 DSLPPYDILDQILEMYVERDMSAEAIIDHGFDREQVQRVLRLVDINEYKRRQAPIGVRIT 523

Query: 540 AKSFGRDRLYPISNKFR 556
            + FGRDR YPI++ +R
Sbjct: 524 RRGFGRDRRYPITSGWR 540


>gi|269794840|ref|YP_003314295.1| NAD+ synthetase [Sanguibacter keddieii DSM 10542]
 gi|269097025|gb|ACZ21461.1| NAD+ synthetase [Sanguibacter keddieii DSM 10542]
          Length = 553

 Score =  490 bits (1262), Expect = e-136,   Method: Composition-based stats.
 Identities = 209/567 (36%), Positives = 312/567 (55%), Gaps = 28/567 (4%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  ++IA+AQ++  VGD+  N          A  +G  ++ F E+ I+GYP EDL  + S
Sbjct: 1   MVDIRIALAQIDTCVGDVDTNSRTILEWSRRAAAEGAQVVAFPEMTITGYPIEDLALRAS 60

Query: 62  FIQACSSAIDTLKSDTHD---GGAGIV---VGFPRQD----QEGVLNSVVILDAGNIIAV 111
           F +A  +A+ T+         G   +V   VG P+           N  ++L  G + A 
Sbjct: 61  FQRAARAAVQTIADQLVADGLGDLTVVLGTVGAPQVTRTSPGTRPTNQALVLQGGAVTAS 120

Query: 112 RDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFL 171
            DK +LPNY  F E R F  G     +  +  R+G+++CEDIW++      L  Q  + L
Sbjct: 121 YDKHHLPNYGVFDEFRIFAPGAEPCVLEIQGRRVGLVVCEDIWQDGGPVAELAAQEVDLL 180

Query: 172 FSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAF 231
             LN SP+   K   R ++   +   +  P+ YVN VGGQD+L+FDG SF       +  
Sbjct: 181 LVLNGSPFEEGKGHSRTDLAVRRARELRAPVAYVNMVGGQDDLVFDGGSFVVGEDGSVLT 240

Query: 232 QMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNN 291
               F E   + +   D +         +    +  PL  +E  Y A V  +R YV+KN 
Sbjct: 241 SAPQFVEHLLVWDLAADGE--------PEHRGPIAPPLDPDEEVYQAIVTGVRGYVRKNG 292

Query: 292 FHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYD 351
           F  V++GLSGGIDSAL AAI  DA+G +NV  + +P  Y+S  S +DA   AK +G  Y 
Sbjct: 293 FRSVVLGLSGGIDSALVAAICADAIGGDNVYGVSMPSTYSSEHSKDDALDLAKRIGAHYR 352

Query: 352 VLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEI 411
           V PI  +V+ F   +      +   + AEN+Q+R+RG ILM LSN    ++L T NKSE+
Sbjct: 353 VQPIAPMVDAFQGEL------DLQDVAAENLQARVRGMILMGLSNSEGHLVLATGNKSEL 406

Query: 412 SVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSA 471
           +VGY T+YGD  GGF P+KD+ K+QV+ L+ WRN+  + +G  P    IP S + K PSA
Sbjct: 407 AVGYSTIYGDAVGGFAPIKDVDKSQVWALSRWRNNVALDAGQIP---PIPESSITKPPSA 463

Query: 472 ELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRR 530
           ELRP Q DQ+SLPPY +LD+++   +E+ E       + +++E V  V  L+  +E+KRR
Sbjct: 464 ELRPGQVDQDSLPPYDLLDEVLDAYIEHAEGRAELLARGFDEEVVDKVVSLVDRAEWKRR 523

Query: 531 QAPVGTKITAKSFGRDRLYPISNKFRD 557
           Q P+G K+TA +FGRDR  P+++++R+
Sbjct: 524 QYPLGPKVTALAFGRDRRLPVTSRWRE 550


>gi|149377768|ref|ZP_01895501.1| NAD synthase [Marinobacter algicola DG893]
 gi|149357940|gb|EDM46429.1| NAD synthase [Marinobacter algicola DG893]
          Length = 550

 Score =  490 bits (1262), Expect = e-136,   Method: Composition-based stats.
 Identities = 225/555 (40%), Positives = 328/555 (59%), Gaps = 21/555 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQG-MDLILFTELFISGYPPEDLVFKKSF 62
           KL++ +AQL+ +VGDI GN  K   A   A ++   DL++F EL ++GYPPEDL+ + S 
Sbjct: 12  KLRVVMAQLDFLVGDIPGNTQKVIEATRRAEQEHQADLVVFPELCLTGYPPEDLLLRPSM 71

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
               + A++TL+ +    G  I+VG P ++   + N+ V ++ GNI     K   PNY  
Sbjct: 72  DVRVADALETLRGE--HLGPAIIVGAPIREGALLYNAAVAIEQGNITGRYFKRFPPNYQV 129

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F +G     +  + + +GI ICEDIW +    +     GA  + +LNASPY  +
Sbjct: 130 FDEKRYFANGVDTLVMDIKGVPVGITICEDIW-SEGPVEDAAAAGARLVVNLNASPYDID 188

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K  +R  +V  +     + I+YVN +GGQDEL+FDG S  +D    LA +   FSE  + 
Sbjct: 189 KQVRRKALVERKAFENRVSIVYVNLIGGQDELVFDGGSVVYDHSGVLAAEAPQFSEGLYP 248

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
            ++  +       +               EE  Y A VL +RDYV KN F  V++GLSGG
Sbjct: 249 VDFVCE-------HHCQPIPQPAIAEPSLEENVYKALVLGVRDYVNKNGFKSVVLGLSGG 301

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSA+  AIA DALG + V+ +M+P++YTS  S+EDA A A ALG +YDV  I  + + F
Sbjct: 302 IDSAVTLAIAADALGADRVRAVMMPFRYTSGMSIEDAEAEAVALGVQYDVFSIEPMYDAF 361

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
              ++   +        EN+Q+R+RG +LM+LSN   +++LTT NKSE++VGY TLYGDM
Sbjct: 362 METLAAPFEGTKPDTTEENLQARLRGVLLMSLSNKFGSLVLTTGNKSEMAVGYSTLYGDM 421

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF+ LKD+ KT VF+LA +RNS         +++VIP  ++ + PSAEL P Q D++S
Sbjct: 422 AGGFDVLKDVPKTLVFRLAWYRNS---------VSQVIPERVITRPPSAELAPDQKDEDS 472

Query: 483 LPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LP Y +LD I+   VE + S      Q ++   V  V  L+  +EYKRRQAP+G +IT +
Sbjct: 473 LPGYDVLDQILNLYVERDLSADAIVAQGFDRADVDRVVRLVDINEYKRRQAPIGVRITER 532

Query: 542 SFGRDRLYPISNKFR 556
            FG+DR YPI+N ++
Sbjct: 533 GFGKDRRYPITNGWK 547


>gi|221632485|ref|YP_002521706.1| glutamine-dependent NAD(+) synthetase [Thermomicrobium roseum DSM
           5159]
 gi|221157196|gb|ACM06323.1| glutamine-dependent NAD(+) synthetase [Thermomicrobium roseum DSM
           5159]
          Length = 586

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 221/592 (37%), Positives = 313/592 (52%), Gaps = 47/592 (7%)

Query: 1   MLK-KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFK 59
           M +   +IA+AQ++P VGD +GN+   R    EA + G  ++ F EL I+GYPPEDL+ K
Sbjct: 5   MTRDTWRIALAQIDPTVGDFSGNVRLIRERAREAAQLGAHIVAFPELVITGYPPEDLLLK 64

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
            SFI A   A+  L     D    ++VG P  +   + N   IL  G I+AV  K +LP 
Sbjct: 65  VSFIDAARRALHLLLDAIPDR--VLIVGVPWVESGILYNGAAILARGEIVAVVPKHHLPT 122

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           Y  F E R F  G      ++ ++R G+ ICEDIW        L  +G + L ++N SPY
Sbjct: 123 YGVFDEDRYFARGSHTFRFLWGNLRFGVTICEDIWYPIGPASSLATRGIDLLVNINGSPY 182

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           +  K  +R  ++  + +     + YVN VGGQDEL+FDG S   D    +  +   F E 
Sbjct: 183 HRGKWIQRQVMLQTRAADAGCYLAYVNMVGGQDELVFDGNSIVLDPNGTILARGTSFEED 242

Query: 240 NFMTEWHYDQQLSQWNYMSDDSA---------------------------------STMY 266
             + +    + LS W +                                           
Sbjct: 243 LIVVDLPITRVLSSWLHDPRRRWLARAESQPALPVVDREIPLPVPGEQLPPLPESVQRPR 302

Query: 267 IPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIML 326
            PL+     Y A V  +RDYV+K  F   +IGLSGGIDS+L A IA DALG ENV  + +
Sbjct: 303 TPLEGVAEVYQALVTGVRDYVRKTGFRTAVIGLSGGIDSSLTACIAADALGPENVTGLSM 362

Query: 327 PYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQ-FLQEEPSGIVAENIQSR 385
           P +Y+S  S+EDA   A+ LG ++ ++PI  +   F  +++    Q E   +  EN+Q+R
Sbjct: 363 PSRYSSRHSIEDAEELARNLGIRFLIVPIEPVHRVFREVLAPLGNQPEEPDVADENLQAR 422

Query: 386 IRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRN 445
           IRG ILM  SN    ++LTT NKSE++ GY TLYGDM+GGF  LKD+ K  V+QLA +RN
Sbjct: 423 IRGTILMTYSNRFGPIVLTTGNKSEMACGYATLYGDMAGGFAVLKDVPKLLVYQLARYRN 482

Query: 446 SHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN 505
           S         ++ VIP  +  K PSAELRP+Q D ++LPP+ ILD +++  VE + S   
Sbjct: 483 S---------ISPVIPERVFVKPPSAELRPNQKDVDTLPPFEILDPLLELYVEQDLSREE 533

Query: 506 -NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
                ++ E V  V  ++  +EYKRRQA  G K+T ++FGRDR  PI+N F 
Sbjct: 534 LIRHGFDPEIVDRVIMMVDRAEYKRRQAAPGVKLTPRAFGRDRRLPIANWFH 585


>gi|152979996|ref|YP_001352840.1| NAD synthetase [Janthinobacterium sp. Marseille]
 gi|151280073|gb|ABR88483.1| NAD+ synthase (glutamine-hydrolysing) [Janthinobacterium sp.
           Marseille]
          Length = 537

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 224/556 (40%), Positives = 317/556 (57%), Gaps = 22/556 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            +K+AIAQ+N  VGD+AGN A+       A  QG D++L  EL + GYPPEDL+ ++SF 
Sbjct: 2   TVKVAIAQINSTVGDLAGNRARIAEFSRRAAEQGADIVLTPELSLVGYPPEDLLLRQSFY 61

Query: 64  QAC-SSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
                + +          G  +VVG P +      N+  +L  G +     K +LPN + 
Sbjct: 62  AKTTETLLALAADLAPLHGLHVVVGHPFEQDGQRYNAASVLLNGKVAGTYCKHDLPNATV 121

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F S         + +R GI ICED W          + GA+ L   N SP++ N
Sbjct: 122 FDEKRYFTSVDEPLVFEVKGVRFGINICEDTWFPHAPA-RAAEAGAQVLLVPNGSPFHMN 180

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K   R +++   ++   + ++Y N VGGQDELIFDG SF  D   ++  Q++H  E   +
Sbjct: 181 KQHLRVDVMHANVTVHGMSLVYANLVGGQDELIFDGNSFVLDQAGEIRAQLQHCVEDLQI 240

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
            E+   Q +            T+   L  E   Y A VL +RDY+ KN F   +IG+SGG
Sbjct: 241 IEFQGGQPVDG----------TIVEELSVEAQVYKALVLGVRDYIGKNGFPGALIGMSGG 290

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           +DSAL  A+AVDALG + V+ IM+P  YT+  S  D+    K +G +YD + I+D    F
Sbjct: 291 VDSALTLAVAVDALGADKVRAIMMPSPYTAEISWVDSRDMVKRVGVRYDEIGINDCFEAF 350

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
              ++   +        ENIQ+RIRG ILMALSN   A++LTT NKSE++VGY TLYGDM
Sbjct: 351 NRTLANEFKGLKQDTTEENIQARIRGTILMALSNKHGAIVLTTGNKSEMAVGYCTLYGDM 410

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF  LKD+ KT V++L ++RN          +++VIP  IL ++PSAELRP QTDQ+S
Sbjct: 411 AGGFAVLKDIAKTLVYRLCAYRN---------IVSDVIPERILTRAPSAELRPDQTDQDS 461

Query: 483 LPPYPILDDIIKRIVENEES-FINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY +LD I++  +E  +S        Y  E V  + HL+  +EYKRRQ+PVG ++T +
Sbjct: 462 LPPYEVLDAIMQMYMEENQSGVEIIAAGYRPEDVARITHLIKINEYKRRQSPVGIRVTHR 521

Query: 542 SFGRDRLYPISNKFRD 557
           +FGRD  YPI++KFR+
Sbjct: 522 AFGRDWRYPITSKFRE 537


>gi|17229977|ref|NP_486525.1| NAD synthetase [Nostoc sp. PCC 7120]
 gi|17131577|dbj|BAB74184.1| NH(3)-dependent NAD(+) synthetase [Nostoc sp. PCC 7120]
          Length = 566

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 218/569 (38%), Positives = 319/569 (56%), Gaps = 34/569 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQ+NP++GD+ GN  K     ++A ++G  L+L  EL + GYPP DL+   SF++
Sbjct: 1   MKIAIAQINPIIGDLTGNAQKILEIAQQAIKKGARLLLTPELSLCGYPPRDLLLNPSFVE 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQD-------QEGVLNSVVILDAGNIIAVRDKINL 117
           A S  +  L  D       ++VG    +        + + NS  +L+ G +  +  K  L
Sbjct: 61  AMSVTLQQLARDLP-VNLAVLVGTVEPNHQAHTTGGKPLFNSTALLENGKVKQMFHKRLL 119

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNIC----------KHLKKQG 167
           P Y  F E R F +G   +     +I +G+ ICED+W +                L   G
Sbjct: 120 PTYDVFDEHRYFEAGQQANYFALDNINIGVTICEDLWNDEEFWGKRSYTANPISDLAILG 179

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
            + + +L+ASPY   K   R  ++         P+IY NQVGG D+LIFDG SF  + Q 
Sbjct: 180 VDLIVNLSASPYSLGKQSFREAMLRHSALRFQQPVIYTNQVGGNDDLIFDGRSFALNRQG 239

Query: 228 QLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYV 287
           ++  + K F+      ++   Q+  Q N ++        +   E+E  ++A VL +RDY 
Sbjct: 240 EVMCRAKGFASDLITVDFDESQRDLQLNSVAP-------VYESEDEEIWHALVLGVRDYA 292

Query: 288 QKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALG 347
           QK  F +V++GLSGGIDSAL A IA  ALGKENV  +++P  Y+S  S+ DA A A  LG
Sbjct: 293 QKCRFSQVVLGLSGGIDSALVATIATAALGKENVFGVLMPSPYSSEHSISDALALADNLG 352

Query: 348 CKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSN 407
            K  +LPI +L+  F   + +       G+  ENIQSRIRGN+LMA++N    +LL+T N
Sbjct: 353 IKTQILPIGELMQSFDQSLVELFAGTEFGLAEENIQSRIRGNLLMAIANKFGYLLLSTGN 412

Query: 408 KSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEK 467
           KSE++VGY TLYGDM+GG   + D+ KT+V+ L +W NSH         + +IP +IL K
Sbjct: 413 KSEMAVGYCTLYGDMNGGLAVIADVPKTRVYSLCNWLNSHQ--------SPIIPENILTK 464

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSE 526
           +PSAEL+P Q DQ+SLPPY ILDDI++R + N +S        +    V  V  ++  +E
Sbjct: 465 APSAELKPGQVDQDSLPPYEILDDILQRFIHNHQSVGEIVAAGHEPVVVDRVIQMVARAE 524

Query: 527 YKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           +KRRQAP G KIT ++FG     PI++ +
Sbjct: 525 FKRRQAPPGLKITDRAFGTGWRMPIASNW 553


>gi|221638758|ref|YP_002525020.1| NAD synthetase [Rhodobacter sphaeroides KD131]
 gi|221159539|gb|ACM00519.1| NH(3)-dependent NAD(+) synthetase [Rhodobacter sphaeroides KD131]
          Length = 564

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 247/558 (44%), Positives = 349/558 (62%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M ++ ++ +AQLNP VGD+AGN A ARRA +EA   G D++  TE+F++GY  +DLV ++
Sbjct: 11  MTERFRLTLAQLNPTVGDLAGNAALARRAWDEARAAGSDMLALTEMFVTGYQTQDLVMRR 70

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++     I+ L +D  + G  I +G P  +   ++N+  +L+ G + A   K +LPN 
Sbjct: 71  AFVEEAMVTIERLAADCAE-GPAIGIGGPCLEDGRLMNAYWVLEGGRVSARVFKHHLPNA 129

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F SG  + P     +R+GI ICED W      + L + GAE L   N SPY+
Sbjct: 130 EVFDEKRVFSSGEVHGPCRVGPLRIGIPICEDSWHADVC-ETLAETGAEILLVPNGSPYH 188

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R  ++  ++    LP++Y+N VGGQD+ +FDGASF  +   +L  Q+  F E  
Sbjct: 189 REKLDVRVNLMVTRVVETGLPLVYLNMVGGQDDQVFDGASFVLNPHGRLMAQLPAFEEAL 248

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              ++  +     W  +     +         EADY+A VLSLRDY++K+ F +V++GLS
Sbjct: 249 VHVDF--EATDEGWRALPAPIVAQP----DLWEADYHAMVLSLRDYLRKSGFSRVLLGLS 302

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL AAIA DALG E V+ +MLP ++TS  SLEDAAA A+ALGC+ D + I     
Sbjct: 303 GGIDSALVAAIAADALGPEAVRCVMLPSRFTSRPSLEDAAAVARALGCRLDEVGIGGPQE 362

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + +    +    GI  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 363 AVGAALGPLFEGTEPGITEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYCTIYG 422

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VFQ+  WRN H      GP  EVIPP +++K PSAELR  Q D+
Sbjct: 423 DMNGGYNPIKDLYKTRVFQMCRWRNGHHRPWMKGPPGEVIPPRVIDKPPSAELREDQKDE 482

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY  LD I++ +V+ EES      + +  ETV  +E L+ GSE+KR Q+  GT++T
Sbjct: 483 DSLPPYATLDAILEGLVDREESVAELVARGFERETVARIERLILGSEWKRFQSAPGTRLT 542

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YP+ N++RD
Sbjct: 543 RRAFWLDRRYPMVNRWRD 560


>gi|299133610|ref|ZP_07026804.1| NAD+ synthetase [Afipia sp. 1NLS2]
 gi|298591446|gb|EFI51647.1| NAD+ synthetase [Afipia sp. 1NLS2]
          Length = 584

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 272/566 (48%), Positives = 364/566 (64%), Gaps = 15/566 (2%)

Query: 1   MLK--KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVF 58
           M +  K  + +AQLNP VGDIAGN AKAR AR +A   G  L++  ELF+ GYPPED+V 
Sbjct: 1   MTESAKFTVTLAQLNPTVGDIAGNAAKARDARAKAAADGAALVVLPELFLCGYPPEDIVL 60

Query: 59  KKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLP 118
           K SF   C  A++ L  +T DG   +++G P  ++  + N+V +LD G I  +R K NLP
Sbjct: 61  KPSFQARCRIAVEELARETSDGSPAVLIGTPWVEEGKLYNAVALLDGGRIAGLRFKANLP 120

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWK-----NSNICKHLKKQGAEFLFS 173
           NY  F EKR F  G +  P+  R +R+G+ ICED W        N+ + L + GAE L  
Sbjct: 121 NYGVFDEKRIFARGPAAGPLTIRGVRIGVPICEDTWMEESAEYENVVECLSETGAEILIV 180

Query: 174 LNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQM 233
            N SPY   K   R  +  G+++   LP +YVNQVGGQDEL+FDGASF  +  + LA Q+
Sbjct: 181 PNGSPYARAKNDIRLSMAVGRVTESGLPFVYVNQVGGQDELVFDGASFALNADRSLAAQL 240

Query: 234 KHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFH 293
             F E    T   + +    W      S        + + ADY ACVL LRDYV KN F 
Sbjct: 241 PCFEE--VTTTLTWTKSAKGWTCKGPISPLI-----EGDRADYAACVLGLRDYVGKNGFP 293

Query: 294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVL 353
            V++G+SGGIDSALC AIAVDA+G E V+ +MLP+++T+ +S+EDAA  A+ LG +YDVL
Sbjct: 294 GVLLGISGGIDSALCLAIAVDAIGVERVRGVMLPFRFTAKESIEDAARIARGLGIRYDVL 353

Query: 354 PIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISV 413
           PI   VN F  ++      +P  +  EN+Q+R RG +LMA+SN    ML+TT NKSE+SV
Sbjct: 354 PIAAAVNGFEDILKDVFNGKPRDVTEENLQARTRGVLLMAISNKFGDMLVTTGNKSEMSV 413

Query: 414 GYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAEL 473
           GY TLYGDM+GGFNP+KD+YKT+VF+L+S RNS      LGP  +VIP SI+ + P+AEL
Sbjct: 414 GYATLYGDMNGGFNPIKDIYKTEVFRLSSLRNSWKPEGALGPSGKVIPVSIIARPPTAEL 473

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENEESFINND-QEYNDETVRYVEHLLYGSEYKRRQA 532
           R +QTDQ+SLPPY ILD I++R+VE + S        ++ +TV  ++ LL  +EYKRRQA
Sbjct: 474 RENQTDQDSLPPYEILDGILERLVERDMSVAEIVGDGFDRDTVLRIDRLLNLAEYKRRQA 533

Query: 533 PVGTKITAKSFGRDRLYPISNKFRDH 558
             G K+T K+FGRDR YPI+N+FRD+
Sbjct: 534 APGVKVTRKNFGRDRRYPITNRFRDN 559


>gi|289548051|ref|YP_003473039.1| NAD+ synthetase [Thermocrinis albus DSM 14484]
 gi|289181668|gb|ADC88912.1| NAD+ synthetase [Thermocrinis albus DSM 14484]
          Length = 565

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 212/575 (36%), Positives = 320/575 (55%), Gaps = 37/575 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           + +A+AQ+NP+VGD   N        ++       L++F EL ISGYPPEDL+ +  F++
Sbjct: 3   INVALAQINPLVGDPENNTQLIMERWQK-VDDKAHLVVFPELSISGYPPEDLLLRWEFVK 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
            C  A++ L   +    +  VVG P  + + + N++VIL  G ++ +  K +LPNYS F 
Sbjct: 62  GCEKALNKLVEFSKSMKSVCVVGTPYWNGD-LYNALVILQGGKVLGIYRKKHLPNYSVFD 120

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F  G     +    + LG  +CEDIW      ++    GA+ L ++NASPY+  K 
Sbjct: 121 EKRYFRGGEEPLLMEIDGVVLGFSVCEDIWHPDGWERYYATAGADILININASPYHMGKY 180

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             +   +  +       ++YVN VGGQDEL+FDG S   D +  +  + K F E   +  
Sbjct: 181 AFKEAFLKARAEDNLCYVVYVNSVGGQDELVFDGRSLVIDPEGNVIARCKAFEEDLKVVS 240

Query: 245 WHYDQQ---------------LSQWNYMSDDSASTMYIP------LQEEEADYNACVLSL 283
               +                + +      D  +  Y+       L+ EE  Y A VLS+
Sbjct: 241 LDVLKGRRRRLVDVRLRERPFVREKPLTHTDGRTLPYVEGTVEHSLEGEEELYRAVVLSI 300

Query: 284 RDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACA 343
           ++YV+KN F KV++GLSGGIDS+L A +AVDALG+E V  + +P  +TS +S +      
Sbjct: 301 KEYVEKNGFRKVVVGLSGGIDSSLVACMAVDALGEERVVGVFMPSVFTSEESRQAVYQLV 360

Query: 344 KALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLL 403
           K L  +    PI  ++N +       +  +   +  EN+QSRIR NIL  LSN    ++L
Sbjct: 361 KNLRIQLLEFPIEGIMNSY----KSMMGWDDITVAEENLQSRIRANILFYLSNRYGYLVL 416

Query: 404 TTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPS 463
           +TSNKSE++ GYGT+YGDM+GGF PLKDLYKT V++LA +RN          + E IP  
Sbjct: 417 STSNKSELATGYGTIYGDMAGGFAPLKDLYKTYVYRLAYYRNR---------VKEDIPSF 467

Query: 464 ILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINND-QEYNDETVRYVEHLL 522
           +L + P+AELRPHQ D+++LPPYP+LD I+   +E   S      + +  E V  V  ++
Sbjct: 468 VLTRPPTAELRPHQKDEDTLPPYPVLDKILFHYIEEGLSVEEIVRRGFERELVCKVVKMI 527

Query: 523 YGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
             +EYKR+Q+P+G K+T+++FG+D   PI+N +RD
Sbjct: 528 KSAEYKRKQSPLGPKLTSRAFGKDWRVPITNGWRD 562


>gi|145595855|ref|YP_001160152.1| NAD+ synthetase [Salinispora tropica CNB-440]
 gi|145305192|gb|ABP55774.1| NH(3)-dependent NAD(+) synthetase [Salinispora tropica CNB-440]
          Length = 598

 Score =  489 bits (1259), Expect = e-136,   Method: Composition-based stats.
 Identities = 220/593 (37%), Positives = 323/593 (54%), Gaps = 46/593 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  L++A+ Q+NP VGD+AGN    R     A   G  LI F EL ++GYP EDLVF++S
Sbjct: 1   MTTLRLALCQVNPNVGDLAGNATIIREWARRAADAGAQLIAFPELTLTGYPVEDLVFRRS 60

Query: 62  FIQACSSAIDTLKSDTHD---GGAGIVVGFPRQD-----------QEGVLNSVVILDAGN 107
           F+ A  +A+D L +D      G   +VVG+   D             G  N+  +L  G 
Sbjct: 61  FVAASKAALDELAADLAADGLGDLAVVVGYLDADGPPQVNGDAEPGHGARNAAALLHGGK 120

Query: 108 IIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG 167
            +A   K +LPNY  F E R F+ G +   +    + + + ICED+W+        ++ G
Sbjct: 121 TVATYFKHHLPNYGVFDEDRYFVPGETLSVVRVGGVDVTLTICEDLWQVGGPFAAARQAG 180

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
              + ++N SPY  NK   R  +V  + +     I YVN VGGQDEL+F+G S     + 
Sbjct: 181 VGLVLNINGSPYELNKDDVRLPLVRRRAAEAKATIAYVNMVGGQDELVFEGDSMIVAAEG 240

Query: 228 QLAFQMKHFSEQNFMTEWHY---------DQQLSQWNYMSDDSAST-------------M 265
           +L  +   F E   + +            D +L+    +      +             +
Sbjct: 241 ELLARAPQFVEHLLVHDLDLPAAADGPPADIELADGMRVLHRCIGSLPAAPTDTLAASEI 300

Query: 266 YIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIM 325
             P  +E   + A +L LRDYV KN+F  V++GLSGGIDS++ AA+AVDALG + V  + 
Sbjct: 301 AEPAADEAEVWQALLLGLRDYVDKNHFPSVVLGLSGGIDSSVVAALAVDALGADRVVGVS 360

Query: 326 LPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSR 385
           LP +++S  S EDAA  AK  G  Y + PI  +V  F + +S       SG+  EN+Q+R
Sbjct: 361 LPSQHSSEHSREDAAELAKRTGLDYRIEPIQPIVETFLANLS------LSGLSVENLQAR 414

Query: 386 IRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRN 445
           +RG ILMALSN    ++LTT NKSE++VGY TLYGD  GGFNP+KD++KT ++QLA WRN
Sbjct: 415 VRGVILMALSNQEGHLVLTTGNKSELAVGYSTLYGDSVGGFNPVKDVWKTLIWQLARWRN 474

Query: 446 SHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN 505
           +  +  G  P    IP + + K PSAEL P Q D ++LP Y +LD I+   ++ +     
Sbjct: 475 AEAVRRGETP---PIPENSISKPPSAELSPGQLDSDTLPEYDLLDPILVGYIDGDLGRDG 531

Query: 506 -NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
             +  ++   V  V  ++  +EYKRRQ+  GTKI+ K+FGRDR  PI+N++R+
Sbjct: 532 LIEAGHDPALVDQVLRMVDTAEYKRRQSAPGTKISMKAFGRDRRLPITNRWRE 584


>gi|192362224|ref|YP_001983661.1| glutamine-dependent NAD+ synthetase signal peptide protein
           [Cellvibrio japonicus Ueda107]
 gi|190688389|gb|ACE86067.1| glutamine-dependent NAD+ synthetase signal peptide protein
           [Cellvibrio japonicus Ueda107]
          Length = 560

 Score =  489 bits (1259), Expect = e-136,   Method: Composition-based stats.
 Identities = 220/557 (39%), Positives = 324/557 (58%), Gaps = 22/557 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQG-MDLILFTELFISGYPPEDLVFKK 60
           + +L++ +AQ+N +VGDI GN AK   +  E   +G +D I++ EL ++GYPPEDL+ + 
Sbjct: 21  MSQLQLVLAQINTLVGDIPGNTAKVLASAREVLERGPVDAIIYPELTLTGYPPEDLLLRP 80

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S       A+D L          +VVG+PR+  + + N   ++ AG ++A   K  LPNY
Sbjct: 81  SLDGRIQRALDELLD--ARLPTTLVVGYPRRRGDKLYNMAGVIQAGKLVAEYAKQCLPNY 138

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F++G              + +CEDIW    + +     GA  + +LNASPY+
Sbjct: 139 QVFDEKRYFVAGDQPCLFDLCGQPTALTVCEDIWHPEPMAQARAA-GARLMLNLNASPYH 197

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K ++R  ++  +     +P++YVN VGGQDEL+FDG S   D Q    +++  +SE N
Sbjct: 198 QGKQQEREAMIAERAREGKMPVVYVNLVGGQDELVFDGGSVVVDAQGTTRYRVPAYSEGN 257

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           +  +               D +  + +P +   A Y   VL L DYV KN F+ V++GLS
Sbjct: 258 YRLQLDLATG-------HCDPSLLVPVP-ERLSAVYQTLVLGLCDYVTKNRFNGVVLGLS 309

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALG + V+ +M+P++YTS  S  DAA  A  LG +Y  + I  +  
Sbjct: 310 GGIDSALTLAIAVDALGADKVEAVMMPFRYTSDLSKNDAADEAARLGVRYGSISIEPMYE 369

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + ++            EN+Q+R RG +LMA+SN    ++LTT NKSE++VGY TLYG
Sbjct: 370 AFMAALADEFAGTRRDTTEENLQARCRGVVLMAISNKKGYLVLTTGNKSEMAVGYSTLYG 429

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+         L EVIP +++ + PSAEL P Q D+
Sbjct: 430 DMAGGFDVLKDVPKTLVFELARYRNT---------LGEVIPETVITRPPSAELAPDQKDE 480

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I+   VE ++S      + +  E V  V  L+  +EYKRRQAP+G +I+
Sbjct: 481 DSLPPYEILDQILALYVEQDQSAEAIIARGFTREQVERVVRLVDINEYKRRQAPIGVRIS 540

Query: 540 AKSFGRDRLYPISNKFR 556
            + FGRDR YPI++ ++
Sbjct: 541 QRGFGRDRRYPITSGWQ 557


>gi|262373253|ref|ZP_06066532.1| NAD synthase [Acinetobacter junii SH205]
 gi|262313278|gb|EEY94363.1| NAD synthase [Acinetobacter junii SH205]
          Length = 541

 Score =  489 bits (1259), Expect = e-136,   Method: Composition-based stats.
 Identities = 225/556 (40%), Positives = 322/556 (57%), Gaps = 21/556 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  KIA+AQ +P +G+I  N  K       A +Q  DLI+F EL   GYP EDL+ + +
Sbjct: 1   MKNFKIALAQFSPHIGNIDANTQKMVEQANLAKQQQADLIIFPELSTIGYPAEDLLIRPN 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-VLNSVVILDAGNIIAVRDKINLPNY 120
             +    A   L          +V GF  Q ++G   NS  ++  G ++ + +K NLPNY
Sbjct: 61  LSKRTQKAFAQLSEV---KDIVMVFGFVHQTEDGYRYNSAAVMKDGQVLGIYNKHNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F  G+ +    +   + G+LICED+W + N  K L +   E    LNASPY 
Sbjct: 118 GVFDEKRYFQEGHQHLIFEYLGHKFGVLICEDVW-SLNTVKQLSQLNVETALVLNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + +      ++L ++YVNQVGGQD+LIFDG+SF  +   ++A Q   F E  
Sbjct: 177 VGKPQHRIQTLNELAKQLNLNLVYVNQVGGQDDLIFDGSSFVTNKNGEIALQAPSFQESI 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           +  E+  +Q+        +   +     L+     Y A V++ RDYVQ++ F  VI+GLS
Sbjct: 237 YFVEYDAEQK--------EFKKTESAPALETFAEIYQALVMATRDYVQRSGFPGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDA+G + VQ +M+PY YTS  S+EDA   A+ +G  + +  IH +VN
Sbjct: 289 GGIDSALTLAIAVDAIGADKVQAVMMPYTYTSQMSVEDATEQARRMGVTFGIAEIHPIVN 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSEISVGY TLYG
Sbjct: 349 SFMQTLYPFFGNTPADATEENLQARTRGTLLMGLSNKFGNLVLSTGNKSEISVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF+ LKD+YKT VF+LA +RN+          T VIP  ++ + PSAELRP QTDQ
Sbjct: 409 DMVGGFSVLKDVYKTIVFELAKYRNTLS-------ETPVIPERVISRPPSAELRPDQTDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LD I+   +E ++S  +   + +  E V  V  L+  +EYKRRQ  +G +I+
Sbjct: 462 DSLPAYDVLDAILYAYIEEDQSQADIIARGFEAEVVEKVIRLVDRNEYKRRQGAIGPRIS 521

Query: 540 AKSFGRDRLYPISNKF 555
           +++F R+R YPI N +
Sbjct: 522 SRAFSRERRYPIVNGW 537


>gi|269127318|ref|YP_003300688.1| NAD+ synthetase [Thermomonospora curvata DSM 43183]
 gi|268312276|gb|ACY98650.1| NAD+ synthetase [Thermomonospora curvata DSM 43183]
          Length = 591

 Score =  489 bits (1258), Expect = e-136,   Method: Composition-based stats.
 Identities = 213/596 (35%), Positives = 306/596 (51%), Gaps = 49/596 (8%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+AQ+NP VGD+ GN          A   G  L+ F E+ ++GYP EDL  + S
Sbjct: 1   MAQLRLALAQVNPTVGDLEGNADLIVEWTRRAAEAGAHLVAFPEMMLTGYPVEDLALRTS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAG---IVVGF----------PRQDQEGVLNSVVILDAGNI 108
           F++A    ++ +     D G G   +V G+          P +     LN++  L  G +
Sbjct: 61  FVEASQRTLEQVARRLADAGLGDLPVVTGYLDRRADAPARPGRPAGAPLNALAWLHRGRV 120

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA 168
                K +LPNY  F E R F+ G     +    I +  +ICED+W++       +  GA
Sbjct: 121 AVRSAKHHLPNYGVFDEFRYFVPGDRLPAVRVAGIDVAAVICEDLWQDGGPVSVTRAAGA 180

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
             L  +N SPY  +K   R E+   +       + YVN VGGQDEL+FDG S       +
Sbjct: 181 GLLLVINGSPYERSKDDVRLELAARRAREAGCTLAYVNMVGGQDELVFDGDSMIVGPDGR 240

Query: 229 LAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSA--------------STMYIP------ 268
           L  +   F+E+  + +    +  S+                       S   +P      
Sbjct: 241 LLARAPRFTEELLVADLQLPEAGSEPLPREQPVRAADGATITVERTVLSPHPVPPYEAVP 300

Query: 269 ------LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQ 322
                 + +    Y A VL +RDYV+KN F  VI GLSGGIDSAL A IA DA+G ENV 
Sbjct: 301 PPVAPPMDDLAEVYAALVLGVRDYVRKNGFRSVICGLSGGIDSALVATIAADAIGAENVH 360

Query: 323 TIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENI 382
            ++LP +Y+S  S+ DA    K  G +   +PI+ +V  F   +        SG+  EN+
Sbjct: 361 VVLLPSRYSSGHSVADAEELVKRQGLQARTVPINPMVEAFERELHP------SGLAEENL 414

Query: 383 QSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLAS 442
           Q+R+R  + MALSN    ++LTT NKSE++ GY TLYGD +GGF P+KD+ KT V+ LA 
Sbjct: 415 QARVRAVVWMALSNQHGHLVLTTGNKSELATGYSTLYGDSAGGFGPIKDVTKTMVWALAR 474

Query: 443 WRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEES 502
           WRN   + +G  P    IP  I++K PSAELRP Q D +SLP Y +LD ++   VE +  
Sbjct: 475 WRNEQAVAAGQVP---PIPQQIIDKPPSAELRPGQLDTDSLPEYHVLDALLDDYVERDMG 531

Query: 503 FIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
                   ++   V  V  L+  +EYKRRQ P G KIT K+FGRDR  PI+N++R+
Sbjct: 532 RDALIAAGHDPALVERVIRLVDRAEYKRRQYPPGPKITGKNFGRDRRLPITNRWRE 587


>gi|255318866|ref|ZP_05360092.1| glutamine-dependent NAD+ synthetase [Acinetobacter radioresistens
           SK82]
 gi|262378876|ref|ZP_06072033.1| glutamine-dependent NAD+ synthetase [Acinetobacter radioresistens
           SH164]
 gi|255304122|gb|EET83313.1| glutamine-dependent NAD+ synthetase [Acinetobacter radioresistens
           SK82]
 gi|262300161|gb|EEY88073.1| glutamine-dependent NAD+ synthetase [Acinetobacter radioresistens
           SH164]
          Length = 541

 Score =  489 bits (1258), Expect = e-136,   Method: Composition-based stats.
 Identities = 221/557 (39%), Positives = 317/557 (56%), Gaps = 21/557 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  KIA+AQ +P  G+   N  K      EA +Q  D+I+F EL   GY  EDL+ + S
Sbjct: 1   MKSFKIALAQFSPHTGNFELNAQKMVEQANEAKKQRADIIVFPELCTVGYSAEDLLLRPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQ-EGVLNSVVILDAGNIIAVRDKINLPNY 120
             +      + L          +V GF  Q +     NS  ++  G ++ V +K NLPNY
Sbjct: 61  LSKRTQKVFEILGQV---KDIVMVFGFVNQAETGQRYNSAAVVKDGQVLGVYNKQNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F EKR F SG       + + +  +LICEDIW + N  + L +  A+ +  LN+SPY 
Sbjct: 118 SVFDEKRYFASGNQQLVFEYMEHKFAVLICEDIW-SINTVQQLTQLKAQTVLVLNSSPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R + +   +  ++  ++YVNQV GQD++IFDG+SF  + Q +L  +   F E  
Sbjct: 177 VGKPQHRIQTMQQLVKQLNFNLVYVNQVCGQDDIIFDGSSFVLNPQGELVTRAPSFQECL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              E+  D+               +   L      Y A V++ RDY+Q++ F  VI+GLS
Sbjct: 237 HYAEYSADKDA--------FIVQEIAPELDTMAEIYQALVMATRDYIQRSGFPGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDA+G + VQ +M+PY YT+  S+EDAAA AK +G  + +  I+ +VN
Sbjct: 289 GGIDSALTLAIAVDAIGADKVQAVMMPYTYTAQISVEDAAAQAKTMGVTFGIAEINPIVN 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +  F    P+    EN+Q+R RG +LMALSN    ++L+T NKSE++VGY TLYG
Sbjct: 349 GFLQTLYPFFGNSPADTTEENLQARARGTLLMALSNKFGNLVLSTGNKSEVAVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF+ LKD+YKT VF+LA +RNS            VIP  ++ + PSAEL P Q DQ
Sbjct: 409 DMVGGFSVLKDVYKTIVFELAKYRNSLS-------EVPVIPERVITRPPSAELSPDQKDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD I+   +E + S  +   + +   TV  V  L+  +EYKRRQ  +G +I+
Sbjct: 462 DSLPPYDILDAILYAYIEEDMSQEDIIAKGFERATVEKVIKLVDRNEYKRRQGAIGPRIS 521

Query: 540 AKSFGRDRLYPISNKFR 556
           +++FGRDR YPI N ++
Sbjct: 522 SRAFGRDRRYPIVNGWK 538


>gi|313903243|ref|ZP_07836636.1| NH(3)-dependent NAD(+) synthetase [Thermaerobacter subterraneus DSM
           13965]
 gi|313466554|gb|EFR62075.1| NH(3)-dependent NAD(+) synthetase [Thermaerobacter subterraneus DSM
           13965]
          Length = 621

 Score =  489 bits (1258), Expect = e-136,   Method: Composition-based stats.
 Identities = 233/614 (37%), Positives = 336/614 (54%), Gaps = 69/614 (11%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            L+IA+AQ+N  VGD+ GN  K  R   +A + G DL++F EL ++GYPPEDLVF+ +F+
Sbjct: 7   PLRIAVAQVNVTVGDLEGNARKLARFAADAAQTGADLVVFPELALTGYPPEDLVFRPAFL 66

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
            A    +  L  +   G   + VGF  +D++ + N+  +L  G I AV  K  LPNY  F
Sbjct: 67  DATRHWLGWLAGELAAGPVAL-VGFVHRDRD-LYNAAAVLQGGQIKAVACKRFLPNYGVF 124

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG-AEFLFSLNASPYYHN 182
            EKR F  G     +  R + LG+ ICED+W      +     G AE L +L+ASPY+  
Sbjct: 125 DEKRYFAPGRRALVLHLRGVALGVSICEDLWYPHGPIREQALAGGAEILLNLSASPYHMG 184

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K ++R  ++  + + + + I+Y N VGGQDEL+FDG S   D   Q+A + + F+E  F 
Sbjct: 185 KPREREGLLITRATDLGVAIVYANLVGGQDELVFDGHSLVVDAGGQVAARGRPFAEDLFF 244

Query: 243 TEWH---------YDQQLSQWNYMSDDSASTMYIPLQE---------------------- 271
            ++          ++ +        +++A   ++ L E                      
Sbjct: 245 WDYDPAAAAVARWHEPRYRHMPVTPEEAAQVEHVDLDEPAAGGGPGGRLPGPVAGPGVAV 304

Query: 272 ---------------------------EEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
                                      E   Y A VL+LRDY +KN F +  +GLSGGID
Sbjct: 305 PGVAGPGTAPEASRPPLPPRQVEVLEGEAEVYAALVLALRDYFEKNGFRRAWLGLSGGID 364

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL A +A DALG   V  + +P  +TS  SL+DA A A+ LG   + +PI ++   F  
Sbjct: 365 SALVACLAADALGPRQVTGVRMPSPFTSAASLDDAEAVARNLGIGLETIPIGEIFGAFRQ 424

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++    + P  +  EN+Q+RIRG +LMAL+N    ++L T NKSE++ GY TLYGDM+G
Sbjct: 425 ALAPLFGDRPFDVAEENLQARIRGTLLMALANKFGGLVLATGNKSELATGYATLYGDMAG 484

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF PLKD+ KT V++LA++RN         P   VIP S+LEK+P+AELRP Q D++SLP
Sbjct: 485 GFAPLKDVPKTLVYRLAAYRNGW-------PGGPVIPRSVLEKAPTAELRPGQKDEDSLP 537

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY +LD I++  VE +        +    E VR   HL+  SEYKRRQA  G KITA++F
Sbjct: 538 PYAVLDPILEAYVERDLPAAALVARGLPAEAVRRTVHLVATSEYKRRQAAPGPKITARAF 597

Query: 544 GRDRLYPISNKFRD 557
           GRDR YPI++ +R+
Sbjct: 598 GRDRRYPITSGYRE 611


>gi|84499552|ref|ZP_00997840.1| NAD(+) synthase [Oceanicola batsensis HTCC2597]
 gi|84392696|gb|EAQ04907.1| NAD(+) synthase [Oceanicola batsensis HTCC2597]
          Length = 552

 Score =  489 bits (1258), Expect = e-136,   Method: Composition-based stats.
 Identities = 246/558 (44%), Positives = 332/558 (59%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I + QLNP VGDIAGN A AR+A E     G DL+   E+F++GY  +DLV K 
Sbjct: 1   MTDRFRITLCQLNPTVGDIAGNAALARQAWETGKAAGADLVALPEMFVTGYQTQDLVGKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F QA  +AI+TL +D  D G  + +G P  +   + N   IL  G +I+   K NLPN 
Sbjct: 61  VFHQAALAAIETLAADCAD-GPALAIGGPALEGASLFNGYHILSGGRVISRILKHNLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R + S     P     +R+G  ICED W +    + L + GAE L   N SPYY
Sbjct: 120 TVFDEVRLYGSAAPAGPYSIGGVRIGSPICEDAWHSEVP-ETLAETGAEILLVPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K++ R+  +  ++    LP+IY+N  GGQD+ +FDG SF  +   ++AF M  F +Q 
Sbjct: 179 RGKMETRYNHMVARVVETGLPLIYLNMTGGQDDQVFDGGSFGLNPGGRMAFHMPVFDQQ- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +T     +    W     + A+       E E DY   V +LRDY +K  F KV++GLS
Sbjct: 238 -ITHVDLTRTPEGWRIDEGEKAAMP----DEWEQDYRCMVEALRDYCRKTGFGKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A IA DALG ENV+ +MLP +YTS  SLEDA A A+ALGC+Y  LPI     
Sbjct: 293 GGIDSAIVATIAADALGPENVRCVMLPSEYTSDHSLEDARAVARALGCRYHDLPISQGRQ 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +     +  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AITETLAPLFEGTDPDVTEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++     +GP  EVIP  I+ K PSAELR  Q D 
Sbjct: 413 DMAGGYNPIKDLYKTRVFEQCRWRNANHRDWMMGPPGEVIPDRIITKPPSAELRADQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I+  +V+ + S  +     Y  E  + VE L+Y SEYKR Q+  GT++T
Sbjct: 473 DSLPDYPVLDAILNILVDLDGSVADCVAAGYRREDAKQVERLIYLSEYKRFQSAPGTRLT 532

Query: 540 AKSFGRDRLYPISNKFRD 557
             +F  DR YPI N++RD
Sbjct: 533 KHAFWLDRRYPIVNRWRD 550


>gi|241663744|ref|YP_002982104.1| NAD synthetase [Ralstonia pickettii 12D]
 gi|240865771|gb|ACS63432.1| NAD+ synthetase [Ralstonia pickettii 12D]
          Length = 545

 Score =  489 bits (1258), Expect = e-136,   Method: Composition-based stats.
 Identities = 222/564 (39%), Positives = 324/564 (57%), Gaps = 30/564 (5%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            + +A+AQ+N  VGD AGN ++   A  EA++ G  ++L  EL ++GYPPEDL+ + +FI
Sbjct: 2   TVSVALAQINCTVGDFAGNASRIVAAAREAHQAGARILLTPELSLTGYPPEDLLLRPAFI 61

Query: 64  QACSSAIDTL-KSDTHDGGAGIVVGFPRQDQE--------GVLNSVVILDAGNIIAVRDK 114
            A + A+D L        G  +++G P+   E           NSV +   G ++   +K
Sbjct: 62  DASARALDALIAELAAFPGLHVLIGHPQLSLEAPAPGVLPKPTNSVTVAVDGRVVGRYNK 121

Query: 115 INLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSL 174
           + LPN   F EKR F  G           R G++ICED W  +    + K  GA+ +   
Sbjct: 122 LELPNNEVFDEKRYFQPGTEPFVFEVDGTRFGVIICEDAW-YATATAYAKAAGAQVVLIP 180

Query: 175 NASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMK 234
           NASPY+ +K   R  I+  ++    LP +Y N VGGQDEL+FDG SF  D +  +  +M 
Sbjct: 181 NASPYHLDKEDLRERIIGARVKESGLPHVYANLVGGQDELVFDGGSFVLDAEGNVVVRMG 240

Query: 235 HFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHK 294
            F E     ++   + L            T+      E   Y A  L +RDY+ KN F  
Sbjct: 241 QFVEGVGYVQFDGGRALPG----------TIVPEASLEAQVYEALKLGVRDYLGKNGFPG 290

Query: 295 VIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLP 354
            IIGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA   A  LG +YD + 
Sbjct: 291 AIIGLSGGVDSALVLAIAVDALGADRVRAVMMPSRYTADISWVDARDMAARLGVQYDEIA 350

Query: 355 IHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVG 414
           I  + + F   +++  +  P     ENIQ+RIRG +LMALSN S  ++LTT NKSE++VG
Sbjct: 351 ISPMFDAFKGALAEDFRGLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSEMAVG 410

Query: 415 YGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELR 474
           Y TLYGDM+GGF  +KD++KT V++L  +RN+         L+EVIP  IL ++PSAELR
Sbjct: 411 YCTLYGDMAGGFAVIKDIFKTLVYRLCRYRNA---------LSEVIPERILTRAPSAELR 461

Query: 475 PHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAP 533
            +QTDQ+SLP Y  LD I++R +E  +   +     + +  V+ +  L+  +EYKRRQAP
Sbjct: 462 ENQTDQDSLPEYDALDAIVQRYMEQNQPVADIIADGFAEADVQKIVRLIKINEYKRRQAP 521

Query: 534 VGTKITAKSFGRDRLYPISNKFRD 557
           VG ++T ++FGRD  YPI+++F++
Sbjct: 522 VGIRVTQRAFGRDWRYPITSRFKE 545


>gi|331004931|ref|ZP_08328344.1| NAD synthetase [gamma proteobacterium IMCC1989]
 gi|330421255|gb|EGG95508.1| NAD synthetase [gamma proteobacterium IMCC1989]
          Length = 547

 Score =  488 bits (1257), Expect = e-136,   Method: Composition-based stats.
 Identities = 239/557 (42%), Positives = 346/557 (62%), Gaps = 15/557 (2%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRA-REEANRQGMDLILFTELFISGYPPEDLVFKK 60
           +  + + +AQ+NP+VGDI GN+AK   +      +   DL++F EL + GYPPEDL+ + 
Sbjct: 1   MSLVNVVMAQINPLVGDIEGNVAKVIESTITSQQQHNADLVVFPELTLCGYPPEDLLLRS 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S     + A+  L S +    A IVVG+P+++     N V +L  G  IA   K +LPNY
Sbjct: 61  SMDVRIADALLLLASQS--FTATIVVGYPKREGGAHYNMVGVLQQGQWIAEYAKQHLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G +     F  I   + ICEDIW +  + +     GA  L ++NASP++
Sbjct: 119 QVFDEKRYFEAGKAATVFDFHGIPTALSICEDIWHDEPLLQAKAA-GANLLININASPFH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K ++R ++++ +     + I+YVNQVGGQDEL+FDG SF  +   Q   Q   + E  
Sbjct: 178 QSKQQERVDLLSHRAKQGDMAIVYVNQVGGQDELVFDGGSFVVNADGQCPVQAPLYEEGL 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           F+ +      +S+ ++M  +S  ++  P+ +    Y A VL LRDYV KN F KV++GLS
Sbjct: 238 FLAQCACVPNMSEVSFM--ESVDSVAPPMCDLSVIYQALVLGLRDYVNKNCFQKVVLGLS 295

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALG + V  IM+P+ YTS  S EDAA  AK LG +YD + I  + +
Sbjct: 296 GGIDSALTLAIAVDALGADKVTAIMMPFLYTSELSKEDAAEQAKRLGVQYDSIAIEGVYS 355

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F S + Q     P+ +  +N+Q+R RG +LMA+SN +  ++LTT NKSE++VGY TLYG
Sbjct: 356 AFMSSLEQQFSGLPTDLAEQNLQARCRGVLLMAISNKTGCLVLTTGNKSELAVGYSTLYG 415

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RNS G         EVIP S++E+ PSAEL P Q D+
Sbjct: 416 DMAGGFDALKDVPKTMVFELAKYRNSMG--------DEVIPLSVIERPPSAELAPDQKDE 467

Query: 481 ESLPPYPILDDIIKRIVENEESFINND-QEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           ++LPPY +LD I++R +E+++S        ++ ETV  V  L+  +EYKRRQ+PVG +I+
Sbjct: 468 DNLPPYEVLDQILERYIEHDQSADAIVNAGFDKETVYRVIRLVDINEYKRRQSPVGVRIS 527

Query: 540 AKSFGRDRLYPISNKFR 556
            K FGRDR YPI+N ++
Sbjct: 528 KKGFGRDRRYPITNGWK 544


>gi|148653679|ref|YP_001280772.1| NAD+ synthetase [Psychrobacter sp. PRwf-1]
 gi|148572763|gb|ABQ94822.1| NAD+ synthetase [Psychrobacter sp. PRwf-1]
          Length = 552

 Score =  488 bits (1257), Expect = e-136,   Method: Composition-based stats.
 Identities = 233/555 (41%), Positives = 321/555 (57%), Gaps = 19/555 (3%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
             LK A+AQ + +VGDI  NI K R    EA   G D+I+F EL + GYPPEDL+ + S 
Sbjct: 13  SSLKFAMAQSHFMVGDIQTNIDKMRSLAIEARDNGADVIVFPELALLGYPPEDLLLRPSL 72

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
                +A+ +L          +++G+P  D  G  NS  I+  G       K  LPNY  
Sbjct: 73  SDRVKAALSSLSDI---NDIVMIIGYPHVDYHGTFNSAAIIQNGQQKGFYHKQYLPNYGV 129

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F E+R F  G +     ++ + +G+LICED+W      K LK QGA+ + ++NASP+   
Sbjct: 130 FDERRYFDKGRNQVLFDYQGVTIGLLICEDLW-QEEPIKALKDQGADLVVTINASPFEAG 188

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K   R  ++  + +   LPIIYVN VGGQD+L+FDG S        +A +   F E    
Sbjct: 189 KQHTRQALLNKRATDNQLPIIYVNAVGGQDDLVFDGGSMAIQANGDVAHEAPRFLEHMLY 248

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
             +            + DS +   + L  E   Y A V+ LRDYV  + F  VI+GLSGG
Sbjct: 249 ATYDIK-------NHTFDSQTKAPLQLSSESETYQALVVGLRDYVNHSGFEGVIVGLSGG 301

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL   +AVDALG + V  +M+PY+YTS  SLEDA A A+ L   Y V PIHD V+  
Sbjct: 302 IDSALTLCVAVDALGSDKVYAVMMPYEYTSQISLEDAQAQARRLNVSYTVCPIHDAVDGM 361

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
              ++    +  +    ENIQ+R RG +LMALSN    +++TT NKSE++VGY TLYGDM
Sbjct: 362 RHTLAPLFSKAKADTTEENIQARARGMVLMALSNKFGHLVITTGNKSEMAVGYATLYGDM 421

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF+ LKD+YKTQV+ LA++RN           T VIP  ++ + PSAELRP Q DQ+S
Sbjct: 422 AGGFDVLKDVYKTQVYALANYRNRL-------EDTNVIPERVITRPPSAELRPDQVDQDS 474

Query: 483 LPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LP Y +LD I+K  ++N+  F     + ++ E VR+V  L+  SEYKRRQA +GTKI+ K
Sbjct: 475 LPDYDLLDAILKDYIDNDLGFNEITAKGFDPEVVRHVIKLVDRSEYKRRQAAIGTKISHK 534

Query: 542 SFGRDRLYPISNKFR 556
           +FGR+R YP+ N + 
Sbjct: 535 AFGRERRYPLVNGWS 549


>gi|126666675|ref|ZP_01737652.1| NAD synthase [Marinobacter sp. ELB17]
 gi|126628720|gb|EAZ99340.1| NAD synthase [Marinobacter sp. ELB17]
          Length = 554

 Score =  488 bits (1256), Expect = e-135,   Method: Composition-based stats.
 Identities = 215/555 (38%), Positives = 326/555 (58%), Gaps = 21/555 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQG-MDLILFTELFISGYPPEDLVFKKSF 62
            L++ + Q + +VGDI GN  +   A  +A+ Q   D+++F EL ++GYPPEDL+ + S 
Sbjct: 16  PLRLVMVQQDFLVGDIPGNAQRIVAAVRQADDQHQADIVVFPELALTGYPPEDLLLRPSL 75

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
                +AID +          +V G P ++   + N+ ++++ G I     K   PNY  
Sbjct: 76  DIRVQAAIDEICG--AGLAPVVVFGAPVRENGKLYNAALVMENGKISHRYFKQCPPNYQV 133

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F SG+ +  +  R + +GI +CED+W      +     GA+ + +LNASPY   
Sbjct: 134 FDEKRYFASGFESSVVSLRGVNVGITVCEDLW-AEGPVETAAAAGAKLVLNLNASPYSKG 192

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K  +R  +V  +     +PI+YVN VG QDEL+FDG S   DG+ ++A +   F +  F+
Sbjct: 193 KQLRRKALVQRKAKAAGVPIVYVNLVGAQDELVFDGGSLVADGKGEIAAEAPQFEQGLFV 252

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
            ++   +       +       +  PL    A Y A V+ +RDYV KN F  V++GLSGG
Sbjct: 253 VDFKCGE-------ICQPVTQPLPQPLSASAAVYQALVMGVRDYVGKNGFKSVVLGLSGG 305

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL  AIAVDALGK  V+ +M+P++YTS  SL+DA A A  +G  YDV  I  + + F
Sbjct: 306 IDSALTLAIAVDALGKAQVRAVMMPFRYTSDISLQDAEAQASTMGVHYDVFSIEPMYDTF 365

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
            + +++           EN+Q+R+RG +LM+LSN   +++LTT NKSE++VGY TLYGDM
Sbjct: 366 MATLAEPFTGTTVDTTEENLQARLRGVLLMSLSNKFGSLVLTTGNKSEMAVGYSTLYGDM 425

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF+ LKD+ KTQVF+L+ +RN+            VIP  ++ + PSAEL P Q D+++
Sbjct: 426 AGGFDVLKDVAKTQVFELSRYRNTVAP---------VIPERVITRPPSAELAPDQKDEDN 476

Query: 483 LPPYPILDDIIKRIVENEESFI-NNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LP Y +LD I++R VE +ES        ++   V  V  L+  +EYKRRQAP+G +++ +
Sbjct: 477 LPGYDVLDAILQRYVEQDESAEVIIAAGFDRTDVERVIRLVDINEYKRRQAPIGVRVSER 536

Query: 542 SFGRDRLYPISNKFR 556
            FG+DR YPI+N ++
Sbjct: 537 GFGKDRRYPITNGWK 551


>gi|326796307|ref|YP_004314127.1| NAD+ synthetase [Marinomonas mediterranea MMB-1]
 gi|326547071|gb|ADZ92291.1| NAD+ synthetase [Marinomonas mediterranea MMB-1]
          Length = 545

 Score =  488 bits (1256), Expect = e-135,   Method: Composition-based stats.
 Identities = 218/556 (39%), Positives = 325/556 (58%), Gaps = 18/556 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQG-MDLILFTELFISGYPPEDLVFKKSF 62
            L++A+AQL+ +VGDI  N     +A  EA      D+++F EL ++GYPPEDL+ + S 
Sbjct: 2   TLRVAMAQLDMLVGDIKNNTESVIKAAHEARDHHQADVVVFPELTLTGYPPEDLLLRPSL 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
                 +I T+ ++       +VVG+PR+    + N   +   G ++    K  LPN+  
Sbjct: 62  DSRIEDSIQTILNEV--HDIYVVVGYPRRIDGDLFNCAGVFHQGRMLGEYAKQKLPNFKV 119

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F +KR F  G     +  +++++G+ ICEDIW         ++ GAE + +L+ASP++  
Sbjct: 120 FDDKRYFEEGTEPLIVDVKNVKVGLSICEDIWHPEP-SLQAQEAGAELIINLSASPFHIE 178

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K+  R +++  +     LPI++VN +G QDEL+++G SF  + Q Q   Q   F    + 
Sbjct: 179 KMGVREQLLHQRAVETQLPIVFVNYMGAQDELVYEGGSFVVNAQGQKIAQAPWFESGIYT 238

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
            ++  ++  +Q        AST+   L  EE+ Y A VL LRDY++KN F  +++GLSGG
Sbjct: 239 VDFSVEETRTQ---KVIPLASTVAPALSIEESVYQAMVLGLRDYIEKNRFKGIVLGLSGG 295

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL  A+AVDA+G + VQ +M+PY YTS  SLEDA   A  LG  Y VLPI  +V  F
Sbjct: 296 IDSALSLAVAVDAIGADRVQAVMMPYTYTSSMSLEDAEEEATLLGVNYSVLPIEPMVTAF 355

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
              ++   +        EN+Q+R RG  LMA+SN    M+LTT NKSE++VGY TLYGDM
Sbjct: 356 METLAPEFEGYAKDTTEENLQARTRGVTLMAISNKKGYMVLTTGNKSEMAVGYATLYGDM 415

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
            GG++ LKD++KT VF+L  +RN+         L  VIP  ++ + PSAEL P Q D++S
Sbjct: 416 VGGYSVLKDVFKTLVFKLCRYRNT---------LGYVIPERVITRPPSAELAPDQIDEDS 466

Query: 483 LPPYPILDDIIKRIVENEESFINNDQ--EYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           LP Y  LD+I+   +E + S     +  +++ ETV  V  L+  +EYKRRQAP G ++T 
Sbjct: 467 LPSYDELDEILHLYIERDMSAEAILEIGQFDRETVYRVLRLVDLNEYKRRQAPTGVRLTE 526

Query: 541 KSFGRDRLYPISNKFR 556
           + FGRDR YPI+N + 
Sbjct: 527 RGFGRDRRYPITNGWH 542


>gi|29832491|ref|NP_827125.1| NH(3)-dependent NAD(+) synthetase [Streptomyces avermitilis
           MA-4680]
 gi|29609610|dbj|BAC73660.1| putative NH(3)-dependent NAD(+) synthetase [Streptomyces
           avermitilis MA-4680]
          Length = 584

 Score =  488 bits (1255), Expect = e-135,   Method: Composition-based stats.
 Identities = 211/592 (35%), Positives = 311/592 (52%), Gaps = 44/592 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+ Q++  VGDIAGN     R    +  QG  L+ F E+ ++GYP EDL  + S
Sbjct: 1   MPQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS 60

Query: 62  FIQACSSAIDTLKSDTHDGG---AGIVVGFPRQDQ----------EGVLNSVVILDAGNI 108
           F++A  +A+  L +   + G     ++VG+  + +              N+  +L  G +
Sbjct: 61  FVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRV 120

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA 168
                K +LPNY  F E R F+ G +   +    + + + ICED+W++       +  GA
Sbjct: 121 ALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGA 180

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
             L S+NASPY  +K   R E+V  +         Y+  +GGQDEL+FDG S   D   +
Sbjct: 181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGE 240

Query: 229 LAFQMKHFSEQNFMTEWHY------------DQQLSQWNYMSDDSASTMYIP-------- 268
           +  +   FSE   + +               D  L     +  +     Y          
Sbjct: 241 VVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYAD 300

Query: 269 -LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLP 327
            L  +E  Y+A V+ LR YV KN F  V+IGLSGGIDSAL AAIA DALG +NV  + +P
Sbjct: 301 RLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMP 360

Query: 328 YKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIR 387
            KY+S  S  DAA  A+  G  +  + I  + + + + +        +G+  EN+QSR+R
Sbjct: 361 SKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLG------LTGLAEENLQSRLR 414

Query: 388 GNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSH 447
           G  LMA+SN    ++L   NKSE++VGY TLYGD  G + P+KD+YKT +F+LA WRN  
Sbjct: 415 GTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRA 474

Query: 448 GITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN- 506
               G  P    IP + + K PSAELRP Q D +SLP YP+LD I++  V+ +       
Sbjct: 475 AAERGQTP---PIPEASITKPPSAELRPGQVDTDSLPDYPVLDAILELYVDRDTGADAIV 531

Query: 507 DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
              Y+ E V     ++  +EYKRRQ P GTKI+AK FG+DR  PI+N++R+H
Sbjct: 532 AAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREH 583


>gi|300193273|pdb|3N05|A Chain A, Crystal Structure Of Nh3-Dependent Nad+ Synthetase From
           Streptomyces Avermitilis
 gi|300193274|pdb|3N05|B Chain B, Crystal Structure Of Nh3-Dependent Nad+ Synthetase From
           Streptomyces Avermitilis
          Length = 590

 Score =  488 bits (1255), Expect = e-135,   Method: Composition-based stats.
 Identities = 211/592 (35%), Positives = 310/592 (52%), Gaps = 44/592 (7%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  +L++A+ Q++  VGDIAGN     R    +  QG  L+ F E+ ++GYP EDL  + 
Sbjct: 1   MSLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRS 60

Query: 61  SFIQACSSAIDTLKSDTHDGG---AGIVVGFPRQDQ----------EGVLNSVVILDAGN 107
           SF++A  +A+  L +   + G     ++VG+  + +              N+  +L  G 
Sbjct: 61  SFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGR 120

Query: 108 IIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG 167
           +     K +LPNY  F E R F+ G +   +    + + + ICED+W++       +  G
Sbjct: 121 VALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAG 180

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
           A  L S+NASPY  +K   R E+V  +         Y+  +GGQDEL+FDG S   D   
Sbjct: 181 AGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDG 240

Query: 228 QLAFQMKHFSEQNFMTEWHY------------DQQLSQWNYMSDDSASTMYIP------- 268
           ++  +   FSE   + +               D  L     +  +     Y         
Sbjct: 241 EVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYA 300

Query: 269 --LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIML 326
             L  +E  Y+A V+ LR YV KN F  V+IGLSGGIDSAL AAIA DALG +NV  + +
Sbjct: 301 DRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSM 360

Query: 327 PYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRI 386
           P KY+S  S  DAA  A+  G  +  + I  + + + + +        +G+  EN+QSR+
Sbjct: 361 PSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLG------LTGLAEENLQSRL 414

Query: 387 RGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNS 446
           RG  LMA+SN    ++L   NKSE++VGY TLYGD  G + P+KD+YKT +F+LA WRN 
Sbjct: 415 RGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNR 474

Query: 447 HGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN 506
                G  P    IP + + K PSAELRP Q D +SLP YP+LD I++  V+ +      
Sbjct: 475 AAAERGQTP---PIPEASITKPPSAELRPGQVDTDSLPDYPVLDAILELYVDRDTGADAI 531

Query: 507 -DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
               Y+ E V     ++  +EYKRRQ P GTKI+AK FG+DR  PI+N++R+
Sbjct: 532 VAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWRE 583


>gi|294635169|ref|ZP_06713677.1| NAD(+) synthase [Edwardsiella tarda ATCC 23685]
 gi|291091431|gb|EFE23992.1| NAD(+) synthase [Edwardsiella tarda ATCC 23685]
          Length = 540

 Score =  488 bits (1255), Expect = e-135,   Method: Composition-based stats.
 Identities = 233/556 (41%), Positives = 334/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +   A  +  + G D+++F+EL + GYPPEDL+++ 
Sbjct: 1   MSRTLSIALAQLNLLVGDIEGNAERMLAAMAQQQQAGADIVMFSELALCGYPPEDLLYRD 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C S ++ L+  +  G   ++VG P +++  + N++ +   G + A   K  LPNY
Sbjct: 61  DFHQRCQSQLERLRQAS--GSIAVIVGHPWREKGALYNALSLFADGQLQARYYKQRLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F +G +   +  +  RLG+LICED+W N      +   GAE L ++NASPY 
Sbjct: 119 GVFDEMRYFSAGDTPCVVTLKGYRLGLLICEDVWFNEP-VDAVAAAGAEILLTINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R+ ++        LP++Y+NQVGGQDEL+FDG S  FD Q QL  ++  F EQ 
Sbjct: 178 REKPYMRNTLLADHCRRTGLPLLYLNQVGGQDELVFDGCSKVFDAQGQLTHRLAAFDEQV 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              +    +                   L      Y A VL++RDYV KN F   ++GLS
Sbjct: 238 TQVQLVETR---------PQPMRDPASELPALAQIYRALVLAVRDYVGKNGFQGAVLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGKE VQ +M+P++YT+  S+ DA   A+ +G ++D+L I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKERVQALMMPFRYTADISVADAQEQAQTMGVEFDILSIEPMFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   ++            EN+Q+R RG +LMALSN  + ++LTT NKSE++VGY TLYG
Sbjct: 349 AFMGQLAPLFAGTERDTTEENLQARCRGVVLMALSNKRRRLVLTTGNKSEMAVGYATLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VFQLAS+RN+         L  VIP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFDVLKDVPKTLVFQLASYRNT---------LGYVIPQRVIDRPPSAELAPDQVDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I++  VE ++S        +++  VR V  L+  +EYKRRQA VG +IT
Sbjct: 460 DSLPPYDVLDAILQGYVEQDKSVAQLVADGFDEAVVRKVIRLVDINEYKRRQAAVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
           A++FG+DR YPI++ F
Sbjct: 520 ARNFGKDRRYPITSGF 535


>gi|262369416|ref|ZP_06062744.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262315484|gb|EEY96523.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 541

 Score =  488 bits (1255), Expect = e-135,   Method: Composition-based stats.
 Identities = 221/557 (39%), Positives = 321/557 (57%), Gaps = 21/557 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  KIA+AQ +P +G++  N  K      EA +Q  DLI+F EL   GYP EDL+ + S
Sbjct: 1   MKSFKIALAQFSPHIGNLEANAQKMLEQANEAKKQNADLIIFPELSSIGYPAEDLLLRPS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQ-DQEGVLNSVVILDAGNIIAVRDKINLPNY 120
             +      + LK+        +V GF  Q +     N+  ++  G ++ V +K NLPNY
Sbjct: 61  LTKRTQQVFEQLKTV---KDIVMVFGFVNQTEDGQRYNAAAVMKDGQVLGVYNKQNLPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F EKR F  G+ +    +   + G+LICED+W + +  + L +   E    LNASPY 
Sbjct: 118 SVFDEKRYFTEGHQHLVFEYLGHKFGVLICEDVW-SLSTVQQLAQLNVETALVLNASPYE 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R E ++     ++L ++Y NQVGGQD+LIFDG SF       +  Q + F E  
Sbjct: 177 VGKPQHRVETMSALAKQMNLNLVYANQVGGQDDLIFDGTSFVIAKNGSIVLQAESFKESL 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           +  E+  +QQ  + N +           L      Y + V++ RDYVQ++ F  VI+GLS
Sbjct: 237 YFAEYEAEQQAFKANALPPA--------LDTMAEIYQSLVMATRDYVQRSGFPGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIA DA+G + VQ +M+PY YT+  S+EDAA  AK++G  + +  I+ +VN
Sbjct: 289 GGIDSALTLAIAADAIGADKVQAVMMPYTYTAQISVEDAAEQAKSMGVTFGIAEINPIVN 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +  F    P+    EN+Q+R RG +LM LSN    ++L+T NKSE++VGY TLYG
Sbjct: 349 SFMQTLYPFFGNSPADATEENLQARARGTLLMGLSNKFGNLVLSTGNKSELAVGYCTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF  LKD+YKT VF+LA +RNS            VIP  ++ + PSAELRP Q DQ
Sbjct: 409 DMVGGFAVLKDVYKTIVFELAKYRNSISD-------KPVIPERVITRPPSAELRPDQKDQ 461

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I+   +E + S  +   + ++ E V  V  L+  +EYKRRQ  +G +I+
Sbjct: 462 DSLPPYDVLDAILYAYIEEDMSQDDIIAKGFDAEVVAKVIRLVDFNEYKRRQGAIGPRIS 521

Query: 540 AKSFGRDRLYPISNKFR 556
           +++F R+R YPI N ++
Sbjct: 522 SRAFSRERRYPIMNGWK 538


>gi|88811118|ref|ZP_01126374.1| NAD(+) synthetase [Nitrococcus mobilis Nb-231]
 gi|88791657|gb|EAR22768.1| NAD(+) synthetase [Nitrococcus mobilis Nb-231]
          Length = 543

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 225/557 (40%), Positives = 316/557 (56%), Gaps = 20/557 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFK 59
           M  +L+IA+AQLN +VGD+ GN      A   A  +    +++F EL ++GYPP+DL+ +
Sbjct: 1   MNDRLRIAMAQLNLLVGDVRGNTLAVIDAACRARDELRARVVIFPELALTGYPPDDLLLR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
             F+   S+AI  L     D    ++VG P +   G++N+ ++++ G I A   K  LP 
Sbjct: 61  NDFLGEVSAAIAQLCRAVRD--VTLIVGAPVRSATGLMNAALVIEQGRIAATYAKHYLPT 118

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           Y  F + R F  G +   +     R+G+ ICED W    +     + GAE + +LNASP+
Sbjct: 119 YGVFDDTRYFEPGSAPCVVEVAGCRIGVTICEDAWHPEPVAWA-VQMGAEVVVNLNASPF 177

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
              K   R  ++  +I    + ++Y N  GGQDE+++DGAS  F     L  +   F   
Sbjct: 178 DQYKRAAREAVIRERIGESGVAMLYCNMAGGQDEVVYDGASCAFGRHGDLRVRAPRFRPG 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
               +        Q     +    ++     EE   Y+A V  +RDYV+KN F  VIIGL
Sbjct: 238 LVPVDL------LQRGGGWEALEGSIEEDPSEEAVLYDALVWGVRDYVEKNGFPGVIIGL 291

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL   +AVDALG E V+T+M+P +YTS  S  DAAA A +L  ++ V+ I  + 
Sbjct: 292 SGGIDSALVTCVAVDALGAERVETVMMPTQYTSEISWTDAAALAGSLRIRHRVIAIEGVF 351

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F   +     + P+ +  EN+QSRIRG +LMALSN    ++L T NKSE++VGY TLY
Sbjct: 352 KAFSETLQPVFADAPADVTEENLQSRIRGTLLMALSNKQGKLVLATGNKSELAVGYATLY 411

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM GGF PLKD++KT V+ LA +RN          L EVIP SIL + PSAELRP+Q D
Sbjct: 412 GDMVGGFAPLKDIFKTDVYSLARYRNE---------LGEVIPQSILTRPPSAELRPNQLD 462

Query: 480 QESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
            +SLP Y +LD I+   VE + S        Y+  TV  V  L++ +EYKRRQAP G K+
Sbjct: 463 TDSLPEYIVLDTILAAYVEEDRSVEEIVAEGYDRATVEEVVRLVHRNEYKRRQAPPGVKV 522

Query: 539 TAKSFGRDRLYPISNKF 555
           T K+FGRDR YPI++ F
Sbjct: 523 TTKAFGRDRRYPITSGF 539


>gi|188575738|ref|YP_001912667.1| glutamine-dependent NAD(+) synthetase (NAD(+) synthase [Xanthomonas
           oryzae pv. oryzae PXO99A]
 gi|188520190|gb|ACD58135.1| glutamine-dependent NAD(+) synthetase (NAD(+) synthase [Xanthomonas
           oryzae pv. oryzae PXO99A]
          Length = 547

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 221/556 (39%), Positives = 311/556 (55%), Gaps = 20/556 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSFI 63
           L+IA+AQ +  VG +  N  +       A  + G D++LF EL ISGYPPEDL+ +  F+
Sbjct: 6   LRIAMAQFDFPVGAVTQNTDRIIEYIAAARDEYGADIVLFPELAISGYPPEDLLLRPGFL 65

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
             C  A+  + + T   G   VVG+P+     V N+  +L  G I A   K  LPNY+ F
Sbjct: 66  AHCEQALARIAAATR--GIVAVVGWPQSAGSVVYNAASVLRDGRIEATYRKRELPNYAVF 123

Query: 124 HEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            E+R F       N  +  + +++G++ICED+W    +     K GAE +   NASPY  
Sbjct: 124 DERRYFDVDPDGENCVVTVKGVQVGVVICEDLWFAEPLANT-VKAGAELVLVPNASPYER 182

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
            K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      F +Q  
Sbjct: 183 GKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAAFVDQWL 242

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
           + ++   ++        DD   +M      +   + A V  L+DY  KN F KV +GLSG
Sbjct: 243 VVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYCSKNGFSKVWLGLSG 296

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSAL  A+AVDALG +NV  + LP +YT+  S + A    +ALG K + + I      
Sbjct: 297 GIDSALVLAMAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALGVKLETVAIEPAFEG 356

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
             + +          I  EN+QSR RG ILMALSN    ++LTT NKSE +VGY T+YGD
Sbjct: 357 LLAALGPLFAGTEPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEYAVGYATIYGD 416

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M GG+ PLKDLYKT+VF LA WRN+            VIPP+++ + PSAELR +QTDQ+
Sbjct: 417 MCGGYAPLKDLYKTEVFGLAKWRNT-------VDGAPVIPPAVISRPPSAELRDNQTDQD 469

Query: 482 SLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLPPY +LD I+ R V+ E+S  +     Y  ETV +V  L+  +E+KR Q+  G K++ 
Sbjct: 470 SLPPYDVLDAILYRYVDQEQSRDDIVAAGYAAETVEHVLRLVRLNEWKRHQSAPGPKVSR 529

Query: 541 KSFGRDRLYPISNKFR 556
           ++FGR+R YPI+N +R
Sbjct: 530 RAFGRERRYPITNGYR 545


>gi|186685760|ref|YP_001868956.1| NAD synthetase [Nostoc punctiforme PCC 73102]
 gi|186468212|gb|ACC84013.1| NAD+ synthetase [Nostoc punctiforme PCC 73102]
          Length = 572

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 216/569 (37%), Positives = 317/569 (55%), Gaps = 35/569 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQ+NP +GD+  N  K   A + A   G  L+L  EL + GYPP DL+   SF++
Sbjct: 1   MKIAIAQINPTIGDLPLNAQKILEAAQRAASSGARLLLTPELSLCGYPPRDLLLNPSFVE 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQD-------QEGVLNSVVILDAGNIIAVRDKINL 117
           A   ++  L  D       ++VG   Q+        + + NS+ +L+ G +  V  K  L
Sbjct: 61  AMGISLQNLAQDLP-PNLAVLVGTVEQNLNASISGGKTLFNSMALLENGKVKQVFHKRLL 119

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNIC----------KHLKKQG 167
           P Y  F E+R F  G   +     +I +G+ ICED+W +                L   G
Sbjct: 120 PTYDVFDERRYFEPGLQANYFTLDNIDIGVTICEDLWNDEEFWGKRSYTVNPIADLAILG 179

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
            + + +L+ASPY   K + R  ++         P+IY NQVGG D+LIFDG SF  + Q 
Sbjct: 180 VDLIVNLSASPYTVGKQQLRETMLRHSAVRFQQPMIYTNQVGGNDDLIFDGHSFALNRQG 239

Query: 228 QLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYV 287
           ++  + + F     + E+   Q+  Q   +             E+E  + A VL +RDY 
Sbjct: 240 EIISRARGFDTDLVVVEFDETQRDFQLASVEPAYQ-------SEDEEIWQALVLGVRDYA 292

Query: 288 QKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALG 347
           +K  F KV++GLSGGIDSA+ AAIA  ALGKENV  +++P  Y+S  S+ DA A AK LG
Sbjct: 293 RKCRFSKVVLGLSGGIDSAIVAAIATAALGKENVLGVLMPSPYSSEHSISDALALAKNLG 352

Query: 348 CKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSN 407
            K ++LPI +L+  F   +         G+  ENIQSRIRGN+LMA++N    +LL+T N
Sbjct: 353 IKTNLLPIGELMQGFDQTLGDLFAGTEFGLAEENIQSRIRGNLLMAIANKFGYLLLSTGN 412

Query: 408 KSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEK 467
           KSE++VGY TLYGDM+GG   + D+ KT+V+ L  W N +          E+IP ++L K
Sbjct: 413 KSEMAVGYCTLYGDMNGGLAVIADVPKTRVYSLCHWLNRNN---------EIIPQNVLTK 463

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSE 526
           +PSAEL+P Q DQ+SLPPY +LDDI++R++ N +S +      ++   V  V  ++  +E
Sbjct: 464 APSAELKPGQVDQDSLPPYEVLDDILQRLIHNHQSAVQIVAAGHDAVIVDRVIQMVARAE 523

Query: 527 YKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           +KRRQAP G KIT ++FG     PI++ +
Sbjct: 524 FKRRQAPPGLKITDRAFGTGWRMPIASNW 552


>gi|183599762|ref|ZP_02961255.1| hypothetical protein PROSTU_03267 [Providencia stuartii ATCC 25827]
 gi|188022023|gb|EDU60063.1| hypothetical protein PROSTU_03267 [Providencia stuartii ATCC 25827]
          Length = 540

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 231/556 (41%), Positives = 334/556 (60%), Gaps = 23/556 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL I++AQLN +VGDI GN  +  +  EE  +   D+++F+EL ++GYPPEDL+F+ 
Sbjct: 1   MSRKLNISLAQLNWLVGDIEGNCERMLQVFEE-QKNIADIVVFSELSLTGYPPEDLLFRA 59

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q     ++ L++ + +    IVVG P  +   + N++     G ++    K  LPNY
Sbjct: 60  DFTQRYLVQLERLQNASTE--TAIVVGHPWTEAGKMYNALSFFYQGKLLTRYFKQELPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F +G     + F+  R+G+LICEDIW +      +K+ GAE L ++NASPY 
Sbjct: 118 GVFDELRYFSAGDKTGVVDFKGYRIGLLICEDIWFDGP-VDAVKQAGAELLLTINASPYD 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK   R +++        LPIIY+NQVGGQDELIFDG S       ++  Q+  F EQ 
Sbjct: 177 RNKDHSRSDLLVRHCQRTQLPIIYLNQVGGQDELIFDGGSKVLASDGKITHQLVDFDEQI 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                       Q+N +S      +   L      Y   V++ RDY+ KN F+  I+GLS
Sbjct: 237 VNC---------QFNELSAVPMEKLAPALSPVAQVYQGLVMATRDYINKNGFNGAILGLS 287

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDA+GKE VQ +M+P++YTS  S+ DA   A+ LG ++D++ I  + +
Sbjct: 288 GGIDSGLTVAIAVDAIGKERVQAVMMPFRYTSEMSIHDAKEQAELLGVEFDIVSIEPMFD 347

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F S +    +        EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 348 AFMSQLQPMFEGTAVDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 407

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 408 DMAGGFDVLKDVPKTLVFELAKYRNT---------ISPAIPQRVIDRPPSAELAPGQLDQ 458

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD +++  VE + S     +Q +++ TV  V  L+  +EYKRRQAPVG +IT
Sbjct: 459 DSLPPYDILDALLEAYVEKDYSVAQLIEQGFDEATVHRVVRLVDINEYKRRQAPVGPRIT 518

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 519 VRNFGKDRRYPITSGF 534


>gi|241764805|ref|ZP_04762812.1| NAD+ synthetase [Acidovorax delafieldii 2AN]
 gi|241365682|gb|EER60394.1| NAD+ synthetase [Acidovorax delafieldii 2AN]
          Length = 552

 Score =  487 bits (1253), Expect = e-135,   Method: Composition-based stats.
 Identities = 222/564 (39%), Positives = 316/564 (56%), Gaps = 21/564 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M+    I  AQLN VVGD+ GN  K   A  +A+ QG  L+L  EL + GY  EDL  + 
Sbjct: 1   MM--FSICTAQLNFVVGDMPGNAQKIIAAARQAHAQGARLLLTPELAVCGYAAEDLFLRP 58

Query: 61  SFIQACSSAIDTLKSDTHDG-GAGIVVGFPRQDQ------EGVLNSVVILDAGNIIAVRD 113
           +F+ AC  A+ T+  +T    G  IV+G P++           LN+  +L  G +     
Sbjct: 59  AFMAACDDAVKTVARETAGLNGLVIVLGHPQKRTPADPAFSACLNAASVLRHGKVEQTYA 118

Query: 114 KINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFS 173
           K  LPNY  F E+R F++G S        +++G+LICED W +       +         
Sbjct: 119 KHELPNYQVFDERRYFVAGQSPCVFDVEGVKVGLLICEDAWFSEPARAAAQAGAQLLAV- 177

Query: 174 LNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQM 233
           +NASP++  K  +R + +  +++   LP++Y + VGGQDE++F+G SF  +    +A + 
Sbjct: 178 INASPFHLGKSAEREQTMRERVAETGLPLVYAHLVGGQDEVVFEGRSFALNADGSVAARA 237

Query: 234 KHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFH 293
             F E+    +    Q   +     +   S        E   ++A VL +RDYV KN F 
Sbjct: 238 PGFQEKLVFAQIGRAQDAIKIEAEIEPERSL-------EADLWDALVLGVRDYVGKNGFP 290

Query: 294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVL 353
             ++GLSGGIDSAL  AIAVDALG + V+T+M+P  YT+  S  DA   A  +G +YD +
Sbjct: 291 GALLGLSGGIDSALVLAIAVDALGADKVRTVMMPSPYTADISWIDARDMAARMGVRYDEI 350

Query: 354 PIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISV 413
            I      F + ++      P     EN+Q+RIRG +LMALSN   A++LTT NKSE++ 
Sbjct: 351 SIAPQFEAFKAALASEFAGLPEDTTEENLQARIRGTLLMALSNKFGAIVLTTGNKSEMAT 410

Query: 414 GYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAEL 473
           GY TLYGDM+GGF P+KD+ KT+VF LA WRN++      G     IP  I+ + PSAEL
Sbjct: 411 GYCTLYGDMAGGFAPIKDVAKTRVFALARWRNANDPY---GTGASPIPERIITRPPSAEL 467

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQA 532
           RP Q DQ+SLP Y +LD I+ R +EN+E   +     Y    V  V  L+  +EYKRRQA
Sbjct: 468 RPDQKDQDSLPAYEVLDAIVARYMENDEPIESIIAAGYERADVERVTRLIKLNEYKRRQA 527

Query: 533 PVGTKITAKSFGRDRLYPISNKFR 556
           PVG ++T +SFG+D  YPI++KFR
Sbjct: 528 PVGVRVTRRSFGKDWRYPITSKFR 551


>gi|297183634|gb|ADI19760.1| hypothetical protein [uncultured gamma proteobacterium EB000_37F04]
          Length = 538

 Score =  487 bits (1253), Expect = e-135,   Method: Composition-based stats.
 Identities = 226/553 (40%), Positives = 328/553 (59%), Gaps = 19/553 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KI +AQ+N +VGDI GN  +      + +  G+D+++F EL ++GYPPEDL+ ++    
Sbjct: 1   MKIVMAQINTLVGDIKGNTQRILDVCVDQSALGVDMVVFPELTLTGYPPEDLLLRQHTTD 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
             ++A++ L  D  D G  +VVG+PR+    + NS  +L  G ++A  DK  LPNY  F 
Sbjct: 61  LTAAALERLCQDLPD-GLAVVVGYPRRQGGLLFNSAGVLYNGAVVAEYDKQCLPNYQVFD 119

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F +G     +  +D+ +G+ ICEDIW       +    GA+ L +LNASP++  K 
Sbjct: 120 EKRYFEAGADTCVVTIKDLPIGLTICEDIWHPQPAA-NAAAAGAQLLINLNASPFHRGKQ 178

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
            +R   V+       LPI+YVNQVGGQDEL+FDG SF  D +  +  +   F+E     E
Sbjct: 179 SERTAQVSALARTHQLPILYVNQVGGQDELVFDGGSFVVDARGDVQHRAIEFAEVMLSVE 238

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
                QL         ++  +  PL E +A +   VL +RDYV KN F  V++GLSGGID
Sbjct: 239 IETSPQL-------KVASGALATPLDELDAVWQVLVLGMRDYVNKNGFPGVVLGLSGGID 291

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SA+  A+AVDALG E V+ +M+P++YT+  S+EDAA  A   G  +    I  L   F +
Sbjct: 292 SAVTLAVAVDALGPERVEAVMMPFRYTASMSIEDAAEQANTQGVAFSNRSIEPLYEAFMT 351

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++   +     I  EN+Q+R RG +LM++SN    ++LTT NKSE++VGY TLYGDM+G
Sbjct: 352 TLAPAFEGLEPNITEENLQARCRGVLLMSISNKKNLLVLTTGNKSELAVGYSTLYGDMAG 411

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF+ LKD  K  V+ LA +RN+         L + IP  ++ + PSAEL P Q D++SLP
Sbjct: 412 GFDVLKDCPKMLVYALAQYRNT---------LGQCIPERVISRPPSAELAPDQKDEDSLP 462

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY +LD II+  VE + S  +     ++ E V  V  L+  +EYKRRQAPVG +I+ ++F
Sbjct: 463 PYEVLDQIIEHYVERDASRDDMIAAGFSPEDVHRVVRLIDLNEYKRRQAPVGVRISPRAF 522

Query: 544 GRDRLYPISNKFR 556
           GRDR YPI+  +R
Sbjct: 523 GRDRRYPITWAWR 535


>gi|239617986|ref|YP_002941308.1| NAD+ synthetase [Kosmotoga olearia TBF 19.5.1]
 gi|239506817|gb|ACR80304.1| NAD+ synthetase [Kosmotoga olearia TBF 19.5.1]
          Length = 578

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 227/574 (39%), Positives = 335/574 (58%), Gaps = 32/574 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +++ +AQ+N  VGD+ GN+ K     + A ++G+ +++F EL I+GYPPEDLV +  FI+
Sbjct: 3   VRLGLAQINTTVGDLKGNVTKINEYIDLAEKKGVSILVFPELAITGYPPEDLVLRTGFIK 62

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
              SA++ ++  T D    +++GF   D E + N+  +L  G  +AV  K++LPNYS F 
Sbjct: 63  DNLSALEKVREYTIDKELLVILGFVDFDFE-IYNAAAVLHNGEKVAVYRKMHLPNYSVFD 121

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F +G     +  +++R+G+ ICED+W  S         GA  + +L+ASP+   K 
Sbjct: 122 EKRYFSAGKKALILRNKNLRIGVNICEDLWVPSGPINEQTIFGANLIINLSASPFTAGKS 181

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           +KR E+++ + S     I Y N VGGQDEL+FDG S       + +F  + F E+ F+T+
Sbjct: 182 RKRLELLSTRASEYSCAIAYCNLVGGQDELVFDGLSAVVLPDGR-SFIARGFEEELFITD 240

Query: 245 WHYD----------------------QQLSQWNYMSDDSASTMYIPLQEEEADYNACVLS 282
              D                      ++   +    +    T +   +  E  +NA VL 
Sbjct: 241 LDLDIATRYNLYEGKRKSFKANAELEEKEISFTLRDNIEFLTSHRIAEGIEEIFNALVLG 300

Query: 283 LRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAAC 342
           LRDYV+KN F  V +GLSGG+DS+L A IAV+ALG+ENV  +++P +YTS  S+EDA   
Sbjct: 301 LRDYVKKNGFSTVTLGLSGGMDSSLAACIAVEALGRENVVGVLMPSEYTSNTSIEDAKML 360

Query: 343 AKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAML 402
           AK LG K   +PI  + + +   +S   +     +  ENIQ+RIRGNILMALSN    ++
Sbjct: 361 AKNLGIKTLTVPITAIYHSYLGTLSDAFKGREQDVTEENIQARIRGNILMALSNKFGWLV 420

Query: 403 LTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPP 462
           L T NKSE++ GY TLYGDM+GGF  LKD+YKT V++LA + N           TE+IP 
Sbjct: 421 LATGNKSELATGYATLYGDMAGGFAVLKDVYKTDVYRLADYFNRT-------KKTEIIPR 473

Query: 463 SILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHL 521
            + EK PSAELRP+QTDQ++LPPY  LD I+K  +E   S     +  +++ TV +   L
Sbjct: 474 RVFEKPPSAELRPNQTDQDTLPPYETLDKILKLFIEEGLSANEILEHGFDNNTVNFTLKL 533

Query: 522 LYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           L  +EYKRRQ   G KI+ ++FG+D   PI+N +
Sbjct: 534 LKKNEYKRRQGAPGIKISRRAFGKDWRMPITNDY 567


>gi|152996972|ref|YP_001341807.1| NAD+ synthetase [Marinomonas sp. MWYL1]
 gi|150837896|gb|ABR71872.1| NAD+ synthetase [Marinomonas sp. MWYL1]
          Length = 545

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 223/556 (40%), Positives = 327/556 (58%), Gaps = 18/556 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEAN-RQGMDLILFTELFISGYPPEDLVFKKSF 62
            L+IA+AQL+ +VGDI  N      A  +A   +  D+++F EL ++GYPPEDL+ + S 
Sbjct: 2   TLRIAMAQLDMLVGDITKNTQSVIDAANKARDEERADVVVFPELTLTGYPPEDLLLRSSL 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
                SA+  L ++       +VVG+PR+    + N   ++  G ++    K  LPN+  
Sbjct: 62  DTRIESALAKLLAEV--HDIYVVVGYPRRIDGELFNCAGVIYQGQLLVEYAKQKLPNFLV 119

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F +KR F  G     +  + +++G+ ICEDIW    I +     GAE + +LNASPY+  
Sbjct: 120 FDDKRYFSEGREAGLVDIKGVKVGLSICEDIWHPGPIAQAKAA-GAELILNLNASPYHIE 178

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K+ +R E++  + + V LPI+YVN +G QDEL+++G SF  + + +   Q   F    + 
Sbjct: 179 KMGEREELLHQRATEVTLPIVYVNYMGAQDELVYEGGSFVVNAKGEKIMQAPWFEAGLYS 238

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
            +   D          +  A ++   L  E + Y A VL LRDY+ KN F  +++GLSGG
Sbjct: 239 IDMIVD---DSQPNKVEPVAGSIAPALGVEASVYQAMVLGLRDYITKNRFKGIVLGLSGG 295

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL  A+AVDA+G + VQ +M+PY YTS  SL DA   A  LG KY VLPI  +V+ F
Sbjct: 296 IDSALSLAVAVDAIGADRVQAVMMPYTYTSSISLHDAEEEANLLGVKYSVLPIETMVSAF 355

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
             +++   +        EN+Q+R RG  LMA+SN    M+LTT NKSE++VGY TLYGDM
Sbjct: 356 TDVLAPEFEGYGKDTTEENLQARTRGVTLMAISNKKGYMVLTTGNKSEMAVGYATLYGDM 415

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
            GG++ LKD++KT VF+L  +RN+         L  VIP  ++ + PSAEL P Q D++S
Sbjct: 416 VGGYSVLKDVFKTLVFKLCRYRNT---------LGYVIPERVITRPPSAELAPDQKDEDS 466

Query: 483 LPPYPILDDIIKRIVENEESFINNDQ--EYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           LP Y ILD+I++  +E ++S        +++ ETV  V  L+  +EYKRRQAP G +ITA
Sbjct: 467 LPSYDILDEILRMYIEEDQSAEAILATNQFDRETVYRVLRLVDVNEYKRRQAPTGVRITA 526

Query: 541 KSFGRDRLYPISNKFR 556
           + FGRDR YPI+N + 
Sbjct: 527 RGFGRDRRYPITNGWH 542


>gi|222111153|ref|YP_002553417.1| NAD(+) synthetase [Acidovorax ebreus TPSY]
 gi|221730597|gb|ACM33417.1| NAD+ synthetase [Acidovorax ebreus TPSY]
          Length = 554

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 231/560 (41%), Positives = 324/560 (57%), Gaps = 21/560 (3%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           I+IAQLN VVGD+ GN  K   A  +A+  G  L+L  EL + GY  EDL  + +F+QAC
Sbjct: 5   ISIAQLNFVVGDVPGNAQKILAAARDAHAAGARLLLTPELALCGYAAEDLYLRPAFVQAC 64

Query: 67  SSAIDTLKSDTHDG-GAGIVVGFPRQDQEGV--------LNSVVILDAGNIIAVRDKINL 117
             A++ L + T D  G  +VVG PR+   GV         N+  +L AG I     K  L
Sbjct: 65  EQALEGLAAATADWPGLTVVVGHPRRVAHGVGEGGRGLCHNAASVLRAGRIEHTYAKQYL 124

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           PNY  F E+R F+ G  N       +R+G+LICED W      +  ++ GA+ L +LNAS
Sbjct: 125 PNYEVFDERRYFVPGDENCVFEVDGVRMGLLICEDAWYPGP-ARSAREAGAQVLVTLNAS 183

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY+  K  +R +++  ++    LP++Y + VGGQDE++F+G SF  +    +A +   F 
Sbjct: 184 PYHLGKAVEREQVMRERVLETGLPLVYAHLVGGQDEVVFEGRSFALNADGSVAARAPGFE 243

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           E+  + +    Q                      E   ++A VL +RDYV KN F  V++
Sbjct: 244 EKTLLIKVQQAQAAIVLEAPVAPHEGW-------EAELWSALVLGVRDYVGKNGFPGVLL 296

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGG+DSAL  AIAVDALG + V+T+M+P  YT+  S  DA   A  LG +YD + I  
Sbjct: 297 GLSGGMDSALVLAIAVDALGADKVRTVMMPSPYTADISWIDARDMAGRLGVRYDEIAIAP 356

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
               F + ++      P     EN+Q+RIRG +LMALSN   +++LTT NKSE++ GY T
Sbjct: 357 QFEAFKTALAPQFASLPEDTTEENLQARIRGMLLMALSNKFGSLVLTTGNKSELATGYCT 416

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGF  +KD+ KT+VF LA WRN++      G     IP  I+ + PSAELRP Q
Sbjct: 417 LYGDMAGGFAVIKDVVKTRVFALARWRNANDPY---GTGANPIPERIITRPPSAELRPDQ 473

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINND-QEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            DQ+SLPPY +LD I++R +EN+E   +     +    V  V  L+  +EYKRRQAPVG 
Sbjct: 474 KDQDSLPPYEVLDAIVERYMENDEPLEDIVRAGFERADVERVTRLIKLNEYKRRQAPVGV 533

Query: 537 KITAKSFGRDRLYPISNKFR 556
           ++T +SFG+D  YPI+N+FR
Sbjct: 534 RVTRRSFGKDWRYPITNRFR 553


>gi|37527188|ref|NP_930532.1| NAD synthetase [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36786622|emb|CAE15684.1| NH(3)-dependent NAD+ synthetase [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 540

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 237/556 (42%), Positives = 337/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN ++GDI GN  +  +  +E  +Q  DL++F+EL ISGY PEDL+F+ 
Sbjct: 1   MSRTLNIALAQLNWMIGDIEGNCERMLQTVQEQQQQNADLVMFSELAISGYSPEDLLFRA 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C   +  L++ +      I+VG P +    + N++ +   G I+A   K  LPNY
Sbjct: 61  DFHQRCREQLARLQAAS--CQIAILVGHPWEQDGEIYNALSLFWQGEILARYFKQRLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G  +  + F+   LG+LICED+W +      LK+ GA+ + S+NASPY 
Sbjct: 119 GVFDEKRYFKAGDQSCVVPFKGYNLGLLICEDLWFDEP-IDALKQAGADLVLSINASPYS 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R+E++        LP+IY+NQVGGQDELIFDG S  F+   ++  ++  F+EQ 
Sbjct: 178 REKPYIRYELIREHCRRTELPMIYLNQVGGQDELIFDGCSKVFNASGEVTHRLAAFNEQI 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
               +         N +  +        L   +  Y A VLS+ DYV+KN F  V++GLS
Sbjct: 238 QQCCF---------NELKIEPMVNPAPELPPLQQVYQALVLSVHDYVRKNGFQGVLLGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDALGKE+VQ +M+P++YTS  S+EDA   A  LG +++V+ I  + +
Sbjct: 289 GGIDSGLTLAIAVDALGKEHVQAVMMPFRYTSEMSIEDAKKQADMLGVEFNVVSIEPVFD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F +               EN+Q+R R  ILMA+SN    ++LTTSNKSE +VGY TLYG
Sbjct: 349 AFMAQFEPLFAGTAKDTTEENLQARCRAVILMAMSNKRHRLVLTTSNKSESAVGYSTLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFN LKD+ KT VF LA +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 409 DMAGGFNALKDVPKTLVFALAKYRNT---------VSPAIPQRVIDRPPSAELAPGQLDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILDDI++  VE ++S        ++++ VR V  L+  +EYKRRQAPVG +IT
Sbjct: 460 DSLPPYDILDDILEGYVEQDKSVDGLVAAGFDEQIVRKVVRLVDINEYKRRQAPVGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 520 LRNFGKDRRYPITSGF 535


>gi|294084249|ref|YP_003551007.1| glutamine-dependent NAD(+) synthetase [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663822|gb|ADE38923.1| Glutamine-dependent NAD(+) synthetase [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 561

 Score =  486 bits (1252), Expect = e-135,   Method: Composition-based stats.
 Identities = 239/559 (42%), Positives = 332/559 (59%), Gaps = 13/559 (2%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           K + IA+AQLN  +G+IA N+     ARE+AN  G D+I+  E+F+SGYP +DLV +  F
Sbjct: 4   KPISIALAQLNSHLGNIAANVECLIDAREKANAGGADIIVTPEMFLSGYPCDDLVLRSDF 63

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQE----GVLNSVVILDAGNIIAVRDKINLP 118
           +   ++ I  L   T DGGA I+VG P ++Q+     + NSV +LD G II  RDK+NLP
Sbjct: 64  MHEVAAGIARLTQVTADGGAAIIVGAPYREQDGDVVRIYNSVFVLDDGKIIGRRDKVNLP 123

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           NY  F +KR F +G    P++ R ++LG+ +CEDIW      + L++ GA+ + SLNASP
Sbjct: 124 NYGVFDDKRNFTAGAMPGPVLVRGLKLGLPVCEDIWTPDV-VECLQESGADMIVSLNASP 182

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           +   K  +R      +     LP++YVN +GGQDEL+FDG SF  +    LA  +  FS+
Sbjct: 183 FDSRKNDQRMAHAVSRTIESSLPLLYVNLIGGQDELVFDGGSFALNADGNLATHLPSFSQ 242

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
                +   D                +  P ++  A Y   +L +RDYVQKN F  V++G
Sbjct: 243 AVVQVQVKSDFGALSLT-------GQITPPDEDLAAIYRGLMLGVRDYVQKNGFPGVVLG 295

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL AAIA DALG + V  +M+P  YTS +SLEDAA  A   G + D + I   
Sbjct: 296 LSGGIDSALVAAIAADALGADAVHAVMMPSPYTSDESLEDAADLASRFGMRLDTISIGPA 355

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           +     +++     +   I  ENIQSR+RG ILM +SN + AM++ T NKSE + GY TL
Sbjct: 356 MAAMDEMLADQFAGKDPDIAEENIQSRLRGTILMGISNKNGAMVMATGNKSEYAAGYSTL 415

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM GGF P+KD++K QVF L  WRN++      GP  EVIP  I++K PSAELRP Q 
Sbjct: 416 YGDMCGGFAPIKDVWKVQVFDLCHWRNANLPRGAAGPEGEVIPKRIIDKPPSAELRPDQK 475

Query: 479 DQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           D +SLPPY  LD I++ + E+         Q Y+ + V     LL+ +E+KR QA  G K
Sbjct: 476 DTDSLPPYERLDAIMQALTEDAADIDAIVAQGYDIKEVAQASQLLFRAEFKRFQAAPGPK 535

Query: 538 ITAKSFGRDRLYPISNKFR 556
           +T+ +FGRDR  P+++ F 
Sbjct: 536 MTSIAFGRDRRLPLTSGFS 554


>gi|312795378|ref|YP_004028300.1| glutamine-dependent NAD(+) synthetase [Burkholderia rhizoxinica HKI
           454]
 gi|312167153|emb|CBW74156.1| Glutamine-dependent NAD(+) synthetase (EC 6.3.5.1) [Burkholderia
           rhizoxinica HKI 454]
          Length = 559

 Score =  486 bits (1251), Expect = e-135,   Method: Composition-based stats.
 Identities = 224/572 (39%), Positives = 320/572 (55%), Gaps = 34/572 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQ+N  VGD AGNIAK   A + A+  G  L++  EL +SGYPPEDL+ + +F  
Sbjct: 1   MKIALAQINVTVGDFAGNIAKIVAAAQTAHDAGASLMIAPELALSGYPPEDLLLRPAFYT 60

Query: 65  ACSSAIDTLKS-DTHDGGAGIVVGFPRQDQEG-----------------VLNSVVILDAG 106
           A  +A+  L +  +   G  ++VG P +                       N+  +L  G
Sbjct: 61  ASHAALSELAAQLSRFAGLRVLVGHPYRSAPTGDVNPNRPLERGVPPVDTFNAASLLAEG 120

Query: 107 NIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQ 166
            I+    K  LPN   F EKR F S           ++ G++ICED W  S      K  
Sbjct: 121 RIVGTYRKQELPNTEVFDEKRYFASNPQPFVFELEGVKFGVIICEDAWHPSAAL-LAKAA 179

Query: 167 GAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQ 226
           GA+ L   N SPY+ NK   R +I+  +I    +P +Y+N VG QDEL+FDG SF  D  
Sbjct: 180 GAQVLLVPNGSPYHVNKEDVRVDILRERIRETGMPAVYLNLVGAQDELVFDGGSFVLDAH 239

Query: 227 QQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDY 286
            +L  ++  F EQ  + E+   Q         +            E   Y A VL +RDY
Sbjct: 240 GELMARLPQFVEQTAIVEFDGAQAQRGEIAPRECV----------EAQVYAALVLGVRDY 289

Query: 287 VQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKAL 346
           + KN F   IIGLSGG+DSAL  A+A DALG E V+ +M+P +YT+  S+ DAA  A+ +
Sbjct: 290 LNKNGFPGAIIGLSGGVDSALVLAVACDALGAERVRAVMMPSRYTADMSMSDAAEMARRV 349

Query: 347 GCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTS 406
           G +YD + I  + + F + ++      P     ENIQ+RIRG +LMALSN   +++LTT 
Sbjct: 350 GVRYDEIAIGPMFDAFRASLAAQFAGLPEDATEENIQARIRGTLLMALSNKFGSIVLTTG 409

Query: 407 NKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILE 466
           NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+           ++IP  IL 
Sbjct: 410 NKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCRYRNAATTF----ATRDIIPERILT 465

Query: 467 KSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGS 525
           ++PSAELR +QTDQ+SLPPY +LD I++  +E + S        Y  + V+ V  L+  +
Sbjct: 466 RAPSAELRENQTDQDSLPPYEVLDAIMRMYMEEDRSLEGIVAAGYARDDVQRVTRLIKIN 525

Query: 526 EYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           EYKRRQAP+G ++T ++FGRD  YPI++ F +
Sbjct: 526 EYKRRQAPIGIRVTHRAFGRDWRYPITSHFSE 557


>gi|332530579|ref|ZP_08406516.1| NAD+ synthetase [Hylemonella gracilis ATCC 19624]
 gi|332039985|gb|EGI76374.1| NAD+ synthetase [Hylemonella gracilis ATCC 19624]
          Length = 565

 Score =  486 bits (1251), Expect = e-135,   Method: Composition-based stats.
 Identities = 238/577 (41%), Positives = 323/577 (55%), Gaps = 34/577 (5%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   L++ +AQ N VVGD++GN  K      +A  QG+ L+L  EL I GY  EDL+ + 
Sbjct: 1   MS--LRLGVAQSNFVVGDLSGNAQKIIATARQACTQGVHLLLTPELAICGYAAEDLLLRP 58

Query: 61  SFIQACSSAIDTLKSDTHDG-GAGIVVGFPRQDQEG-----------VLNSVVILDAGNI 108
           SFI AC  A+ T+  +  D  G  +VVG P   ++G             N+  +L AG +
Sbjct: 59  SFIAACDEAVRTVAKELADLEGLTVVVGHPAATEDGGWRTRSVMRPGRFNAASVLRAGQV 118

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRD----IRLGILICEDIWKNSNICKHLK 164
           IA   K  LPNY  F E+R F  G               R+G+LICED W ++   +  +
Sbjct: 119 IARYAKRELPNYQVFDERRYFEPGDQPCVFEVEADGERTRVGLLICEDSWFDNP-ARETR 177

Query: 165 KQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFD 224
             GAE L  +NASP++  K  +R   +  ++    LP++Y + VGGQDE +F+G SF   
Sbjct: 178 AAGAELLAVINASPFHAGKGDERETAMAQRVRDHGLPLVYAHLVGGQDEAVFEGRSFALQ 237

Query: 225 GQQQ----LAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACV 280
              +    LA +   F+E  F+ +   D    + +         +      +   ++A V
Sbjct: 238 PSGEGEVSLAARAPSFAEDLFVMDARRDAAGLRLS-------GPIAPERDRDADLWDALV 290

Query: 281 LSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAA 340
           L +RDYV KN F   IIGLSGGIDSAL  AIAVDALG   V+T+M+P  YT+  S  DA 
Sbjct: 291 LGVRDYVGKNGFPGAIIGLSGGIDSALVLAIAVDALGPAKVRTVMMPSPYTADISWIDAR 350

Query: 341 ACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKA 400
             A  L  +YD + I      F + ++Q     P     ENIQ+RIRG +LMALSN S  
Sbjct: 351 DMAARLRVQYDEISIVPEFEAFKTSLAQEFAGLPEDTTEENIQARIRGTLLMALSNKSGR 410

Query: 401 MLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVI 460
           ++LTT NKSE++ GY TLYGDM+GGF  +KD+ KT VF+LA WRN+H      G  T  I
Sbjct: 411 IVLTTGNKSEMATGYCTLYGDMAGGFAVIKDVLKTTVFRLARWRNAHDPY---GTGTAPI 467

Query: 461 PPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVE 519
           P  I+ + PSAELRP QTDQ+SLPPY +LD I++R +EN++S        Y    V  V 
Sbjct: 468 PERIITRPPSAELRPDQTDQDSLPPYEVLDAIVERYMENDDSVEAIVAAGYARADVERVT 527

Query: 520 HLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
            LL  +EYKRRQAPVG ++T + FG+D  YPI+NKFR
Sbjct: 528 RLLRLNEYKRRQAPVGIRVTHRGFGKDWRYPITNKFR 564


>gi|120602568|ref|YP_966968.1| NAD+ synthetase [Desulfovibrio vulgaris DP4]
 gi|120562797|gb|ABM28541.1| NH(3)-dependent NAD(+) synthetase [Desulfovibrio vulgaris DP4]
          Length = 559

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 211/568 (37%), Positives = 310/568 (54%), Gaps = 31/568 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+A+ Q++ VVGDI GN A+   A  EA   G  L +  EL + GYPP DL+ +  F+ 
Sbjct: 1   MKVALLQIDTVVGDIVGNAARIADAVREAASLGARLCVTPELALCGYPPRDLLLQDDFVP 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQD----QEGVLNSVVILDAGNIIAVRDKINLPNY 120
           AC  A++ L     D    ++VG P  +       + N  V+L  G +     K+ LPNY
Sbjct: 61  ACRKALEALAQQLRDL-PPVLVGAPVPNPSPVGNPIHNCAVLLREGKVTVATRKVLLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAE----------- 169
             F E+R F SG     +     R G+ ICED+W +    +  +    +           
Sbjct: 120 DVFDERRYFESGVGCGVVTIDGWRFGVTICEDVWNDKTFWQEHRHYENDPVADLMAGGAD 179

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            + +L+ASP+   K   R  +++       + ++Y NQVGG D+L+F G S  FD    L
Sbjct: 180 AILNLSASPFTLGKQAVRERMLSRVAFRYRVSVLYANQVGGNDDLVFAGKSIAFDATGTL 239

Query: 230 AFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQK 289
             + + F+E   M +             +  + +    P  +EE  + A VL  RDY +K
Sbjct: 240 IARGRSFAEDIVMVDV------------AQATGTITAEPTSDEEQVWKALVLGTRDYARK 287

Query: 290 NNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCK 349
             F   ++GLSGGIDSAL AA+A +ALG + V  +++P  ++S  S+ DA A A +LG  
Sbjct: 288 CGFEGAVLGLSGGIDSALVAAVAAEALGPDKVLGVLMPSPHSSEGSVTDALALASSLGIA 347

Query: 350 YDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKS 409
              +PI DL++ F + ++Q      + +  ENIQSRIRGN+LMALSN  + +LLTT NKS
Sbjct: 348 TCTIPIGDLMHGFEAALAQAFAGREADVTEENIQSRIRGNLLMALSNKQRRLLLTTGNKS 407

Query: 410 EISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLG--PLTEVIPPSILEK 467
           E++VGY T+YGDM+GG   + DL KT V+++A W N    + G       E IP +IL K
Sbjct: 408 ELAVGYCTIYGDMAGGLAVIADLPKTLVYRVAHWLNERDTSHGHEGCEARETIPSAILTK 467

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSE 526
            PSAELRP Q D +SLPPY +LD I++R+VE   S  +     Y+ ETVR V  L+  +E
Sbjct: 468 EPSAELRPGQRDSDSLPPYDVLDGILERLVELRRSAADIVAEGYDVETVRKVLRLVCNAE 527

Query: 527 YKRRQAPVGTKITAKSFGRDRLYPISNK 554
           +KRRQAP G K+T ++FG     P++ +
Sbjct: 528 FKRRQAPPGLKVTDRAFGTGWRMPVAAR 555


>gi|46580021|ref|YP_010829.1| glutamine-dependent NAD+ synthetase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449437|gb|AAS96088.1| glutamine-dependent NAD+ synthetase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311233980|gb|ADP86834.1| NAD+ synthetase [Desulfovibrio vulgaris RCH1]
          Length = 559

 Score =  486 bits (1250), Expect = e-135,   Method: Composition-based stats.
 Identities = 211/568 (37%), Positives = 310/568 (54%), Gaps = 31/568 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+A+ Q++ VVGDI GN A+   A  EA   G  L +  EL + GYPP DL+ +  F+ 
Sbjct: 1   MKVALLQIDTVVGDIVGNAARIADAVREAASLGARLCVTPELALCGYPPRDLLLQDDFVP 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQD----QEGVLNSVVILDAGNIIAVRDKINLPNY 120
           AC  A++ L     D    ++VG P  +       + N  V+L  G +     K+ LPNY
Sbjct: 61  ACRKALEALAQQLRDL-PPVLVGAPVPNPSPVGNPIHNCAVLLREGKVTVATRKVLLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAE----------- 169
             F E+R F SG     +     R G+ ICED+W +    +  +    +           
Sbjct: 120 DVFDERRYFESGVGCGVVTIDGWRFGVTICEDVWNDKTFWQEHRHYENDPVADLMAGGAD 179

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            + +L+ASP+   K   R  +++       + ++Y NQVGG D+L+F G S  FD    L
Sbjct: 180 AILNLSASPFTLGKQAVRERMLSRVAFRYRVSVLYANQVGGNDDLVFAGKSIAFDATGTL 239

Query: 230 AFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQK 289
             + + F+E   M +             +  + +    P  +EE  + A VL  RDY +K
Sbjct: 240 IARGRSFAEDIVMVDV------------AQATGTITAEPTSDEEQVWKALVLGTRDYARK 287

Query: 290 NNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCK 349
             F   ++GLSGGIDSAL AA+A +ALG + V  +++P  ++S  S+ DA A A +LG  
Sbjct: 288 CGFDGAVLGLSGGIDSALVAAVAAEALGPDKVLGVLMPSPHSSEGSVTDALALASSLGIA 347

Query: 350 YDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKS 409
              +PI DL++ F + ++Q      + +  ENIQSRIRGN+LMALSN  + +LLTT NKS
Sbjct: 348 TCTIPIGDLMHGFEAALAQAFAGREADVTEENIQSRIRGNLLMALSNKQRRLLLTTGNKS 407

Query: 410 EISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLG--PLTEVIPPSILEK 467
           E++VGY T+YGDM+GG   + DL KT V+++A W N    + G       E IP +IL K
Sbjct: 408 ELAVGYCTIYGDMAGGLAVIADLPKTLVYRVAHWLNERDTSHGHEGREARETIPSAILTK 467

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSE 526
            PSAELRP Q D +SLPPY +LD I++R+VE   S  +     Y+ ETVR V  L+  +E
Sbjct: 468 EPSAELRPGQRDSDSLPPYDVLDGILERLVELRRSAADIVAEGYDVETVRKVLRLVCNAE 527

Query: 527 YKRRQAPVGTKITAKSFGRDRLYPISNK 554
           +KRRQAP G K+T ++FG     P++ +
Sbjct: 528 FKRRQAPPGLKVTDRAFGTGWRMPVAAR 555


>gi|114569533|ref|YP_756213.1| NH(3)-dependent NAD(+) synthetase [Maricaulis maris MCS10]
 gi|114339995|gb|ABI65275.1| NH(3)-dependent NAD(+) synthetase [Maricaulis maris MCS10]
          Length = 552

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 258/560 (46%), Positives = 361/560 (64%), Gaps = 11/560 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  ++ +  AQLNPVVGD+AGN+AKAR A  EA  +G D+++F E+F+ GYPPEDLV K 
Sbjct: 1   MTDRIILVTAQLNPVVGDVAGNLAKARAAHAEAKTRGGDMVVFPEMFLLGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S ++AC SA+D L + T D G  I++G P +    + N+V +LD G ++A+R K  LPNY
Sbjct: 61  SAVEACRSALDALAAITRD-GPAILIGLPWKQNSCLYNAVALLDEGRLVALRFKRELPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F EKR F +G   D + +R I+LG+ ICED+W      + L  +GAE + +LN SP+ 
Sbjct: 120 AVFDEKRVFEAGPLPDIVKWRGIKLGLPICEDLWLGDVP-RALIDKGAEMIITLNGSPWR 178

Query: 181 HNKLKKRHEIVTGQISHVHLP--IIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
               ++R +  +G       P  +I+VNQVGGQDEL+FDGASF  D + +   ++  F E
Sbjct: 179 RTIERERKQAFSGWFDSWASPKAMIFVNQVGGQDELVFDGASFSRDSEGREVQRLPAFEE 238

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
                EW       + +     +   +       EAD+ A   +L DY+ KN F  V++G
Sbjct: 239 AIDAVEW------VRTDKGWFGAGGQIVSVKSGLEADWKAMTRALGDYIGKNGFPGVVLG 292

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           +SGGIDSA+ AAIAVDALG + V  +M+P KYTS +S EDA ACA+ALG +YD++ +   
Sbjct: 293 MSGGIDSAISAAIAVDALGADKVWAVMMPSKYTSQESFEDAKACAEALGIRYDIIDVEPT 352

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
           +  F +++S   +        EN+QSR RG +LMALSN    M+L+T NKSE++VGY TL
Sbjct: 353 IASFNAILSTPFKGTKPDTTEENLQSRARGVVLMALSNKFGPMVLSTGNKSEMAVGYATL 412

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GG+N LKD+YKT+VF+LA WRNS     GLGP+ +VIP  I+ K PSAEL   Q 
Sbjct: 413 YGDMNGGYNALKDIYKTEVFELAWWRNSANHQVGLGPVGQVIPERIITKPPSAELAEDQK 472

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           D++SLPPY +LD I+  ++E E S        +++  V+ +E+LLY +EYKRRQAP G K
Sbjct: 473 DEDSLPPYDVLDAILYGLIEEERSVRELVADGHDEAEVKRIENLLYRAEYKRRQAPPGVK 532

Query: 538 ITAKSFGRDRLYPISNKFRD 557
           I  K+FGRDR YPI+N+FR+
Sbjct: 533 IGPKNFGRDRRYPITNRFRN 552


>gi|58581218|ref|YP_200234.1| NAD synthetase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58425812|gb|AAW74849.1| NH3-dependent NAD synthetase [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 552

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 221/566 (39%), Positives = 313/566 (55%), Gaps = 26/566 (4%)

Query: 1   MLK------KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPP 53
           M++       L+IA+AQ +  VG +  N  +       A  +   D++LF EL ISGYPP
Sbjct: 1   MMESAVTAHTLRIAMAQFDFPVGGVTQNTDRIIEYIAAARDEFEADIVLFPELAISGYPP 60

Query: 54  EDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRD 113
           EDL+ +  F+  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   
Sbjct: 61  EDLLLRPGFLAHCEQALARIAAATR--GIVAVVGWPQSAGSVVYNAASVLRDGRIEATYR 118

Query: 114 KINLPNYSEFHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFL 171
           K  LPNY+ F E+R F       N  +  + +++G++ICED+W    +     K GAE +
Sbjct: 119 KRELPNYAVFDERRYFDVDPDGENCVVTVKGVQVGVVICEDLWFAEPLANT-VKAGAELV 177

Query: 172 FSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAF 231
              NASPY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +  
Sbjct: 178 LVPNASPYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHP 237

Query: 232 QMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNN 291
               F +Q  + ++   ++        DD   +M      +   + A V  L+DY  KN 
Sbjct: 238 AAAAFVDQWLVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYCSKNG 291

Query: 292 FHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYD 351
           F KV +GLSGGIDSAL  A+AVDALG +NV  + LP +YT+  S + A    +ALG K +
Sbjct: 292 FSKVWLGLSGGIDSALVLAMAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALGVKLE 351

Query: 352 VLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEI 411
            + I        + +          I  EN+QSR RG ILMALSN    ++LTT NKSE 
Sbjct: 352 TVAIEPAFEGLLAALGPLFAGTEPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEY 411

Query: 412 SVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSA 471
           +VGY T+YGDM GG+ PLKDLYKT+VF LA WRN+            VIPP+++ + PSA
Sbjct: 412 AVGYATIYGDMCGGYAPLKDLYKTEVFGLAKWRNT-------VDGAPVIPPAVISRPPSA 464

Query: 472 ELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRR 530
           ELR +QTDQ+SLPPY +LD I+ R V+ E+S  +     Y  ETV +V  L+  +E+KR 
Sbjct: 465 ELRDNQTDQDSLPPYDVLDAILYRYVDQEQSRDDIVAAGYAAETVEHVLRLVRLNEWKRH 524

Query: 531 QAPVGTKITAKSFGRDRLYPISNKFR 556
           Q+  G K++ ++FGR+R YPI+N +R
Sbjct: 525 QSAPGPKVSRRAFGRERRYPITNGYR 550


>gi|17547066|ref|NP_520468.1| NAD synthetase [Ralstonia solanacearum GMI1000]
 gi|17429367|emb|CAD16054.1| probable nh3-dependent nad+ synthetase signal peptide protein
           [Ralstonia solanacearum GMI1000]
          Length = 546

 Score =  485 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 221/562 (39%), Positives = 319/562 (56%), Gaps = 31/562 (5%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           +A+AQ+N  VGD+AGN A+   A  EA++ G  +++  EL ++GYPPEDL+ + +F+ A 
Sbjct: 5   VALAQINCTVGDLAGNAARIVAAAREAHQAGARILVTPELSLTGYPPEDLLLRPAFLDAA 64

Query: 67  SSAIDTL-KSDTHDGGAGIVVGFP-----RQDQE----GVLNSVVILDAGNIIAVRDKIN 116
           S A+D L        G  +++G P                 N+  +   G ++    K+ 
Sbjct: 65  SRALDALVAELAAFAGLHVLIGHPQLLFEAPAPGSALPKPTNTATVAVDGRVLGQYHKLE 124

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LPN   F EKR F  G           R G+++CED W         K  GA+ +   NA
Sbjct: 125 LPNNEVFDEKRYFQVGGEPFVFDVEGTRFGVILCEDAWYPKATA-WAKAAGAQVVLIPNA 183

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY+ +K   R +I+  ++    LP +YVN VGGQDEL+FDG SF  D   + A +M  F
Sbjct: 184 SPYHLDKEDLREQIIGARVQESGLPHVYVNLVGGQDELVFDGGSFVLDAHGKPAARMAQF 243

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E      +   + L             +      E   Y A  L +RDY+ KN F   I
Sbjct: 244 VEGVGYVRFDGARPLPG----------EIAPEATLEAQVYAALKLGVRDYIGKNGFPGAI 293

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           IGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA   A  LG +YD LPI 
Sbjct: 294 IGLSGGVDSALVLAIAVDALGADRVRAVMMPSRYTADISWLDARDMAARLGVRYDELPIM 353

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            + + F   +++  ++ P     ENIQ+RIRG +LMALSN S  ++LTT NKSE++VGY 
Sbjct: 354 PMFDAFRGALAEEFRDLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSEMAVGYC 413

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGF  +KD++KT V++L  +RN+         L+EVIP  IL ++PSAELR +
Sbjct: 414 TLYGDMAGGFAVIKDIFKTLVYRLCRYRNA---------LSEVIPERILTRAPSAELREN 464

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           QTDQ+SLP Y  LD I++R +E  +         + +  V+ +  L+  +EYKRRQAPVG
Sbjct: 465 QTDQDSLPEYDALDAIVQRYMEQNQPVAEIIAAGFAEADVQKIVRLIKINEYKRRQAPVG 524

Query: 536 TKITAKSFGRDRLYPISNKFRD 557
            ++T ++FGRD  YPI+++F++
Sbjct: 525 IRVTQRAFGRDWRYPITSRFKE 546


>gi|330825694|ref|YP_004388997.1| NAD+ synthetase [Alicycliphilus denitrificans K601]
 gi|329311066|gb|AEB85481.1| NAD+ synthetase [Alicycliphilus denitrificans K601]
          Length = 552

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 224/558 (40%), Positives = 314/558 (56%), Gaps = 19/558 (3%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           I+IAQLN VVGD+ GN  K   A  ++   G  L+L  EL I GY  EDL  + +F+ AC
Sbjct: 5   ISIAQLNFVVGDLQGNAQKIIDAARQSYAAGARLLLTPELAICGYAAEDLFLRPAFLAAC 64

Query: 67  SSAIDTLKSDTHDG-GAGIVVGFPRQDQ------EGVLNSVVILDAGNIIAVRDKINLPN 119
             A+  +   T D  G  IV+G PR            LN+  +L AG +     K  LPN
Sbjct: 65  DEAVQAVARGTADLAGLAIVLGHPRAAAPGAPAFSSCLNAASVLRAGRVEQTYAKRELPN 124

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           Y  F E+R F++G +        +R+G+LICED W ++                +NASP+
Sbjct: 125 YQVFDERRYFVAGDAPCVFEVEGVRVGLLICEDAWFSAPARDAAAAGAQLLAV-INASPF 183

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           +  K  +R + +  +++   LP++Y + VGGQDE++F+G SF  +    +A +   F E+
Sbjct: 184 HLGKGAEREQTMRERVAETGLPLVYAHLVGGQDEVVFEGRSFALNADGTVAMRAPAFEEK 243

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
               + H  Q   +           +      E   ++A VL +RDYV KN F   ++GL
Sbjct: 244 LVFAQVHQAQAGIEMEA-------DVAPERSLEADLWDALVLGVRDYVGKNGFPGALLGL 296

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  AIAVDALG + V+T+M+P  YT+  S  DA   A  LG +YD + I    
Sbjct: 297 SGGIDSALVLAIAVDALGADKVRTVMMPSPYTADISWIDARDMAARLGVRYDEIAIAPQF 356

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
             F + ++   +        EN+Q+RIRG +LMALSN   A++LTT NKSE++ GY TLY
Sbjct: 357 EAFKAALAPLFEGRAEDTTEENLQARIRGTLLMALSNKFGAVVLTTGNKSEMATGYCTLY 416

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GGF  +KD+ KT+VF LA WRN++      G     IP  I+ + PSAELRP Q D
Sbjct: 417 GDMAGGFAVIKDVVKTRVFDLARWRNANDPY---GTGANPIPERIIIRPPSAELRPDQKD 473

Query: 480 QESLPPYPILDDIIKRIVENEESFINND-QEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           Q+SLPPY +LD I+ R +EN+E   +     Y+   V  V  L+  +EYKRRQAPVG ++
Sbjct: 474 QDSLPPYEVLDAILARYMENDEPVEDIVRAGYDRADVERVTRLIKINEYKRRQAPVGVRV 533

Query: 539 TAKSFGRDRLYPISNKFR 556
           T +SFG+D  YPI+NKFR
Sbjct: 534 TRRSFGKDWRYPITNKFR 551


>gi|78485716|ref|YP_391641.1| NAD+ synthetase [Thiomicrospira crunogena XCL-2]
 gi|78364002|gb|ABB41967.1| NH(3)-dependent NAD(+) synthetase [Thiomicrospira crunogena XCL-2]
          Length = 545

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 228/562 (40%), Positives = 340/562 (60%), Gaps = 22/562 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEAN-RQGMDLILFTELFISGYPPEDLVFK 59
           M ++L I +AQ+NP+VGD+ GN +    + ++A      D+++F E+ ++GYPPEDL+F+
Sbjct: 1   MSEQLTIIMAQINPIVGDVEGNTSLIIESAKQAKMEHQADIVVFPEMTLTGYPPEDLLFR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQ-EGVLNSVVILDAGNIIAVRDKINLP 118
           ++  Q   S++ T+     D    +V+G+P  D+     N    ++ G I A   K NLP
Sbjct: 61  EALYQQVESSLSTICEQVTD--TVLVIGYPMMDELGDRFNMAAWIEDGQIQASYIKQNLP 118

Query: 119 NYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           NYS F EKR F SG     + ++ ++ G+LICEDIWK S       K GA+ L +LNASP
Sbjct: 119 NYSVFDEKRYFSSGQQPCVVEYKGVKFGLLICEDIWKLSP-ADQSVKAGADILLNLNASP 177

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           +   K + R  +V  ++  V  P+IYVNQVGGQDEL+FDG SF    + ++  Q   F  
Sbjct: 178 FSQEKHQDRIRVVKRRVEEVKRPVIYVNQVGGQDELMFDGGSFATCAEGEVQVQGAEFKT 237

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
                +      L Q + +         + LQ E   Y A V+ ++DYV KN F  V++G
Sbjct: 238 DLIPVKI-----LKQADAVVILPGEKAEL-LQNEARVYEALVMGVKDYVHKNGFKGVLLG 291

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL  AIAVDALG   V+ +M+P+KYT+  S+EDA   A+ LG  Y  +PI  +
Sbjct: 292 LSGGIDSALTLAIAVDALGDNQVEAVMMPFKYTADISVEDAEKEAQVLGVHYHSIPIEPI 351

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
            + + S ++   +     +  EN+Q+RIRG +LM++SN +  ++L TSNKSE++VGY TL
Sbjct: 352 YDAYESALASRFEGYEEDVTEENMQARIRGVLLMSISNKTGKLVLATSNKSEVAVGYSTL 411

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM GGF+PLKD+ KT V++LA +RN+         ++ VIP  ++ + PSAELRP Q 
Sbjct: 412 YGDMVGGFSPLKDVPKTLVYRLAEYRNT---------ISSVIPERVITRPPSAELRPDQK 462

Query: 479 DQESLPPYPILDDIIKRIVENEESFINNDQ--EYNDETVRYVEHLLYGSEYKRRQAPVGT 536
           DQ+SLP Y +LD IIK  V+ ++S     +   Y+ + V  +  ++  +EYKRRQA  G 
Sbjct: 463 DQDSLPDYEVLDTIIKAFVKEDKSPAQIVEEFGYDKQEVVRITKMISRNEYKRRQAAPGV 522

Query: 537 KITAKSFGRDRLYPISNKFRDH 558
           KI+ ++FGRDR YPI++++ + 
Sbjct: 523 KISPRAFGRDRRYPITSRYAEE 544


>gi|91788178|ref|YP_549130.1| NAD+ synthetase [Polaromonas sp. JS666]
 gi|91697403|gb|ABE44232.1| NAD+ synthetase [Polaromonas sp. JS666]
          Length = 562

 Score =  485 bits (1248), Expect = e-134,   Method: Composition-based stats.
 Identities = 228/571 (39%), Positives = 312/571 (54%), Gaps = 29/571 (5%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            LKI +AQLN  VGD+ GN  K   A   A   G+ L+L  EL I GY  EDL  + SFI
Sbjct: 2   TLKICVAQLNYCVGDMPGNAQKIIDAARTAYAGGVRLLLTPELAICGYAAEDLFLRPSFI 61

Query: 64  QACSSAIDTLKSDTHDG-GAGIVVGFPRQDQEG------------VLNSVVILDAGNIIA 110
           QAC  A++ +  +     G  +VVG P     G              N+  +L  G ++ 
Sbjct: 62  QACDDAVNLVARELAGLKGLTVVVGTPTGGDNGKGLRTKSVEVQQRHNAARVLREGRVLQ 121

Query: 111 VRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIR----LGILICEDIWKNSNICKHLKKQ 166
              K  LPNY  F E+R F  G         D      +G+LICED W      +  +  
Sbjct: 122 TYAKRELPNYQVFDERRYFTPGQGVCVFQAGDGADAISVGLLICEDAWFEEP-ARLAQAA 180

Query: 167 GAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQ 226
           GAE L  +NASP++  K  +R  ++  ++    LP++Y + VGGQDE++F+G SF     
Sbjct: 181 GAEVLAVINASPFHVGKGGEREVMMRSRVLATGLPLVYAHLVGGQDEIVFEGHSFALQAD 240

Query: 227 QQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDY 286
             LA + + F E  F+TE        +     +            E   ++A VL +RDY
Sbjct: 241 GALAGRAESFKENLFLTEVERTSTAIKLIANIEPGR-------SHEADLWDALVLGVRDY 293

Query: 287 VQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKAL 346
           + KN F   I+GLSGGIDSAL  AIAVDALG + V+T+M+P  YT+  S  DA   A+ L
Sbjct: 294 LGKNGFPGAILGLSGGIDSALVLAIAVDALGADKVRTVMMPSPYTADISWVDAREMAQRL 353

Query: 347 GCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTS 406
             +YD + I      F + ++   +        ENIQ+RIRG  LMALSN   +++LTT 
Sbjct: 354 KVRYDEISIVPEFEAFKASLAHEFKGLKEDTTEENIQARIRGVFLMALSNKFGSIVLTTG 413

Query: 407 NKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILE 466
           NKSE++ GY TLYGDM+GGF  +KDL KT VF+LA WRN +      G     IP  ++ 
Sbjct: 414 NKSEMATGYCTLYGDMAGGFAVIKDLAKTTVFKLARWRNENDPY---GTGANPIPERVIT 470

Query: 467 KSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGS 525
           + PSAELRP QTDQ+SLPPY +LD I++R +EN++S        +    V  V  L+  +
Sbjct: 471 RPPSAELRPDQTDQDSLPPYEVLDAILERYMENDQSVEAIIAAGFERAVVECVARLIKIN 530

Query: 526 EYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           EYKRRQAPVG ++T +SFG+D  YPI++KFR
Sbjct: 531 EYKRRQAPVGIRVTHRSFGKDWRYPITSKFR 561


>gi|302550954|ref|ZP_07303296.1| NH(3)-dependent NAD(+) synthetase [Streptomyces viridochromogenes
           DSM 40736]
 gi|302468572|gb|EFL31665.1| NH(3)-dependent NAD(+) synthetase [Streptomyces viridochromogenes
           DSM 40736]
          Length = 603

 Score =  485 bits (1248), Expect = e-134,   Method: Composition-based stats.
 Identities = 206/592 (34%), Positives = 309/592 (52%), Gaps = 44/592 (7%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
            +L++A+ Q++  VGD+A N     R    +  QG  L+ F E+ ++GYP EDL  + SF
Sbjct: 21  PQLRLALNQIDSSVGDLAQNAESIVRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSF 80

Query: 63  IQACSSAIDTLKSDTHDGG---AGIVVGFPRQD----------QEGVLNSVVILDAGNII 109
           ++A  +A+ +L +   D G     ++VG+  +                N+  +L  G ++
Sbjct: 81  VEASRAALRSLAARLADEGFGELPVIVGYLDRSATAQPKYGQPAGAPQNAGAVLYGGEVV 140

Query: 110 AVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAE 169
               K +LPNY  F E R F+ G S   +    + + + ICED+W++       +   A 
Sbjct: 141 LNYAKHHLPNYGVFDEFRYFVPGDSMPVLRVHGVDVALAICEDLWQDGGRVPAARSARAG 200

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            L S+NASPY  NK   R ++V  +         Y+  +GGQDEL+FDG S   D   ++
Sbjct: 201 LLLSINASPYERNKDDTRLDLVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDKNGEV 260

Query: 230 AFQMKHFSEQNFMTEWHY------------DQQLSQWNYMSDDSASTMYIP--------- 268
             +   FSE   + +               D  L     +  +     Y P         
Sbjct: 261 VARAPQFSEGCVVLDLDLPAASPDAPTGVVDDGLRIDRVVLSEEPLAAYEPELTGGYADR 320

Query: 269 LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPY 328
           L ++E  Y+A V+ LR YV KN F  V+IGLSGGIDS+L AAIA DA+G +NV  + +P 
Sbjct: 321 LDDDEEVYSALVVGLRAYVAKNGFTSVLIGLSGGIDSSLVAAIACDAVGAQNVYGVSMPS 380

Query: 329 KYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRG 388
           KY+S  S +DAA  A+  G  Y  + I  + + +   +        +G+  EN+QSR+RG
Sbjct: 381 KYSSDHSKDDAAELARRTGLNYRTVAIEPMFDAYMGSL------RLTGLAEENLQSRLRG 434

Query: 389 NILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG 448
            +LMA+SN    ++L   NKSE++VGY TLYGD  G + P+KD+YKT +F+L+ WRN   
Sbjct: 435 TLLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLSEWRNRAA 494

Query: 449 ITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-D 507
              G  P    IP + + K PSAELRP Q D +SLP YP+LD I++  V+ +        
Sbjct: 495 RERGQTP---PIPENSITKPPSAELRPGQVDTDSLPDYPVLDAILELYVDRDRGADEIVA 551

Query: 508 QEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
             Y+   V     ++  +EYKRRQ P GTKI+ K FG+DR  PI+N +R+ +
Sbjct: 552 AGYDPALVTKTLRMVDTAEYKRRQYPPGTKISPKGFGKDRRLPITNGWRESV 603


>gi|94501751|ref|ZP_01308265.1| NAD synthase [Oceanobacter sp. RED65]
 gi|94426151|gb|EAT11145.1| NAD synthase [Oceanobacter sp. RED65]
          Length = 543

 Score =  485 bits (1248), Expect = e-134,   Method: Composition-based stats.
 Identities = 222/558 (39%), Positives = 335/558 (60%), Gaps = 20/558 (3%)

Query: 1   MLKK-LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFK 59
           M ++ L + +AQLN VVGDI  N  K   + +++  +G+D+++F EL ++GYPPEDL+ +
Sbjct: 1   MSEQSLSVCLAQLNLVVGDIQSNTQKVLASAKQSVEKGVDVVIFPELTLTGYPPEDLLLR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
            S       A+  ++         +V+G+P+    G+ N   +++ G ++A   K +LPN
Sbjct: 61  PSLKLRVEQALQEIEEAA--LPITLVIGYPKVTASGLQNMAGVIENGRLVAEYAKQHLPN 118

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPY 179
           +  F EKR FI G     +  + + + I ICEDIW+   +    K+ GA+ + +LNASP+
Sbjct: 119 FQVFDEKRYFIEGTQPCVVQIKGLPVAISICEDIWQKGIM-TQAKQAGAKLMLNLNASPF 177

Query: 180 YHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQ 239
           + +K   R  ++  +     +PI+YVN VGGQDEL+FDG S   D Q  +  +   + E 
Sbjct: 178 HIDKPLHREALLKERALEGAMPIVYVNLVGGQDELVFDGGSVVVDQQGNVKSRAITYDEA 237

Query: 240 NFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGL 299
             + E   D           +         ++ ++ Y+A VL  +DYV KN F  V++GL
Sbjct: 238 QPVVELAIDDGAVSSIDGKTEPHR------EKLDSIYSALVLGTKDYVNKNGFKGVVLGL 291

Query: 300 SGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLV 359
           SGGIDSAL  A+AVDALGKE VQ IM+P+KYTS  SL DA   A  LG +Y V+PI  + 
Sbjct: 292 SGGIDSALTLAVAVDALGKERVQAIMMPFKYTSQMSLHDAEDEANRLGVEYKVMPIEPMF 351

Query: 360 NHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLY 419
           + F   ++   +        EN+QSR RG +LMA+SN   +++LTT NKSE++VGY TLY
Sbjct: 352 DAFMGTLADEFEGTKVDTTEENLQSRCRGVLLMAMSNKKGSLVLTTGNKSEMAVGYATLY 411

Query: 420 GDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTD 479
           GDM+GG+  LKD++KT VF+L+ +RN+         L EVIPP ++ + PSAEL P Q D
Sbjct: 412 GDMAGGYGVLKDVFKTLVFELSKYRNT---------LGEVIPPRVISRPPSAELAPDQVD 462

Query: 480 QESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKI 538
           ++SLP YP+LD+I++  +E ++S      + + ++ V  V  L+  +EYKRRQAPVG ++
Sbjct: 463 EDSLPAYPVLDEILRLYIEEDQSAQAIIAKGFKEDEVNRVIRLVDINEYKRRQAPVGVRL 522

Query: 539 TAKSFGRDRLYPISNKFR 556
           T + FGRDR YPI+N +R
Sbjct: 523 TQRGFGRDRRYPITNGWR 540


>gi|268317860|ref|YP_003291579.1| NAD+ synthetase [Rhodothermus marinus DSM 4252]
 gi|262335394|gb|ACY49191.1| NAD+ synthetase [Rhodothermus marinus DSM 4252]
          Length = 571

 Score =  485 bits (1248), Expect = e-134,   Method: Composition-based stats.
 Identities = 215/575 (37%), Positives = 317/575 (55%), Gaps = 38/575 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQLNP+VGD+ GN  K      +A RQG +L++F E+ ++GYPP+DL+   +FI+
Sbjct: 1   MKIALAQLNPIVGDLQGNRRKIVDFAHQAYRQGAELVIFPEMCVAGYPPQDLLDMPAFIE 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQE----GVLNSVVILDAGNIIAVRDKINLPNY 120
           A +  ++T+  +      G+++G P +++      + N+ ++L+ G I+A   K  LP Y
Sbjct: 61  AVAHTVETIALEVPRE-LGVILGAPIRNESPVGKRLFNAALLLEGGRIVARVPKRLLPTY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNIC----------KHLKKQGAEF 170
             F E R F  G     + +R +R+G+ ICED+W N +              L  QG + 
Sbjct: 120 DVFDEYRYFEPGPPQPVVEWRGLRIGLHICEDMWNNEDWAPYHLYDENPIDELAAQGIDL 179

Query: 171 LFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLA 230
             +++ASP+   K  +R  I+ G      +P IYVNQVG   ELIFDG S        + 
Sbjct: 180 FVNISASPFSLGKHDERSRIIEGICREHGVPFIYVNQVGANTELIFDGDSRVHAPDGSIL 239

Query: 231 FQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKN 290
                F E   + +   D              +       E E  ++A VL +RDY  K 
Sbjct: 240 LCAPSFQEALLIWDTEAD-------------YAPYVHRRTEIEDLHDALVLGIRDYFYKT 286

Query: 291 -NFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCK 349
             F KV++GLSGGIDSA+  A+AV ALG E V  + +P KY+SP+S+EDA   A+ LG  
Sbjct: 287 GAFEKVVLGLSGGIDSAVVCALAVAALGPERVVGVAMPSKYSSPESVEDARQLAENLGIT 346

Query: 350 YDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKS 409
           + ++PI   V+ F  ++     + P  +  ENIQ+R+RG  LMALSN  + +LL+T NKS
Sbjct: 347 FHIIPIMPAVDAFREMLRPVFDDLPEDVTEENIQARVRGVTLMALSNKFRYLLLSTGNKS 406

Query: 410 EISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSP 469
           E++VGY TLYGD +GG   L D+YKTQV++LA + N+            VIP  IL K P
Sbjct: 407 EMAVGYVTLYGDTNGGLAVLADVYKTQVYRLARYINARAGRY-------VIPERILTKPP 459

Query: 470 SAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ--EYNDETVRYVEHLLYGSEY 527
           SAELRP Q D +SLPPY +LD I++R +E+ E          ++   V  +   +  +EY
Sbjct: 460 SAELRPGQKDTDSLPPYEVLDVILQRYIEHREEVDEIVAATGFDRALVADILRRVDRNEY 519

Query: 528 KRRQAPVGTKITAKSFGRDRLYPISNKFRDHISEE 562
           KRRQ P G ++T K+FG  R  PI  ++   + EE
Sbjct: 520 KRRQTPPGLRVTGKAFGIGRRLPIVMRWNRAVLEE 554


>gi|261345356|ref|ZP_05973000.1| NAD(+) synthase [Providencia rustigianii DSM 4541]
 gi|282566399|gb|EFB71934.1| NAD(+) synthase [Providencia rustigianii DSM 4541]
          Length = 540

 Score =  484 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 228/556 (41%), Positives = 338/556 (60%), Gaps = 23/556 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL I++AQLN +VGDI GN  +  +  E+   Q  D+++F+EL ++GY PEDL+F+ 
Sbjct: 1   MSRKLNISLAQLNWLVGDIEGNCDRMLQVVEQ-QSQNTDIVMFSELALTGYSPEDLLFRH 59

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F + C + +  L+  + +    I+VG P  +   + N++     G ++A   K  LPNY
Sbjct: 60  DFEERCVAQLKRLQQASGE--CAIIVGHPWYEDSEIYNALSFFYQGKLLARYFKQELPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F +      + F+  RLG+LICEDIW +     ++K  GAE + ++NASPY 
Sbjct: 118 GVFDEPRYFTAAEDTCVVDFKGYRLGLLICEDIWYDEP-IDNVKGAGAELVLTINASPYD 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +K   R +++        LPIIY+NQVGGQDEL+FDGAS     + +  +QM  F EQ 
Sbjct: 177 LHKEHIRSDLLEEHCQRTGLPIIYLNQVGGQDELVFDGASKVLANKGKQVYQMAEFDEQV 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
               +   + +++   + + S +            Y A VL+ RDY+ KN F+  I+GLS
Sbjct: 237 ATVTFEELKLVTEQPKLPEVSTT---------AQVYQALVLATRDYINKNGFNGAILGLS 287

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDA+GKE VQ +M+P++YTS  S+ DA   A+ LG ++D++ I  + +
Sbjct: 288 GGIDSGLTVAIAVDAIGKEQVQAVMMPFRYTSEMSIHDAKEQAELLGVEFDIVSIEPMFD 347

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + +        +    EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 348 AFMTELQPMFAGAQADTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 407

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 408 DMAGGFDVLKDVPKTLVFELAKYRNT---------ISPAIPQRVIDRPPSAELAPGQLDQ 458

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I++  VE + S  +     ++ ETVR V  L+  +EYKRRQAPVG +IT
Sbjct: 459 DSLPPYDVLDAILEGYVEKDLSVTDLIKLGFDKETVRKVVRLVDINEYKRRQAPVGPRIT 518

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 519 MRNFGKDRRYPITSGF 534


>gi|332528122|ref|ZP_08404153.1| NH(3)-dependent NAD(+) synthetase [Rubrivivax benzoatilyticus JA2]
 gi|332112693|gb|EGJ12486.1| NH(3)-dependent NAD(+) synthetase [Rubrivivax benzoatilyticus JA2]
          Length = 552

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 228/570 (40%), Positives = 327/570 (57%), Gaps = 37/570 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+A+AQ N VVGD+AGN  +   A   A  QG  L+L  EL ++GYPPEDL+ + +F+Q
Sbjct: 1   MKVALAQFNAVVGDLAGNSRRLEDAARRAYAQGARLVLAPELALTGYPPEDLLLRPAFMQ 60

Query: 65  ACSSAIDTLKSDTHD-GGAGIVVGFPRQDQEG------------VLNSVVILDAGNIIAV 111
           AC+ A+  L     D  G  +VVG P Q  E               N+  +L  G + A 
Sbjct: 61  ACADALAALADVLRDCEGLHLVVGHPHQFGERGDLRTKSVTVQQRYNAASLLAGGRVQAT 120

Query: 112 RDKINLPNYSEFHEKRTFISGYS----NDPIVFRDIRLGILICEDIWKNSNICKHLKKQG 167
             K  LPNY  F E+R F SG              +R G++ICED W +    +  +  G
Sbjct: 121 YCKRELPNYQVFDERRYFASGRDAGLPPLVFDCEGLRFGVVICEDAWFDEP-ARLARDAG 179

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
           A+ L  LNASP++  K ++R   +  +   V LP+++ + VGGQDE++FDGASF  D   
Sbjct: 180 AQVLCVLNASPFHLGKAEERQARMAERARDVGLPLLFSHLVGGQDEVVFDGASFALDAAG 239

Query: 228 QLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYV 287
           ++  +   F+E+  + ++  D +              +      +   ++A V  +RDY+
Sbjct: 240 EVRARAATFAEELLVVDFDADAR----------PVGPVAEAPDLDRQAWDALVTGVRDYL 289

Query: 288 QKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALG 347
            KN F   IIGLSGGIDSAL  A+AVDALG + V+ +M+P  YT+  S  DA   A  LG
Sbjct: 290 GKNGFPGAIIGLSGGIDSALVLAVAVDALGADKVRAVMMPSPYTADISWIDARDMAARLG 349

Query: 348 CKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSN 407
            +YD + I  + + F + ++            EN+Q+RIRG +LMALSN + A++LTT N
Sbjct: 350 VRYDEIDIAPMFDAFRTALAPQFAGLAEDTTEENLQARIRGTLLMALSNKTGAIVLTTGN 409

Query: 408 KSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEK 467
           KSE++ GY TLYGDM+GGF  +KD+ KT V++LA+WRN+ G         EVIP  I+ +
Sbjct: 410 KSEMATGYCTLYGDMAGGFAVIKDVAKTLVYRLANWRNAQG--------AEVIPQRIITR 461

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSE 526
            PSAELRP QTDQ+SLPPY +LD I+ R +E+++S        +    V  V  L+  +E
Sbjct: 462 PPSAELRPDQTDQDSLPPYEVLDAILARYMEDDQSVEQIVAAGFERADVERVTRLIKINE 521

Query: 527 YKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           YKRRQAPVG +IT ++FGRD  YPI+++FR
Sbjct: 522 YKRRQAPVGIRITHRAFGRDWRYPITSRFR 551


>gi|84623136|ref|YP_450508.1| NAD synthetase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|84367076|dbj|BAE68234.1| NH3-dependent NAD synthetase [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 551

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 220/557 (39%), Positives = 310/557 (55%), Gaps = 20/557 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSF 62
            L+IA+AQ +  VG +  N  +       A  +   D++LF EL ISGYPPEDL+ +  F
Sbjct: 9   TLRIAMAQFDFPVGGVTQNTDRIIEYIAAARDEFEADIVLFPELAISGYPPEDLLLRPGF 68

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           +  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   K  LPNY+ 
Sbjct: 69  LAHCEQALARIAAATR--GIVAVVGWPQSAGSVVYNAASVLRDGRIEATYRKRELPNYAV 126

Query: 123 FHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           F E+R F       N  +  + +++G++ICED+W    +     K GAE +   NASPY 
Sbjct: 127 FDERRYFDVDPDGENCVVTVKGVQVGVVICEDLWFAEPLANT-VKAGAELVLVPNASPYE 185

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      F +Q 
Sbjct: 186 RGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAAFVDQW 245

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + ++   ++        DD   +M      +   + A V  L+DY  KN F KV +GLS
Sbjct: 246 LVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYCSKNGFSKVWLGLS 299

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  A+AVDALG +NV  + LP +YT+  S + A    +ALG K + + I     
Sbjct: 300 GGIDSALVLAMAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALGVKLETVAIEPAFE 359

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + +          I  EN+QSR RG ILMALSN    ++LTT NKSE +VGY T+YG
Sbjct: 360 GLLAALGPLFAGTEPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEYAVGYATIYG 419

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GG+ PLKDLYKT+VF LA WRN+            VIPP+++ + PSAELR +QTDQ
Sbjct: 420 DMCGGYAPLKDLYKTEVFGLAKWRNT-------VDGAPVIPPAVISRPPSAELRDNQTDQ 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I+ R V+ E+S  +     Y  ETV +V  L+  +E+KR Q+  G K++
Sbjct: 473 DSLPPYDVLDAILYRYVDQEQSRDDIVAAGYAAETVEHVLRLVRLNEWKRHQSAPGPKVS 532

Query: 540 AKSFGRDRLYPISNKFR 556
            ++FGR+R YPI+N +R
Sbjct: 533 RRAFGRERRYPITNGYR 549


>gi|299066056|emb|CBJ37237.1| putative nh3-dependent nad+ synthetase (nadE) [Ralstonia
           solanacearum CMR15]
          Length = 565

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 221/562 (39%), Positives = 318/562 (56%), Gaps = 31/562 (5%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           +A+AQ+N  VGD+AGN A+   A  EA++ G  +++  EL ++GYPPEDL+ + +F+ A 
Sbjct: 24  VALAQINCTVGDLAGNAARIVAAAREAHQAGARILVTPELSLTGYPPEDLLLRPAFLDAA 83

Query: 67  SSAIDTL-KSDTHDGGAGIVVGFP-----RQDQE----GVLNSVVILDAGNIIAVRDKIN 116
           S A+D L        G  +++G P                 N+  +   G ++    K+ 
Sbjct: 84  SRALDALVAELAAFAGLHVLIGHPQLLFEAPAPGSALPKPTNTATVAVDGRVLGQYHKLE 143

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LPN   F EKR F  G           R G+++CED W         K  GA+ +   NA
Sbjct: 144 LPNNEVFDEKRYFQVGGEPFVFDVEGTRFGVIVCEDAWYPQATA-WAKAAGAQVVLIPNA 202

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY+ +K   R +I+  ++    LP +YVN VGGQDEL+FDG SF  D   + A +M  F
Sbjct: 203 SPYHLDKEDLREQIIGARVQESGLPHVYVNLVGGQDELVFDGGSFVLDAHGKPAVRMAQF 262

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E      +   + L             +      E   Y A  L +RDY+ KN F   I
Sbjct: 263 VEGVGYVRFDGARPLPG----------EIAPEATLEAQVYEALKLGVRDYIGKNGFPGAI 312

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           IGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA      LG +YD LPI 
Sbjct: 313 IGLSGGVDSALVLAIAVDALGADRVRAVMMPSRYTADISWLDARDMVARLGVRYDELPIM 372

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            + + F   +S+  ++ P     ENIQ+RIRG +LMALSN S  ++LTT NKSE++VGY 
Sbjct: 373 PMFDAFRGALSEEFRDLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSEMAVGYC 432

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGF  +KD++KT V++L  +RN+         L+EVIP  IL ++PSAELR +
Sbjct: 433 TLYGDMAGGFAVIKDIFKTLVYRLCRYRNA---------LSEVIPERILTRAPSAELREN 483

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           QTDQ+SLP Y  LD I++R +E  +         + +  V+ +  L+  +EYKRRQAPVG
Sbjct: 484 QTDQDSLPEYDALDAIVQRYMEQNQPVAEIIAAGFAEADVQKIVRLIKINEYKRRQAPVG 543

Query: 536 TKITAKSFGRDRLYPISNKFRD 557
            ++T ++FGRD  YPI+++F++
Sbjct: 544 IRVTQRAFGRDWRYPITSRFKE 565


>gi|163735249|ref|ZP_02142684.1| NAD synthetase [Roseobacter litoralis Och 149]
 gi|161391463|gb|EDQ15797.1| NAD synthetase [Roseobacter litoralis Och 149]
          Length = 541

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 233/548 (42%), Positives = 321/548 (58%), Gaps = 9/548 (1%)

Query: 12  LNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAID 71
           +NP VGD+AGN A AR         G DL+   E+FI+GY  +DLV K +F       I+
Sbjct: 1   MNPTVGDLAGNAAIAREVWAAGKAAGADLVALPEMFIAGYNAQDLVMKPAFQLDAMRHIE 60

Query: 72  TLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFIS 131
            L  D  D G  + +G P  +   + N+ +IL  G I++   K +LPN + F E R F +
Sbjct: 61  ALAQDCAD-GPTLAIGSPWVEGTKLYNAYLILKGGKIVSQVLKHHLPNETVFDEVRIFDA 119

Query: 132 GYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIV 191
           G    P    + R+G  ICED W      + L + GAEFL   N SPYY  K + R   +
Sbjct: 120 GPLGGPYSVGNSRVGSPICEDAWHEDV-AETLAETGAEFLLVPNGSPYYRGKFETRLNHM 178

Query: 192 TGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQL 251
             ++    LP+IY+N VGGQD+ +FDGASF  +    LA Q+  F E   +     ++  
Sbjct: 179 VARVIETELPLIYLNMVGGQDDQVFDGASFGLNPGGNLAVQLPAFDEA--VAHVDLERGP 236

Query: 252 SQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAI 311
             W  +  + A          E DY   V +LRDY +K  F KV++GLSGG+DSAL A I
Sbjct: 237 EGWRIVEGEKAHHP----DAWEQDYRVMVQALRDYCRKTGFGKVLLGLSGGVDSALVATI 292

Query: 312 AVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQ 371
           AVDA G +NV+ +MLP +YTS +SLEDA A AKALGC YD +PI +        ++   +
Sbjct: 293 AVDAFGAQNVRCVMLPSEYTSAESLEDAEAVAKALGCHYDYVPITEGRAAVEQTLAPLFE 352

Query: 372 EEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKD 431
              + +  ENIQSR+RG +LMA+SN    MLLTT NKSE++VGY T+YGDM+GG+NP+KD
Sbjct: 353 GHDADLTEENIQSRLRGLLLMAMSNKFGEMLLTTGNKSEVAVGYATIYGDMAGGYNPIKD 412

Query: 432 LYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDD 491
           LYKT+VF+   WRN +  +   GP  EVI P +++K PSAELR  Q D +SLP YP LD 
Sbjct: 413 LYKTRVFETCRWRNKNHRSWMEGPDGEVITPRVIDKPPSAELREDQKDSDSLPDYPELDR 472

Query: 492 IIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYP 550
           +++ +V+   S  +      + ET + +EHL+Y SEYKR Q+  G ++T  +F  DR YP
Sbjct: 473 LLEILVDRNGSIEDCVAAGSDAETAKKIEHLIYISEYKRFQSAPGARLTKGAFWLDRRYP 532

Query: 551 ISNKFRDH 558
           I N++RD 
Sbjct: 533 IVNRWRDR 540


>gi|121594129|ref|YP_986025.1| NAD+ synthetase [Acidovorax sp. JS42]
 gi|120606209|gb|ABM41949.1| NAD+ synthetase [Acidovorax sp. JS42]
          Length = 554

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 230/560 (41%), Positives = 323/560 (57%), Gaps = 21/560 (3%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           I+IAQ N VVGD+ GN  K   A  +A+  G  L+L  EL + GY  EDL  + +F+QAC
Sbjct: 5   ISIAQRNFVVGDVPGNAQKILAAARDAHAAGARLLLTPELALCGYAAEDLYLRPAFVQAC 64

Query: 67  SSAIDTLKSDTHDG-GAGIVVGFPRQDQEGV--------LNSVVILDAGNIIAVRDKINL 117
             A++ L + T D  G  +VVG PR+   GV         N+  +L AG I     K  L
Sbjct: 65  EQALEGLAAATADWPGLTVVVGHPRRVAHGVGEGGRGLCHNAASVLRAGRIEHTYAKQYL 124

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           PNY  F E+R F+ G  N       +R+G+LICED W      +  ++ GA+ L +LNAS
Sbjct: 125 PNYEVFDERRYFVPGDENCVFEVEGVRMGLLICEDAWYPGP-ARSAREAGAQVLVTLNAS 183

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           PY+  K  +R +++  ++    LP++Y + VGGQDE++F+G SF  +    +A +   F 
Sbjct: 184 PYHLGKAVEREQVMRERVQETGLPLVYAHLVGGQDEVVFEGRSFALNADGNVAARAPGFE 243

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           E+  + +    Q                      E   ++A VL +RDYV KN F  V++
Sbjct: 244 EKTLLIKVQQAQAAIVLEAPVAPHEGW-------EAELWSALVLGVRDYVGKNGFPGVLL 296

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGG+DSAL  AIAVDALG + V+T+M+P  YT+  S  DA   A  LG +YD + I  
Sbjct: 297 GLSGGMDSALVLAIAVDALGADKVRTVMMPSPYTADISWIDARDMAARLGVRYDEIAIAP 356

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
               F + ++      P     EN+Q+RIRG +LMALSN   +++LTT NKSE++ GY T
Sbjct: 357 QFEAFKTALAPQFAGLPEDTTEENLQARIRGMLLMALSNKFGSLVLTTGNKSELATGYCT 416

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           LYGDM+GGF  +KD+ KT+VF LA WRN++      G     IP  I+ + PSAELRP Q
Sbjct: 417 LYGDMAGGFAVIKDVVKTRVFALARWRNANDPY---GTGANPIPERIITRPPSAELRPDQ 473

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINND-QEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            DQ+SLPPY +LD I++R +EN+E   +     +    V  V  L+  +EYKRRQAPVG 
Sbjct: 474 KDQDSLPPYEVLDAIVERYMENDEPLEDIVRAGFERADVERVTRLIKLNEYKRRQAPVGV 533

Query: 537 KITAKSFGRDRLYPISNKFR 556
           ++T +SFG+D  YPI+N+FR
Sbjct: 534 RVTRRSFGKDWRYPITNRFR 553


>gi|289667066|ref|ZP_06488141.1| NAD synthetase [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 551

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 221/557 (39%), Positives = 311/557 (55%), Gaps = 20/557 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSF 62
            L+IA+AQ +  VG +A N  +       A  +   D++LF EL ISGYPPEDL+ +  F
Sbjct: 9   TLRIAMAQFDFPVGAVAQNTDRIIEHIAAARDEFEADIVLFPELAISGYPPEDLLLRPGF 68

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           +  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   K  LPNY+ 
Sbjct: 69  LAHCEEALGRIAAATR--GIVAVVGWPQSAGSVVYNAASVLRDGRIEATYRKRELPNYAV 126

Query: 123 FHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           F E+R F       N     + +++G++ICED+W    +     K  AE +   NASPY 
Sbjct: 127 FDERRYFDVDPDGDNCVFTVKGVQVGVVICEDLWFAEPLANT-VKARAELVLVPNASPYE 185

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      F +Q 
Sbjct: 186 RGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAAFVDQW 245

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + ++   ++        DD   +M      +   + A V  L+DY +KN F KV +GLS
Sbjct: 246 LVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYCRKNGFSKVWLGLS 299

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALG +NV  + LP +YT+  S + A    +ALG K + + I     
Sbjct: 300 GGIDSALVLAIAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALGVKLETIAIEPAFE 359

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                +    +     I  EN+QSR RG ILMALSN    ++LTT NKSE +VGY T+YG
Sbjct: 360 GLLGALGPMFEGTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEYAVGYATIYG 419

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GG+ PLKDLYKT+VF LA WRN+ G          VIPP+++ + PSAELR +QTDQ
Sbjct: 420 DMCGGYAPLKDLYKTEVFGLAKWRNTVGG-------APVIPPAVISRPPSAELRDNQTDQ 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I+ R V+ E+S  +     Y  +TV +V  L+  +E+KR Q+  G K++
Sbjct: 473 DSLPPYDVLDGILYRYVDQEQSRDDIVAAGYAADTVEHVLRLVRLNEWKRHQSAPGPKVS 532

Query: 540 AKSFGRDRLYPISNKFR 556
            ++FGR+R YPI+N +R
Sbjct: 533 RRAFGRERRYPITNGYR 549


>gi|325929041|ref|ZP_08190196.1| DNA-directed RNA polymerase, subunit H [Xanthomonas perforans
           91-118]
 gi|325540574|gb|EGD12161.1| DNA-directed RNA polymerase, subunit H [Xanthomonas perforans
           91-118]
          Length = 551

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 219/557 (39%), Positives = 311/557 (55%), Gaps = 20/557 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSF 62
            L+IA+AQ +  VG +  N  +       A  +   D++LF EL ISGYPPEDL+ +  F
Sbjct: 9   TLRIAMAQFDFPVGGVTQNTDRIIEYIAAARDEFEADIVLFPELAISGYPPEDLLLRPGF 68

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           +  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   K  LPNY+ 
Sbjct: 69  LAHCEQALARIAAATR--GIVAVVGWPQSAGSVVYNAASVLRDGRIEATYRKRELPNYAV 126

Query: 123 FHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           F E+R F       N  +  + + +G++ICED+W    +     + GAE +   NASPY 
Sbjct: 127 FDERRYFDVDPDGENCVVTVKGVHVGVVICEDLWFAEPLANT-VRAGAELVLVPNASPYE 185

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      F +Q 
Sbjct: 186 RGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAAFVDQW 245

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + ++   ++        DD   +M      +   + A V  L+DY +KN F KV +GLS
Sbjct: 246 LVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYCRKNGFSKVWLGLS 299

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  A+AVDALG +NV  + LP +YT+  S + A    +ALG K + + I     
Sbjct: 300 GGIDSALVLAMAVDALGGDNVTAVRLPSRYTATLSNDLADEQCRALGVKLETIAIEPAFE 359

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                +    +     I  EN+QSR RG ILMALSN    ++LTT NKSE +VGY T+YG
Sbjct: 360 GLLGALGPMFEGTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEYAVGYATIYG 419

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GG+ PLKDLYKT+VF LA WRN+ G          VIPP+++ + PSAELR +QTDQ
Sbjct: 420 DMCGGYAPLKDLYKTEVFGLAKWRNTVGG-------APVIPPAVISRPPSAELRANQTDQ 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I+ R V+ E+S  +     Y  +TV +V  L+  +E+KR Q+  G K++
Sbjct: 473 DSLPPYDVLDGILYRYVDQEQSRDDIVAAGYAADTVEHVLRLVRLNEWKRHQSAPGPKVS 532

Query: 540 AKSFGRDRLYPISNKFR 556
            ++FGR+R YPI+N +R
Sbjct: 533 RRAFGRERRYPITNGYR 549


>gi|121608702|ref|YP_996509.1| NAD+ synthetase [Verminephrobacter eiseniae EF01-2]
 gi|121553342|gb|ABM57491.1| NAD+ synthetase [Verminephrobacter eiseniae EF01-2]
          Length = 552

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 228/561 (40%), Positives = 319/561 (56%), Gaps = 19/561 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            L I  AQLN VVGD+  N  K   A  +A+ +G  L+L  EL I GY  EDL  + +FI
Sbjct: 2   TLSICTAQLNFVVGDMPANAQKIIAAARQAHARGARLLLTPELAICGYAAEDLFLRPAFI 61

Query: 64  QACSSAIDTLKSDTHDG-GAGIVVGFPRQDQ------EGVLNSVVILDAGNIIAVRDKIN 116
            AC  A+ T+  +T D     IV+G PR            +N+  +L AG I     K  
Sbjct: 62  AACDDAVKTVARETADLKDLAIVLGHPRGFAPEAAAFSACINAASVLRAGQIEQTYAKRE 121

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LPNY  F E+R F++G+         +R+G+LICED W  +   +     GA+ L  +NA
Sbjct: 122 LPNYQVFDERRYFVAGHKPCVFDMGGLRVGLLICEDAWFAAP-ARDCALAGAQLLAVINA 180

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SP++  K  +R +I+  ++    LP++Y + VGGQDE++F+G SF  D    +A +   F
Sbjct: 181 SPFHLGKGAEREQIMRERVLETGLPLVYAHLVGGQDEVVFEGRSFALDADGSVAGRAPGF 240

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E+      H      +           +      E   ++A VL +RDYV KN F   +
Sbjct: 241 EEKLVYAHIHPSSSAIRIEA-------DIAPERSLEADLWDALVLGVRDYVGKNGFAGAL 293

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL  AIAVDALG + ++T+M+P  YT+  SL DA   A+ LG ++D + I 
Sbjct: 294 LGLSGGIDSALVLAIAVDALGADKLRTVMMPSPYTADISLIDARELARRLGVRHDEISIT 353

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
                F + ++      P     EN+Q+RIRG +LMALSN   A++LTT NKSE+S GY 
Sbjct: 354 PQWEAFKAALAPAFAGLPEDTTEENLQARIRGTLLMALSNKFGALVLTTGNKSEMSTGYC 413

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGF  +KD+ KT+VF LA WRN++      G     IP  I+ + PSAELRP 
Sbjct: 414 TLYGDMAGGFAVIKDVAKTRVFDLARWRNANDPY---GSGANPIPQRIIARPPSAELRPD 470

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVG 535
           QTDQ+SLPPY +LD I+ R +EN+E   +     +    V  V  L+  +EYKRRQAPVG
Sbjct: 471 QTDQDSLPPYEVLDAIMSRYMENDEPIESIIASGFARADVERVTRLIKFNEYKRRQAPVG 530

Query: 536 TKITAKSFGRDRLYPISNKFR 556
            ++T +SFG+D  YPI+++FR
Sbjct: 531 IRVTRRSFGKDWRYPITSRFR 551


>gi|239931662|ref|ZP_04688615.1| NH(3)-dependent NAD(+) synthetase [Streptomyces ghanaensis ATCC
           14672]
          Length = 588

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 210/592 (35%), Positives = 310/592 (52%), Gaps = 44/592 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+ Q++  VGD+ GN     R    +  +G  L+ F E+ ++GYP EDL  + S
Sbjct: 1   MPQLRLALNQIDSRVGDLDGNTETILRWTRHSAERGAHLVAFPEMVLTGYPVEDLALRSS 60

Query: 62  FIQACSSAIDTLKSDTHDGG---AGIVVGFPRQD----------QEGVLNSVVILDAGNI 108
           F++A  +A+ +L +   + G     +VVG+  +                N+  +L  G +
Sbjct: 61  FVEASRAALRSLAARLAEEGFGELPVVVGYLDRSAAAQPKYGQPAGAPQNAGAVLYGGEV 120

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA 168
           +    K +LPNY  F E R F+ G +   +    + + + ICED+W++       +  GA
Sbjct: 121 VLAFAKHHLPNYGVFDEFRYFVPGDTMPVVRVHGVDVALAICEDLWQDGGRVPAARSAGA 180

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
             L S+NASPY   K   R E+V  +         Y+   GGQDEL+FDG S   D    
Sbjct: 181 GLLLSINASPYEREKDDTRLELVRKRAQEAGCTTAYLAMTGGQDELVFDGDSIVVDRDGA 240

Query: 229 LAFQMKHFSEQNFMT------------EWHYDQQLSQWNYMSDDSASTMYIP-------- 268
           +  +   F+E  F+                 D  L     +  ++    Y P        
Sbjct: 241 VVTRAPQFTEGCFVVDLDLPAAAADAPTGTVDDGLRIDRVVLSEAPLPAYEPEQAGGCAE 300

Query: 269 -LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLP 327
            L ++E  Y+A V+ LR YV+KN F  V+IGLSGGIDSAL AAIA DA+G ENV  + +P
Sbjct: 301 RLDDDEEVYSALVVGLRAYVEKNGFESVLIGLSGGIDSALVAAIACDAVGAENVYGVSMP 360

Query: 328 YKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIR 387
            KY+S  S +DAA  A+  G  Y  + I  + + +   +        +G+  EN+QSR+R
Sbjct: 361 SKYSSGHSRDDAAELARRTGLNYRTVAIEPMFDAYMGALG------LTGLAEENLQSRLR 414

Query: 388 GNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSH 447
           G +LMALSN    ++L   NKSE++VGY TLYGD  G + P+KD+YKT VF+LA WRN  
Sbjct: 415 GTLLMALSNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSVFRLARWRNRA 474

Query: 448 GITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN- 506
               G  P    IP + + K PSAELRP Q D +SLP YP+LD I++  V+ +       
Sbjct: 475 AQERGETP---PIPENSISKPPSAELRPGQVDTDSLPDYPVLDAILELYVDRDRGADEIV 531

Query: 507 DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
              ++ E V     ++  +EYKRRQ P GTKI+ K FG+DR  PI+N +R+ 
Sbjct: 532 AAGFDRELVAKTLRMVDRAEYKRRQYPPGTKISPKGFGKDRRLPITNGWREQ 583


>gi|78048901|ref|YP_365076.1| NAD synthetase [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|78037331|emb|CAJ25076.1| NAD(+) synthase (glutamine-hydrolyzing) [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 547

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 218/557 (39%), Positives = 312/557 (56%), Gaps = 20/557 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSF 62
            L+IA+AQ +  VG +  N  +       A  +   D++LF EL ISGYPPEDL+ +  F
Sbjct: 5   TLRIAMAQFDFPVGGVTQNTDRIIEYIAAARDEFEADIVLFPELAISGYPPEDLLLRPGF 64

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           +  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   K  LPNY+ 
Sbjct: 65  LAHCEQALARIAAATR--GIVAVVGWPQSAGSVVYNAASVLRDGRIEATYRKRELPNYAV 122

Query: 123 FHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           F E+R F       +  +  + +++G++ICED+W    +     + GAE +   NASPY 
Sbjct: 123 FDERRYFDVDPDGESCVVTVKGVQVGVVICEDLWFAEPLANT-VRAGAELVLVPNASPYE 181

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      F +Q 
Sbjct: 182 RGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAAFVDQW 241

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + ++   ++        DD   +M      +   + A V  L+DY +KN F KV +GLS
Sbjct: 242 LVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYCRKNGFSKVWLGLS 295

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  A+AVDALG +NV  + LP +YT+  S + A    +ALG K + + I     
Sbjct: 296 GGIDSALVLAMAVDALGGDNVTAVRLPSRYTATLSNDLADEQCRALGVKLETIAIEPAFE 355

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                +    +     I  EN+QSR RG ILMALSN    ++LTT NKSE +VGY T+YG
Sbjct: 356 GLLGALGPMFEGTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEYAVGYATIYG 415

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GG+ PLKDLYKT+VF LA WRN+ G          VIPP+++ + PSAELR +QTDQ
Sbjct: 416 DMCGGYAPLKDLYKTEVFGLAKWRNTVGG-------APVIPPAVISRPPSAELRANQTDQ 468

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I+ R V+ E+S  +     Y  +TV +V  L+  +E+KR Q+  G K++
Sbjct: 469 DSLPPYDVLDGILYRYVDQEQSRDDIVAAGYAADTVEHVLRLVRLNEWKRHQSAPGPKVS 528

Query: 540 AKSFGRDRLYPISNKFR 556
            ++FGR+R YPI+N +R
Sbjct: 529 RRAFGRERRYPITNGYR 545


>gi|302545965|ref|ZP_07298307.1| glutamine-dependent NAD(+) synthetase [Streptomyces hygroscopicus
           ATCC 53653]
 gi|302463583|gb|EFL26676.1| glutamine-dependent NAD(+) synthetase [Streptomyces himastatinicus
           ATCC 53653]
          Length = 589

 Score =  484 bits (1245), Expect = e-134,   Method: Composition-based stats.
 Identities = 208/593 (35%), Positives = 307/593 (51%), Gaps = 46/593 (7%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
            +L++A+ Q++  VGD+AGN          +  QG  L+ F E+ ++GYP EDL  + SF
Sbjct: 5   PQLRLALNQIDSTVGDLAGNAESIVHWTRHSAEQGAHLVAFPEMVLTGYPVEDLALRSSF 64

Query: 63  IQACSSAIDTLKSDTHDGGAG---IVVGFPRQDQE-GVL--------NSVVILDAGNIIA 110
           ++A  +A+  L       G G   ++VG+  + +             N+  +L  G I+ 
Sbjct: 65  VEASRTALRALAERLDAEGLGELPVIVGYLDRSERARRYGQPAGSPQNAAAVLHRGAIVL 124

Query: 111 VRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEF 170
              K +LPNY  F E R F+ G +   +    I + + ICED+W++          GA  
Sbjct: 125 TFAKHHLPNYGVFDEFRYFVPGDTMPVVRVHGIDVALAICEDLWQDGGRVPAAHSAGAGL 184

Query: 171 LFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLA 230
           L S+NASPY   K   R ++V  +         Y+  +GGQDEL+FDG S       ++ 
Sbjct: 185 LLSINASPYEREKDDTRLDLVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIIVGRDGEVI 244

Query: 231 FQMKHFSEQNFMTEWHY-------------DQQLSQWNYMSDDSASTMYIPLQ------- 270
            +   F+E   + +                D  L   +          Y P         
Sbjct: 245 ARAPQFAEGCVVVDLDLPAADPDAVPEGVVDDGLRIDHRTLSADPLPAYDPEPGLAGGEA 304

Query: 271 ----EEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIML 326
               ++E  Y A V+ LR YV KN F  V+IGLSGGIDSAL AAIA DA+G +NV  + +
Sbjct: 305 ERLGDDEEIYTALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDAVGAQNVYGVAM 364

Query: 327 PYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRI 386
           P +Y+S  S+ DA   A+  G  +  +PI  + + +   +        +G+  EN+QSR+
Sbjct: 365 PSRYSSEHSIGDATELARRTGLNFRTVPIAPMFDAYMGSLH------LTGLAEENLQSRL 418

Query: 387 RGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNS 446
           RG +LMALSN    ++L   NKSE++ GY TLYGD  G + P+KD+YKT +F+LA WRN 
Sbjct: 419 RGTMLMALSNQEGHIVLAPGNKSELACGYSTLYGDSVGAYGPIKDVYKTSIFRLAKWRNR 478

Query: 447 HGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN 506
                G    T  IP + + K PSAELRP Q D +SLP Y +LD I++  V+ ++     
Sbjct: 479 AAEERGQ---TLPIPENSITKPPSAELRPGQVDTDSLPDYDVLDRILELYVDRDQGRQEI 535

Query: 507 -DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
               Y+DE V  +  L+  +EYKRRQ P GTKI+AK FG+DR  PI+N++R+H
Sbjct: 536 VAAGYDDELVTRILRLVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREH 588


>gi|300690788|ref|YP_003751783.1| nh3-dependent nad+ synthetase (nadE) [Ralstonia solanacearum PSI07]
 gi|299077848|emb|CBJ50486.1| putative nh3-dependent nad+ synthetase (nadE) [Ralstonia
           solanacearum PSI07]
          Length = 546

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 223/562 (39%), Positives = 321/562 (57%), Gaps = 31/562 (5%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           +A+AQ+N  VGD+AGN A+   A  EA++ G  +++  EL ++GYPPEDL+ + +F+ A 
Sbjct: 5   VALAQINCTVGDLAGNAARIVAAAREAHQAGARILVTPELSLTGYPPEDLLLRPAFLDAT 64

Query: 67  SSAIDTL-KSDTHDGGAGIVVGFPRQDQE---------GVLNSVVILDAGNIIAVRDKIN 116
           S A+D L        G  +++G P+   E            N+  +   G +     K+ 
Sbjct: 65  SRALDVLVAELAAFPGLHVLIGHPQLSFEAPAPGSALPKPTNTATVAVDGRVRGQYHKLE 124

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LPN   F EKR F  G+          R G++ICED W         K  GAE +   NA
Sbjct: 125 LPNNEVFDEKRYFQVGFEPFVFDVEGTRFGVIICEDAWYPQATA-WAKAAGAEVVLVPNA 183

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY+ +K   R +I+  ++    LP +YVN VGGQDEL+FDG SF  D   +   +M  F
Sbjct: 184 SPYHLDKEDLREQIIGARVKESGLPHVYVNLVGGQDELVFDGGSFVLDSGGKPVARMAQF 243

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E      +   + L             +      E   Y A  L +RDY+ KN F   I
Sbjct: 244 VEGVGYVRFDGARPLPG----------EIAPEATLEAQVYEALKLGVRDYIGKNGFPGAI 293

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           IGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA   A  LG +YD +PI 
Sbjct: 294 IGLSGGVDSALVLAIAVDALGTDRVRAVMMPSRYTADISWLDARDMAARLGVRYDEIPIM 353

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            + + F  ++++  +  P     ENIQ+RIRG +LMALSN S  ++LTT NKSE++VGY 
Sbjct: 354 PMFDAFGGVLAEEFRNLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSEMAVGYC 413

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGF  +KD++KT V++L  +RN+         L+EVIP  IL ++PSAELR +
Sbjct: 414 TLYGDMAGGFAVIKDIFKTLVYRLCRYRNA---------LSEVIPERILTRAPSAELREN 464

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           QTDQ+SLP Y  LD I++R +E  +   +     + +  VR +  L+  +EYKRRQAPVG
Sbjct: 465 QTDQDSLPEYAALDAIVQRYMEQNQPVTDIIAAGFAEADVRKIVRLIKINEYKRRQAPVG 524

Query: 536 TKITAKSFGRDRLYPISNKFRD 557
            ++T ++FGRD  YPI+++F++
Sbjct: 525 IRVTQRAFGRDWRYPITSRFKE 546


>gi|284006754|emb|CBA72011.1| glutamine-dependent NAD( ) synthetase [Arsenophonus nasoniae]
          Length = 540

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 241/556 (43%), Positives = 336/556 (60%), Gaps = 22/556 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  +  +    QG DLILF+EL ++GYPPEDL+F+ 
Sbjct: 1   MNRTLNIALAQLNWLVGDIEGNCERMLQEAKAQQLQGADLILFSELSLTGYPPEDLLFRS 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q CS  +D LK  +      IVVG P Q  E   N++     G ++A   K  LPNY
Sbjct: 61  DFHQRCSKQLDRLKEASQ--NIAIVVGHPWQQNEKCYNALSFFWQGQMVARYFKQQLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G+ +  + F+  +LG LICED+W +  + +     GA+ L  +NASPY 
Sbjct: 119 GVFDEKRYFYAGHESCVLSFKGYKLGFLICEDVWFDEPVDRIKAL-GADVLIIINASPYN 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R  ++       HLPI+Y+NQVGGQDELIFDG S  F+GQ ++   +  F+EQ 
Sbjct: 178 REKLHIRTRLLKSHSQRTHLPIVYLNQVGGQDELIFDGGSKVFNGQGEITHYLAQFAEQV 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                       ++N       + +   L      Y A V++ RDY+ KN F  VI+GLS
Sbjct: 238 IQC---------KFNDGEPLPVANLAKTLSSTAQVYEALVMATRDYINKNGFSGVILGLS 288

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALGK+NVQ +M+P+KYT+  S+ DA   A  LG ++ ++ I  + +
Sbjct: 289 GGIDSALTLAIAVDALGKDNVQAVMMPFKYTAEISIHDAREQATLLGIEFAIVSIEAMYD 348

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + +S    +       EN+Q+R R  ILMA+SN S  ++LTTSNKSE +VGY +LYG
Sbjct: 349 AFMAGLSPLFADMAPDTTEENLQARCRAIILMAISNKSGRLVLTTSNKSESAVGYTSLYG 408

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  LKD+ KT VF+LA +RN+             IP  ++E+ P+AEL P Q DQ
Sbjct: 409 DMAGGFAVLKDVPKTLVFELAKYRNTISPN---------IPQRVIERPPTAELAPGQLDQ 459

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPYP+LD I++  VE ++S        +++ TVR V  L+  +EYKRRQAP+G +IT
Sbjct: 460 DSLPPYPVLDAILEGYVEQDKSVSELVAAGFDEVTVRKVIKLVDINEYKRRQAPIGPRIT 519

Query: 540 AKSFGRDRLYPISNKF 555
            ++F +DR YPI++ F
Sbjct: 520 IRNFNKDRRYPITSAF 535


>gi|108805552|ref|YP_645489.1| NH(3)-dependent NAD(+) synthetase [Rubrobacter xylanophilus DSM
           9941]
 gi|108766795|gb|ABG05677.1| NH(3)-dependent NAD(+) synthetase [Rubrobacter xylanophilus DSM
           9941]
          Length = 577

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 220/580 (37%), Positives = 324/580 (55%), Gaps = 36/580 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +++A+AQ+N  VGDI GN  +     E A R G +L+ F EL ++GYPPEDL+ +  F+ 
Sbjct: 1   MRVALAQINTTVGDIWGNAERVSGTLERALRGGAELVAFPELALTGYPPEDLLLRPGFVH 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
              +A++ + +   + GA   VGF       + N+  ++  G ++    K  LPNY  F 
Sbjct: 61  DNLAALEEVAARVPE-GAVAAVGFVDL-GTDLFNACAVISGGRVLHRYHKRYLPNYGVFD 118

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E R F  G     +      +G+ +CEDIW      +     GA  L +++ASPY+  K 
Sbjct: 119 ENRYFREGGGAPVLRLDGTLVGVSVCEDIWYPGGPAREQALAGASVLLNISASPYHRRKG 178

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R  +++ + S     +++ N VGGQDEL+FDG S  FD + +L  + + F E     +
Sbjct: 179 ALRERMLSVRASDYGCYVLFCNLVGGQDELVFDGHSVVFDPEGRLLARARQFEEDLLFVD 238

Query: 245 WHYDQQLSQWNYMSDDS-------ASTMYIP-------------------LQEEEADYNA 278
            + ++ L Q  + S             + +P                   L EE     A
Sbjct: 239 LYPEEALVQRLHESRPRKEELETEPEVVEVPGFRERREPAQSREPRAEELLPEEGEVLEA 298

Query: 279 CVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLED 338
            VL LRDY +KN F + ++GLSGGIDS+L AA+A  ALG ENV  +++P +YTS  S  D
Sbjct: 299 LVLGLRDYFRKNGFSRAVLGLSGGIDSSLTAAVAARALGPENVTGVLMPSRYTSEASNAD 358

Query: 339 AAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHS 398
           A A AK LG    V+PI    + +  ++++  +  P  +  ENIQ+RIRGNI+MALSN  
Sbjct: 359 ARAVAKNLGIDVRVIPIGRAFDAYREMLAEVFRGLPEDVTEENIQARIRGNIVMALSNKF 418

Query: 399 KAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTE 458
             + L+T NKSE+SVGY TLYGDM+GGF+ LKD+ KT V+++A + N            E
Sbjct: 419 GWIALSTGNKSEMSVGYSTLYGDMAGGFSVLKDVPKTLVYRVARYVNE-------AEGRE 471

Query: 459 VIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRY 517
           VIP S+L K PSAELRP Q D +SLPPY +LD I++  VE+++         + +E VR 
Sbjct: 472 VIPESVLTKEPSAELRPGQRDVDSLPPYEVLDPILEAYVEDDKGVGEIVAMGFEEEDVRR 531

Query: 518 VEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
           V  ++  +EYKRRQAPVG K+T ++FGRDR  PI+N++ +
Sbjct: 532 VVRMVDRAEYKRRQAPVGIKVTTRAFGRDRRMPITNRYSE 571


>gi|328881984|emb|CCA55223.1| NAD synthetase or Glutamine amidotransferase chain of NAD
           synthetase [Streptomyces venezuelae ATCC 10712]
          Length = 609

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 215/590 (36%), Positives = 306/590 (51%), Gaps = 44/590 (7%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
            +L++A+ Q++  VGDIAGN          A  QG  L+ F E+ ++GYP EDL  + SF
Sbjct: 26  PQLRLALNQIDSTVGDIAGNAEAIVHWTRHAAGQGAHLVAFPEMALTGYPVEDLALRSSF 85

Query: 63  IQACSSAIDTLKSDTHDGG---AGIVVGFPRQDQ----------EGVLNSVVILDAGNII 109
           ++A  +A+  L     D G     +VVG+  + +              N+  +L  G ++
Sbjct: 86  VEASRAALRGLARRLADEGFGEVPVVVGYLDRSERAEPKLGLPAGSPENAAAVLHRGEVV 145

Query: 110 AVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAE 169
               K +LPNY  F E R F+ G +   +    I + + ICED+W+        +   A 
Sbjct: 146 LRFAKHHLPNYGVFDEYRYFVRGDTMPVLRVHGIDVALAICEDLWQEGGRVPAARHARAG 205

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            L S+NASPY  NK   R E+V  +         Y+   GGQDEL+FDG S   D   ++
Sbjct: 206 LLLSVNASPYERNKDDTRLELVRKRAQEAGCVTAYLASTGGQDELVFDGDSIVVDAAGEV 265

Query: 230 AFQMKHFSEQNFMTEWHY------------DQQLSQWNYMSDDSASTMYIP--------- 268
             +   F E + + +               +  L+    +  +     Y P         
Sbjct: 266 IARAPQFVEGSVILDLELPAADPEAPEGLVNDGLTVDRVVVSEEPLPAYEPELTGGYAHR 325

Query: 269 LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPY 328
           L++EE  Y+A V+ LR YV KN F  V++GLSGGIDSAL AAIA DALG ENV  + +P 
Sbjct: 326 LEDEEEVYSALVIGLRAYVAKNGFRSVLVGLSGGIDSALVAAIACDALGAENVYGVSMPS 385

Query: 329 KYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRG 388
           KY+S  S  DAA  A+  G  Y  + I  + + +   +        +G+  EN+QSR+RG
Sbjct: 386 KYSSDHSRGDAAELARRTGLHYRTVSIEPMFDAYMGSLG------LTGLAEENLQSRLRG 439

Query: 389 NILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG 448
             LMALSN    ++L   NKSE++VGY TLYGD  G F P+KD+YK+ VF+LA WRN   
Sbjct: 440 TTLMALSNQEGHIVLAPGNKSELAVGYSTLYGDSVGAFGPIKDVYKSTVFRLARWRNRAA 499

Query: 449 ITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-D 507
              G  P    IP S + K PSAELRP Q D +SLP Y  LD ++   V+ +        
Sbjct: 500 EERGQTP---PIPESSISKPPSAELRPGQVDTDSLPDYDTLDAVLALYVDQDRGREEIVA 556

Query: 508 QEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
             Y++E V     ++  +EYKRRQ P GTKI+AK FG+DR  PI+N++R+
Sbjct: 557 AGYDEELVTRTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWRE 606


>gi|332970488|gb|EGK09478.1| NAD synthetase [Psychrobacter sp. 1501(2011)]
          Length = 557

 Score =  483 bits (1244), Expect = e-134,   Method: Composition-based stats.
 Identities = 232/555 (41%), Positives = 326/555 (58%), Gaps = 19/555 (3%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
           K LK A+AQ + +VGDI  NI K R    EA   G ++I+F EL + GYPPEDL+ + S 
Sbjct: 17  KSLKFALAQSHFMVGDIQTNIEKMRSLAIEARDNGANIIIFPELALLGYPPEDLLLRPSL 76

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
                +A+ +L          +++G+P  D  G  NS  I+  G       K  LPNY  
Sbjct: 77  SDRVKAALSSLNDI---NDIVMIIGYPHVDYHGTFNSAAIIQNGQQKGFYHKQYLPNYGV 133

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F E+R F  G +     ++ I +G+LICED+W      K LK QGA+ + ++NASP+   
Sbjct: 134 FDERRYFDKGRNQVLFDYQGITIGLLICEDLW-QDEPIKALKDQGADLVVTINASPFEAG 192

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K   R  +++ + +  +LPI+YVN VGGQD+L+FDG S       ++A +   F E    
Sbjct: 193 KQHTRQALLSKRATDNNLPIVYVNAVGGQDDLVFDGGSMAVQANGKVAHEAPRFLEHMLY 252

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
             ++ +           D+ +   + L  E   Y A V+ LRDYV  + F  VI+GLSGG
Sbjct: 253 ANFNVE-------SGQFDTQTKAPLQLSAESETYQALVVGLRDYVNHSGFEGVIVGLSGG 305

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL   IAVDALG + V  +M+PY+YTS  SLEDA A A+ L   Y V PIHD V+  
Sbjct: 306 IDSALTLCIAVDALGSDKVYAVMMPYEYTSQISLEDAQAQARRLNVSYTVCPIHDAVDGM 365

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
              ++    +  +    ENIQ+R RG +LMALSN    +++TT NKSE++VGY TLYGDM
Sbjct: 366 RHTLAPLFSKAKADTTEENIQARARGMVLMALSNKFGHLVITTGNKSEMAVGYSTLYGDM 425

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF+ LKD+YKTQV+ LA++RN           T+VIP  ++ + PSAELRP Q DQ+S
Sbjct: 426 AGGFDVLKDVYKTQVYALANYRNRL-------EDTDVIPERVITRPPSAELRPDQKDQDS 478

Query: 483 LPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LP Y ILD I+K  ++N+  F     + ++ +TVR    ++  SEYKRRQA +GTKI+ K
Sbjct: 479 LPDYDILDAILKDYIDNDLGFNEIVAKGFDPDTVRQTIRMVDRSEYKRRQAAIGTKISHK 538

Query: 542 SFGRDRLYPISNKFR 556
           +FGR+R YP+ N + 
Sbjct: 539 AFGRERRYPLVNGWS 553


>gi|260221021|emb|CBA29170.1| Probable glutamine-dependent NAD(+) synthetase [Curvibacter
           putative symbiont of Hydra magnipapillata]
          Length = 562

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 228/567 (40%), Positives = 316/567 (55%), Gaps = 25/567 (4%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            LK+ +AQLN +VGD+ GN+ K   A   A  QG+ L+L  EL I GY  EDL  + +FI
Sbjct: 6   TLKLCVAQLNFIVGDLNGNVKKIVDAATHAYDQGVRLVLTPELSICGYAAEDLFLRPAFI 65

Query: 64  QACSSAIDTLKSDTHDG-GAGIVVGFPRQDQEG--------VLNSVVILDAGNIIAVRDK 114
           QAC  A+ ++        G  +VVG P                N+  +L  G ++A   K
Sbjct: 66  QACDDAVKSVARQLAGLKGLSVVVGHPTGGDSRTRSVAIQSRFNAASVLREGQVVAHYAK 125

Query: 115 INLPNYSEFHEKRTFISGYSNDPIVFRD----IRLGILICEDIWKNSNICKHLKKQGAEF 170
             LPNY  F E+R F  G         +    +++G+LICED W      +  K+ GAE 
Sbjct: 126 RELPNYQVFDERRYFSPGQGVCVFEAGEGASAVKVGLLICEDAWFEEP-ARLAKEAGAEL 184

Query: 171 LFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLA 230
           L  +NASP++  K  +R   +  +     LP++Y + VGGQDE++F+G SF  D Q  + 
Sbjct: 185 LAVINASPFHVGKGYEREARMGERCRATGLPLVYAHLVGGQDEVVFEGHSFTLDAQGAVT 244

Query: 231 FQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKN 290
            +   F E  F+ +    Q+  +   + +            E   ++A VL +RDYV KN
Sbjct: 245 GRAPSFKENLFVAQVARAQEAIKLVAVVEPER-------SAEADLWDALVLGVRDYVGKN 297

Query: 291 NFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKY 350
            F   ++GLSGGIDSAL   +AVDALG + V+ IM+P  YT+  S  DA   A  +G +Y
Sbjct: 298 GFPGALLGLSGGIDSALVLTVAVDALGADKVRAIMMPSPYTADISWIDARDMAARMGVRY 357

Query: 351 DVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSE 410
           D + I      F + ++            ENIQ+RIRG +LMALSN   +++LTT NKSE
Sbjct: 358 DEISIVPEFEAFKASLAGEFAGRAEDTTEENIQARIRGTLLMALSNKFGSIVLTTGNKSE 417

Query: 411 ISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPS 470
           ++ GY TLYGDM+GGF  +KDL KT VF+LA WRN+H      G     IP  I+ + PS
Sbjct: 418 MATGYCTLYGDMAGGFAVIKDLAKTTVFKLAWWRNAHDPY---GTCASPIPERIITRPPS 474

Query: 471 AELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKR 529
           AELRP Q DQ+SLPPY +LD I++R +EN+ES        Y  E V  V  L+  +EYKR
Sbjct: 475 AELRPDQKDQDSLPPYEVLDGILERYMENDESMETIIAAGYRTEDVERVTRLIKINEYKR 534

Query: 530 RQAPVGTKITAKSFGRDRLYPISNKFR 556
           RQAPVG ++T +SFG+D  YPI+N+FR
Sbjct: 535 RQAPVGIRVTHRSFGKDWRYPITNRFR 561


>gi|326577687|gb|EGE27563.1| NAD+ synthetase [Moraxella catarrhalis O35E]
          Length = 563

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 226/554 (40%), Positives = 318/554 (57%), Gaps = 19/554 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           ++  AI Q N  VGDIAGN+ K      +A  +G D+++F EL + GYPPEDL+ + +  
Sbjct: 25  QMTFAIIQTNFWVGDIAGNVKKMHALTLDAKARGADIVIFPELALVGYPPEDLLLRPTLG 84

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +    A+  L       G  +++G+P  D  G  NS  IL  G+      K  LPNY  F
Sbjct: 85  ERVREAMAKLAEI---EGIVVILGYPHIDHHGTFNSAAILQDGSQKGFYHKQCLPNYGIF 141

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F  G +     ++ + +G+LICEDIW +    + LK+ GA+ +  +NASP+   K
Sbjct: 142 DEQRYFQKGLNQVLFDYKGVTIGLLICEDIWHDEP-IQALKQAGADLVIVINASPFEIGK 200

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
              R  ++T   S  HLPIIYVN VG QD+++FDG S       ++A +   F  Q  M 
Sbjct: 201 QTARKSLLTRHSSTHHLPIIYVNTVGAQDDIVFDGGSLITQSDGRVAHEGVRFLNQLLMA 260

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
            +    +       + D+ +   + L EE   Y A V+ LRDYV ++ F  VI+GLSGGI
Sbjct: 261 RFDIQNK-------TFDTQAKAPLVLSEESEMYQALVVGLRDYVNRSGFKGVIVGLSGGI 313

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IAVDALG + V  +M+PY+YT+  SLEDA A A  L   Y V PIHD V    
Sbjct: 314 DSALTLCIAVDALGCDRVYAVMMPYEYTAQISLEDAEAQAARLNVSYTVCPIHDAVAGLR 373

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++  L      +  EN+Q+R RG ILMALSN    M+++T NKSE +VGY TLYGDM 
Sbjct: 374 SALAPLLANSEPDVTEENLQARARGTILMALSNKFGHMVISTGNKSENAVGYSTLYGDMV 433

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+YKT V++LA++RN             VIP  ++ + PSAELRP+Q DQ+SL
Sbjct: 434 GGFDVLKDVYKTDVYRLANYRNRL-------EDNPVIPERVITRPPSAELRPNQKDQDSL 486

Query: 484 PPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
             Y  LD I+K  ++++  +       +  +TV  +  ++  +EYKRRQ  +GTKIT KS
Sbjct: 487 GDYETLDSILKMYIDDDLGYKAIVAAGFEPKTVEKILGMVDRAEYKRRQGAIGTKITKKS 546

Query: 543 FGRDRLYPISNKFR 556
           FGR+R YP+ N + 
Sbjct: 547 FGRERRYPLVNGWS 560


>gi|207723618|ref|YP_002254016.1| nh3-dependent nad+ synthetase protein [Ralstonia solanacearum
           MolK2]
 gi|206588821|emb|CAQ35783.1| nh3-dependent nad+ synthetase protein [Ralstonia solanacearum
           MolK2]
          Length = 546

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 221/562 (39%), Positives = 318/562 (56%), Gaps = 31/562 (5%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           +A+AQ+N  VGD+AGN A+   A  EA++ G  +++  EL ++GYPPEDL+ + +F+ A 
Sbjct: 5   VALAQINCTVGDLAGNAARILAAAREAHQAGARILVTPELSLTGYPPEDLLLRPAFLGAT 64

Query: 67  SSAIDTL-KSDTHDGGAGIVVGFPRQDQE---------GVLNSVVILDAGNIIAVRDKIN 116
           S A+D L        G  +++G P+   E            N+  +   G  +    K+ 
Sbjct: 65  SRALDALVAELAAFPGLHVLIGHPQLSFEAPAPGSALPKPTNTATVAVDGRTLGQYHKLE 124

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LPN   F EKR F +G           R G++ICED W            GAE +   NA
Sbjct: 125 LPNNEVFDEKRYFQAGCEPFVFEVEGTRFGVIICEDAWYPQATAWAKTA-GAEVVLIPNA 183

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY+ +K   R +I+  ++    LP +YVN VGGQDEL+FDG SF  D   +   +M  F
Sbjct: 184 SPYHLDKEDLREQIIGARVKESGLPHVYVNLVGGQDELVFDGGSFVLDAHGKPVARMAQF 243

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
           +E      +            +      +      E   Y A  L +RDY+ KN F   I
Sbjct: 244 AEGVGYVRFD----------GARPQPGEIAQEATLEAQVYEALKLGVRDYIGKNGFPGAI 293

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           IGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA   A  LG +YD +PI 
Sbjct: 294 IGLSGGVDSALVLAIAVDALGADRVRAVMMPSRYTADISWVDARDMAVRLGVRYDEIPIM 353

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            + + F   ++   +  P     ENIQ+RIRG +LMALSN S  ++LTT NKSE++VGY 
Sbjct: 354 PMFDAFRGALADEFRNLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSEMAVGYC 413

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGF  +KD++KT V++L  +RN+         L+EVIP  IL ++PSAELR +
Sbjct: 414 TLYGDMAGGFAVIKDIFKTLVYRLCRYRNA---------LSEVIPERILTRAPSAELREN 464

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           QTDQ+SLP Y  LD I++R +E  +   +     + +  V+ +  LL  +EYKRRQAPVG
Sbjct: 465 QTDQDSLPEYAALDAIVQRYMEQNQPVADIIAAGFAEADVQKIVRLLKINEYKRRQAPVG 524

Query: 536 TKITAKSFGRDRLYPISNKFRD 557
            ++T ++FGRD  YPI+++F++
Sbjct: 525 IRVTQRAFGRDWRYPITSRFKE 546


>gi|212710640|ref|ZP_03318768.1| hypothetical protein PROVALCAL_01706 [Providencia alcalifaciens DSM
           30120]
 gi|212686721|gb|EEB46249.1| hypothetical protein PROVALCAL_01706 [Providencia alcalifaciens DSM
           30120]
          Length = 540

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 223/556 (40%), Positives = 334/556 (60%), Gaps = 23/556 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL I++AQLN +VGDI GN  +  +  EE   +  D+++F+EL ++GY PEDL+F+ 
Sbjct: 1   MSRKLNISLAQLNWLVGDIEGNCERMLQTVEE-QGKNTDIVMFSELALTGYSPEDLLFRH 59

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F + C++ +  L+  +     GI+VG P  ++  + N++     G ++A   K  LPNY
Sbjct: 60  DFEERCTAQLKRLQQAS--SQCGIIVGHPWYEENEIYNALSFFYQGKLLARYFKQELPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F +      + F+  +LG+LICEDIW +      +K  GA+ + ++NASPY 
Sbjct: 118 GVFDEPRYFTAAEKTCVVEFKGYQLGLLICEDIWYDEP-IDAVKGAGADLVLTINASPYD 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK   R +++        LPI+Y+NQVGGQDEL+FDG S     + +  +QM  F+EQ 
Sbjct: 177 LNKEHIRSDLLVEHAQRTGLPIVYLNQVGGQDELVFDGGSKVLANKGKQVYQMVEFAEQV 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
               +   + +++     + S              Y A VL+ RDY+ KN F+  I+GLS
Sbjct: 237 ATVTFEDVKLVTEQPKQPEASQ---------IAQVYQALVLATRDYINKNGFNGAILGLS 287

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIA DA+GK+ VQ +M+P++YTS  S+ DA   A+ LG ++D++ I  + +
Sbjct: 288 GGIDSGLTVAIAADAIGKDRVQAVMMPFRYTSEMSIHDAKEQAELLGVEFDIVSIEPMFD 347

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + +    +        EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 348 AFMAQLQPMFEGTQPDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 407

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 408 DMAGGFDVLKDVPKTLVFELAKYRNT---------ISPAIPQRVIDRPPSAELAPGQLDQ 458

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I+   VE + S  +     ++ E VR V  L+  +EYKRRQAPVG +IT
Sbjct: 459 DSLPPYDVLDAILDGYVEKDLSVADLIKLGFDREIVRKVVRLVDINEYKRRQAPVGPRIT 518

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 519 MRNFGKDRRYPITSGF 534


>gi|302534133|ref|ZP_07286475.1| NH(3)-dependent NAD(+) synthetase [Streptomyces sp. C]
 gi|302443028|gb|EFL14844.1| NH(3)-dependent NAD(+) synthetase [Streptomyces sp. C]
          Length = 584

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 212/592 (35%), Positives = 310/592 (52%), Gaps = 44/592 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+ Q++  VG+IA N          +  QG  L+ F E+ ++GYP EDL  + S
Sbjct: 1   MPQLRLALNQIDSQVGNIAANADSVVHWTRHSAEQGAHLVAFPEMTLTGYPVEDLALRAS 60

Query: 62  FIQACSSAIDTLKSDTHD---GGAGIVVGFPRQDQ----------EGVLNSVVILDAGNI 108
           F+ A  +A+  L     D   GG  +VVG+  + +              N+  +L  G +
Sbjct: 61  FVDASRTALTALARRLADEGLGGLPVVVGYLDRSERATPRLGLPAGSPENAAAVLYGGEV 120

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA 168
           +    K +LPNY  F E R F+ G +   +    + + + ICED+W+        +  GA
Sbjct: 121 VLRFAKHHLPNYGVFDEFRYFVPGDTQPVVRVHGVDVALAICEDLWQEGGRVPATRSAGA 180

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
             L S+NASPY  NK   R E+V  +       + YV  +GGQDEL+FDG S   D   +
Sbjct: 181 GLLISINASPYERNKDDVRLELVRKRAQEAGCTLAYVAMIGGQDELVFDGDSIVVDAAGE 240

Query: 229 LAFQMKHFSEQNFMTEWHY------------DQQLSQWNYMSDDSASTMYIP-------- 268
           +  +   FSE   + +               D  L     +  +     Y P        
Sbjct: 241 VVVRAPQFSEGCVLVDLDLPAARPDAPEGVVDDGLRIDRVILSEEPLEAYEPVVTGGYAE 300

Query: 269 -LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLP 327
            L ++E  Y+A V+ LR YV KN F  V+IGLSGGIDSAL AA+A DA+G +NV  I +P
Sbjct: 301 RLDDDEEVYDALVVGLRAYVGKNGFRSVLIGLSGGIDSALVAAVACDAVGAQNVYGIAMP 360

Query: 328 YKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIR 387
            KY+S  S  DAA  A   G  +  +PI  + + +   +        +G+  EN+QSR+R
Sbjct: 361 SKYSSEHSEGDAADLAARTGLNFRTVPIAPMFDAYMGSLG------LTGLAEENLQSRLR 414

Query: 388 GNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSH 447
           G +LMA+SN    ++L   NKSE++VGY TLYGD  G + P+KD+YK+ VF+LA +RN  
Sbjct: 415 GTLLMAVSNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKSDVFRLARYRNRA 474

Query: 448 GITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN- 506
               G  P    IP + + K PSAELRP Q D +SLP YP+LD I+ R V+ ++      
Sbjct: 475 AEERGETP---PIPENSIVKPPSAELRPGQVDTDSLPDYPVLDAILARYVDRDQGLEEIV 531

Query: 507 DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
              ++ E V     ++  +EYKRRQ P GTKI+AK FG+DR  PI+N +R+ 
Sbjct: 532 AAGFDRELVAKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNGWRER 583


>gi|16330978|ref|NP_441706.1| NAD synthetase [Synechocystis sp. PCC 6803]
 gi|8928223|sp|P74292|NADE_SYNY3 RecName: Full=Probable glutamine-dependent NAD(+) synthetase;
           AltName: Full=NAD(+) synthase [glutamine-hydrolyzing]
 gi|1653472|dbj|BAA18386.1| NH(3)-dependent NAD(+) synthetase [Synechocystis sp. PCC 6803]
          Length = 558

 Score =  483 bits (1243), Expect = e-134,   Method: Composition-based stats.
 Identities = 215/570 (37%), Positives = 312/570 (54%), Gaps = 35/570 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
             IA+AQLNP +G IA N  K   A  +A  +G DL+L  EL + GYPP+DL+   SF++
Sbjct: 2   FTIALAQLNPTIGAIAENAEKIVTAALQAQARGADLLLTPELALCGYPPKDLLLNPSFVE 61

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQ-------EGVLNSVVILDAGNIIAVRDKINL 117
                +  L          I+VG             + + NS V+++ G I     K  L
Sbjct: 62  QLEEELQWLAEKMP-PSIAILVGTVTPHHQAERQGQKKLWNSAVLIEQGQIKQWFHKCLL 120

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNIC----------KHLKKQG 167
           P Y  F E R F S   ++  +++++++G+ ICED+W +                L  QG
Sbjct: 121 PTYDVFDEDRYFASAAKSEYFIYKNVKIGVTICEDLWNDEAFWGQKFYQVNPLMDLIDQG 180

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
              + +L+ASPY   K   R  +++      ++P+IYVNQVGG D+LIFDG SF  + Q 
Sbjct: 181 VNLVVNLSASPYSCGKHYLRESLISHSAKRFNVPLIYVNQVGGNDDLIFDGGSFAVNSQG 240

Query: 228 QLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYV 287
           ++  +   F E   +  +           ++        +P+ + E  + A VL + DY+
Sbjct: 241 KIIGRSPLFQEDLALLSYDLSSGELTGQKLAS-------LPMVDTEELWQALVLGVGDYL 293

Query: 288 QKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALG 347
            K  F K I+GLSGGIDS+L AAIAV+ALGKENV  I++P  Y+S  S++DA A AK LG
Sbjct: 294 HKCGFSKAILGLSGGIDSSLVAAIAVEALGKENVLGILMPSPYSSDHSIQDALALAKNLG 353

Query: 348 CKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSN 407
                +PI  ++  +   +    Q+ P G+  EN+QSRIRGN+LMA++N    +LL+T N
Sbjct: 354 MNTQTIPIGPIMATYDQALVPLFQDAPFGLAEENLQSRIRGNLLMAIANKFGHLLLSTGN 413

Query: 408 KSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEK 467
           KSE++VGY TLYGDM+GG   + D+ KTQVF+L  W N             +IPPS+L K
Sbjct: 414 KSELAVGYCTLYGDMNGGLAAIADVPKTQVFELCRWLNREQ---------TIIPPSVLTK 464

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSE 526
            PSAEL+P Q D +SLPPY +LD I+ R+VE  +S     +  +  E V  +  L+  SE
Sbjct: 465 PPSAELKPGQVDTDSLPPYDVLDGILGRLVEKHQSPQEIINAGFEREVVLKICQLVQKSE 524

Query: 527 YKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           +KRRQA  G K+T ++FG     PI+  F 
Sbjct: 525 FKRRQAAPGLKVTDRAFGSGWRMPIAQAFH 554


>gi|297194731|ref|ZP_06912129.1| NH(3)-dependent NAD(+) synthetase [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|297152418|gb|EDY66850.2| NH(3)-dependent NAD(+) synthetase [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 585

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 202/591 (34%), Positives = 305/591 (51%), Gaps = 44/591 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+ Q++  VGD+AGN          A  QG  L+ F E+ ++GYP EDL  + S
Sbjct: 1   MPQLRLALNQIDSTVGDLAGNAEAIVHWTRHAAEQGAHLVAFPEMVLTGYPVEDLALRSS 60

Query: 62  FIQACSSAIDTLKSDTHDGG---AGIVVGFPRQDQ----------EGVLNSVVILDAGNI 108
           F++A  + +  L +     G     ++VG+  + +              N+  +L  G +
Sbjct: 61  FVEASRATLRALAARLDSEGFGELPVIVGYLDRSETGRPRYGQPAGSPRNAAAVLHRGEV 120

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA 168
                K +LPNY  F E R F+ G +   I    + + + ICED+W++       +   A
Sbjct: 121 ALSFAKHHLPNYGVFDEFRYFVPGDTMPVIRVHGVDVALAICEDLWQDGGRVPAARSAKA 180

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
             L S+NASPY   K   R E+V  +         Y+  +GGQDEL+FDG S       +
Sbjct: 181 GLLISINASPYEREKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVGADGE 240

Query: 229 LAFQMKHFSEQNFMTEWHY-------------DQQLSQWNYMSDDSASTMYIP------- 268
           +  +   F+E + + +                D        +S +               
Sbjct: 241 VVARAPQFAEGSVVLDLELPAAAADAPEGVVDDGLRIDRVVLSQEPLPACEAELTGGYAD 300

Query: 269 -LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLP 327
            L ++E  Y+A V+ LR Y  KN F  V+IGLSGGIDSAL AAIA DALG +NV  + +P
Sbjct: 301 RLDDDEEVYSALVVGLRAYAAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMP 360

Query: 328 YKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIR 387
            KY+S  S  DAA  A+  G  +  +PI  + + +   +        +G+  EN+QSR+R
Sbjct: 361 SKYSSDHSKGDAAELARRTGLNFRTVPIEPMFDAYMGSLG------LTGLAEENLQSRLR 414

Query: 388 GNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSH 447
           G +LMA+SN    ++L   NKSE++VGY TLYGD  G + P+KD+YKT VF+LA WRN  
Sbjct: 415 GTMLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTTVFRLAKWRNRA 474

Query: 448 GITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN- 506
               G  P    IP + + K PSAELRP Q D +SLP Y +LD +++  V+ ++      
Sbjct: 475 AAERGQTP---PIPEASITKPPSAELRPGQVDTDSLPDYDVLDRLLELYVDRDQGKDAIV 531

Query: 507 DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
              +++  V     ++  +EYKRRQ P GTKI+AK FG+DR  PI+N++R+
Sbjct: 532 AAGFDEALVTKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWRE 582


>gi|320011138|gb|ADW05988.1| NAD+ synthetase [Streptomyces flavogriseus ATCC 33331]
          Length = 586

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 209/591 (35%), Positives = 305/591 (51%), Gaps = 44/591 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+ Q++  VGD+AGN          A  QG  L+ F E+ ++GYP EDL  + S
Sbjct: 1   MPQLRLALNQIDATVGDLAGNSESILHWTRHAAEQGAHLVAFPEMVLTGYPVEDLALRSS 60

Query: 62  FIQACSSAIDTLKSDTHDGG---AGIVVGFPRQDQ----------EGVLNSVVILDAGNI 108
           F++A   A+  L     D G     +VVG+  + +              N+  +L  G +
Sbjct: 61  FVEASRRALRALAVRLADEGFGELPVVVGYLDRSEHPAVRYGQPAGSPRNAAAVLHRGRV 120

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA 168
                K +LPNY  F E R F+ G S   +    I + + ICED+W++       +  GA
Sbjct: 121 ALNFAKHHLPNYGVFDEFRYFVPGDSMPVVRVHGIDVALAICEDLWQDGGRVPAARAAGA 180

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
             L S+NASPY  +K   R E+V  +         Y+   GGQDEL+FDG S       +
Sbjct: 181 GLLLSVNASPYERDKDDTRLELVRRRAREAGCTTAYLAMTGGQDELVFDGDSIVVGKDGE 240

Query: 229 LAFQMKHFSEQNFMTEWHY------------DQQLSQWNYMSDDSASTMYIP-------- 268
           +  +   FSE   + +                  L   + +  +     Y P        
Sbjct: 241 VIARAPQFSEGTVILDLDLPAASAEAPSGVVADGLRIDHVVLSEEPLPAYEPELAGGYAE 300

Query: 269 -LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLP 327
            L ++E  Y+A V+ LR Y  KN F  V+IGLSGGIDSAL A IA DALG +NV  + +P
Sbjct: 301 RLDDDEELYSALVVGLRAYAAKNGFSSVLIGLSGGIDSALVAVIACDALGADNVYGLSMP 360

Query: 328 YKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIR 387
            KY+S  S  DAA  A+  G  +  +PI  + + +   +        +G+  EN+QSR+R
Sbjct: 361 SKYSSDHSKGDAAELARRTGLNFRTVPIEPMFDAYMDSLG------LTGLAEENLQSRLR 414

Query: 388 GNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSH 447
           G +LMA+SN    ++L   NKSE++VGY TLYGD  G + P+KD+YKT VF+LA WRN  
Sbjct: 415 GTMLMAVSNQEGQIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSVFRLAKWRNRA 474

Query: 448 GITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN- 506
               G  P    IP + + K PSAELRP Q D +SLP Y +LD I++  V+ ++      
Sbjct: 475 AEERGQTP---PIPEASITKPPSAELRPDQVDTDSLPDYDVLDRILELYVDRDQGRDAIV 531

Query: 507 DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
              ++D  V     ++  +EYKRRQ P GTKI+ K FG+DR  PI+N++R+
Sbjct: 532 AAGFDDALVTRTLRMVDTAEYKRRQYPPGTKISPKGFGKDRRLPITNRWRE 582


>gi|283856355|ref|YP_162634.2| NAD synthetase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775354|gb|AAV89523.2| NAD+ synthetase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 558

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 245/557 (43%), Positives = 350/557 (62%), Gaps = 6/557 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  +L I +AQ+   VG    N     + R+EA    +DLILF EL + GYPPEDLV K 
Sbjct: 3   MTDQLTILLAQIPQTVGHCRRNADAMLKIRQEA--GKVDLILFPELQLIGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S +Q     ++ L   T DGGA ++VG   Q++  + N+V +LD G I A+R K +LPNY
Sbjct: 61  SLLQNAKEELERLALATSDGGAAMLVGTAWQEKGRIFNAVALLDQGKIAAIRYKHDLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G   +P++FRD+ LGI +CEDIW       HLK++GAE L   N SP+ 
Sbjct: 121 GTFDEKRIFSAGPLPEPVLFRDVSLGIPVCEDIWTEKLCA-HLKERGAEILLVPNGSPFE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   RH++V  ++    LP +Y+N+VGGQDE++FDG SF  +    +   +  +    
Sbjct: 180 SGKYPVRHKVVADRVKETGLPCLYLNRVGGQDEVVFDGGSFVVNRDGAVPISLPQWQADC 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           ++T WH  ++   W+      +       +     Y A ++ L DYV++N F  V++GLS
Sbjct: 240 YVTHWHKTEE--GWSCDEGLQSKISEGEDRRLSDIYQAMMMGLGDYVRQNGFSGVLLGLS 297

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL AA+AVDALG + V  +MLP +YTS +SL+DA ACA+ LGC+ D +PI+  V 
Sbjct: 298 GGIDSALSAAVAVDALGADKVWCVMLPSRYTSQESLDDARACAEMLGCRLDSVPINPAVE 357

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
               +++     +   I  ENIQSR+RG +LMA+SN    M+LTT NKSE++VGY TLYG
Sbjct: 358 AIDGMLAPLFSGKKPDITEENIQSRLRGVVLMAISNKFSPMVLTTGNKSEMAVGYATLYG 417

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG++ LKDLYK+ VF+++ WRNSH     LGP   V+P  ++ K PSAELR  Q D 
Sbjct: 418 DMNGGYSVLKDLYKSDVFKVSRWRNSHKPAHALGPDGYVMPDRVITKPPSAELREDQKDS 477

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD ++  ++E + S  +   + Y+ + V  +E+LL+ +EYKRRQAP G K+ 
Sbjct: 478 DSLPPYDILDAVLHGLIEEDLSCSDLVKRGYDPDLVTRIENLLHRAEYKRRQAPPGVKLG 537

Query: 540 AKSFGRDRLYPISNKFR 556
           +++FGRDR YP+S++FR
Sbjct: 538 SRNFGRDRRYPLSHQFR 554


>gi|326569726|gb|EGE19776.1| NAD+ synthetase [Moraxella catarrhalis BC8]
          Length = 563

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 226/554 (40%), Positives = 318/554 (57%), Gaps = 19/554 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           ++  AI Q N  VGDIAGN+ K      +A  +G D+++F EL + GYPPEDL+ + +  
Sbjct: 25  QMTFAIIQTNFWVGDIAGNVKKMHALTLDAKARGADIVIFPELALVGYPPEDLLLRPTLG 84

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +    A+  L       G  +++G+P  D  G  NS  IL  G+      K  LPNY  F
Sbjct: 85  ERVREAMAKLAEI---EGIVVILGYPHIDHHGTFNSAAILQDGSQKGFYHKQCLPNYGIF 141

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F  G +     ++ + +G+LICEDIW +    + LK+ GA+ +  +NASP+   K
Sbjct: 142 DEQRYFQKGLNQVLFDYKGVTIGLLICEDIWHDEP-IQALKQAGADLVIVINASPFEIGK 200

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
              R  ++T   S  HLPIIYVN VG QD+++FDG S       ++A +   F  Q  M 
Sbjct: 201 QTARKSLLTRHSSTHHLPIIYVNTVGAQDDIVFDGGSLITQSDGRVAHEGVRFLNQLLMA 260

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
            +    +       + D+ +   + L EE   Y A V+ LRDYV ++ F  VI+GLSGGI
Sbjct: 261 RFDIQNK-------TFDTQAKAPLVLSEESEMYQALVVGLRDYVNRSGFKGVIVGLSGGI 313

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IAVDALG + V  +M+PY+YT+  SLEDA A A  L   Y V PIHD V    
Sbjct: 314 DSALTLCIAVDALGCDRVYAVMMPYEYTAQISLEDAEAQAARLNVSYTVCPIHDAVAGLR 373

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++  L      +  EN+Q+R RG ILMALSN    M+++T NKSE +VGY TLYGDM 
Sbjct: 374 SALAPLLANSEPDVTEENLQARARGTILMALSNKFGHMVISTGNKSENAVGYSTLYGDMV 433

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+YKT V++LA++RN             VIP  ++ + PSAELRP+Q DQ+SL
Sbjct: 434 GGFDVLKDVYKTDVYRLANYRNRL-------EDNPVIPERVITRPPSAELRPNQKDQDSL 486

Query: 484 PPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
             Y  LD I+K  ++++  +       +  +TV  +  ++  +EYKRRQ  +GTKIT KS
Sbjct: 487 GDYDTLDSILKMYIDDDLGYKAIVAAGFEPKTVEKILGMVDRAEYKRRQGAIGTKITKKS 546

Query: 543 FGRDRLYPISNKFR 556
           FGR+R YP+ N + 
Sbjct: 547 FGRERRYPLVNGWS 560


>gi|326570757|gb|EGE20782.1| NAD+ synthetase [Moraxella catarrhalis BC1]
 gi|326573020|gb|EGE22996.1| NAD+ synthetase [Moraxella catarrhalis CO72]
 gi|326573542|gb|EGE23505.1| NAD+ synthetase [Moraxella catarrhalis 101P30B1]
          Length = 563

 Score =  483 bits (1242), Expect = e-134,   Method: Composition-based stats.
 Identities = 226/554 (40%), Positives = 318/554 (57%), Gaps = 19/554 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           ++  AI Q N  VGDIAGN+ K      +A  +G D+++F EL + GYPPEDL+ + +  
Sbjct: 25  QMTFAIIQTNFWVGDIAGNVKKMHALTLDAKARGADIVIFPELALVGYPPEDLLLRPTLG 84

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +    A+  L       G  +++G+P  D  G  NS  IL  G+      K  LPNY  F
Sbjct: 85  ERVREAMAKLAEI---EGIVVILGYPHIDHHGTFNSAAILQDGSQKGFYHKQCLPNYGIF 141

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F  G +     ++ + +G+LICEDIW +    + LK+ GA+ +  +NASP+   K
Sbjct: 142 DEQRYFQKGLNQVLFDYKGVTIGLLICEDIWHDEP-IQALKQAGADLVIVINASPFEIGK 200

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
              R  ++T   S  HLPIIYVN VG QD+++FDG S       ++A +   F  Q  M 
Sbjct: 201 QTARKSLLTRHSSTHHLPIIYVNTVGAQDDIVFDGGSLITQSDGRVAHEGVRFLNQLLMA 260

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
            +    +       + D+ +   + L EE   Y A V+ LRDYV ++ F  VI+GLSGGI
Sbjct: 261 RFDTQNK-------TFDTQAKAPLVLSEESEMYQALVVGLRDYVNRSGFKGVIVGLSGGI 313

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IAVDALG + V  +M+PY+YT+  SLEDA A A  L   Y V PIHD V    
Sbjct: 314 DSALTLCIAVDALGCDRVYAVMMPYEYTAQISLEDAEAQAARLNVSYTVCPIHDAVAGLR 373

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++  L      +  EN+Q+R RG ILMALSN    M+++T NKSE +VGY TLYGDM 
Sbjct: 374 SALAPLLANSEPDVTEENLQARARGTILMALSNKFGHMVISTGNKSENAVGYSTLYGDMV 433

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+YKT V++LA++RN             VIP  ++ + PSAELRP+Q DQ+SL
Sbjct: 434 GGFDVLKDVYKTDVYRLANYRNRL-------EDNPVIPERVITRPPSAELRPNQKDQDSL 486

Query: 484 PPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
             Y  LD I+K  ++++  +       +  +TV  +  ++  +EYKRRQ  +GTKIT KS
Sbjct: 487 GDYETLDSILKMYIDDDLGYKAIVAAGFEPKTVEKILSMVDRAEYKRRQGAIGTKITKKS 546

Query: 543 FGRDRLYPISNKFR 556
           FGR+R YP+ N + 
Sbjct: 547 FGRERRYPLVNGWS 560


>gi|326561328|gb|EGE11686.1| NAD+ synthetase [Moraxella catarrhalis 7169]
          Length = 563

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 227/554 (40%), Positives = 318/554 (57%), Gaps = 19/554 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           ++  AI Q N  VGDIAGN+ K      +A  +G D+++F EL + GYPPEDL+ + +  
Sbjct: 25  QMTFAIIQTNFWVGDIAGNVKKMHALTLDAKARGADIVIFPELALVGYPPEDLLLRPTLG 84

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +    A+  L       G  +++G+P  D  G  NS  IL  G+      K  LPNY  F
Sbjct: 85  ERVREAMAKLAEI---EGIVVILGYPHIDHHGTFNSAAILQDGSQKGFYHKQCLPNYGIF 141

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F  G +     ++ + +G+LICEDIW +  I   LK+ GA+ +  +NASP+   K
Sbjct: 142 DEQRYFQKGLNQVLFDYKGVTIGLLICEDIWHDEPIY-MLKQAGADLVIVINASPFEIGK 200

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
              R  ++T   S  HLPIIYVN VG QD+++FDG S       ++A +   F  Q  M 
Sbjct: 201 QTARKSLLTRHSSTHHLPIIYVNTVGAQDDIVFDGGSLITQSDGRVAHEGVRFLNQLLMA 260

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
            +    +       + D+ +   + L EE   Y A V+ LRDYV ++ F  VI+GLSGGI
Sbjct: 261 RFDIQNK-------TFDTQAKAPLVLSEESEMYQALVVGLRDYVNRSGFKGVIVGLSGGI 313

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IAVDALG + V  +M+PY+YT+  SLEDA A A  L   Y V PIHD V    
Sbjct: 314 DSALTLCIAVDALGSDRVYAVMMPYEYTAQISLEDAEAQAARLNVSYTVCPIHDAVAGLR 373

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++  L      +  EN+Q+R RG ILMALSN    M+++T NKSE +VGY TLYGDM 
Sbjct: 374 SALAPLLANSEPDVTEENLQARARGTILMALSNKFGHMVISTGNKSENAVGYSTLYGDMV 433

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+YKT V++LA++RN             VIP  ++ + PSAELRP+Q DQ+SL
Sbjct: 434 GGFDVLKDVYKTDVYRLANYRNRL-------EDNPVIPERVITRPPSAELRPNQKDQDSL 486

Query: 484 PPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
             Y  LD I+K  ++++  +       +  +TV  +  ++  +EYKRRQ  +GTKIT KS
Sbjct: 487 GDYETLDSILKMYIDDDLGYKAIVAAGFEPKTVEKILGMVDRAEYKRRQGAIGTKITKKS 546

Query: 543 FGRDRLYPISNKFR 556
           FGR+R YP+ N + 
Sbjct: 547 FGRERRYPLVNGWS 560


>gi|188990496|ref|YP_001902506.1| putative bifunctional NAD(+) synthase (glutamine-hydrolyzing) /
           nitrilase [Xanthomonas campestris pv. campestris str.
           B100]
 gi|167732256|emb|CAP50448.1| putative bifunctional NAD(+) synthase (glutamine-hydrolyzing) /
           nitrilase [Xanthomonas campestris pv. campestris]
          Length = 552

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 222/566 (39%), Positives = 316/566 (55%), Gaps = 26/566 (4%)

Query: 1   MLK------KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPP 53
           M++       L+IA+AQ +  VG +  N  +       A  +   D++LF EL ISGYPP
Sbjct: 1   MMESAVTAHTLRIAMAQFDFPVGAVTQNTDRIIEYIAAARDEFDADIVLFPELAISGYPP 60

Query: 54  EDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRD 113
           EDL+ +  F+  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   
Sbjct: 61  EDLLLRPGFLAHCEQALARIAAATR--GIVAVVGWPQSAGSVVYNAASVLREGRIEATYR 118

Query: 114 KINLPNYSEFHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFL 171
           K  LPNY+ F E+R F       N  +  + +++G++ICED+W    + K ++  GAE +
Sbjct: 119 KRELPNYAVFDERRYFDVDPDGDNCVVTVKGVQVGVVICEDLWFAEPLAKTVQA-GAELV 177

Query: 172 FSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAF 231
              NASPY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +  
Sbjct: 178 LVPNASPYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHP 237

Query: 232 QMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNN 291
               F +Q  + ++   ++        DD   +M      +   + A V  L+DY  KN 
Sbjct: 238 AAAAFVDQWLVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLKDYCGKNG 291

Query: 292 FHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYD 351
           F KV +GLSGGIDSAL  A+AVDALG ENV  + LP +YT+  S + A    +ALG K +
Sbjct: 292 FRKVWLGLSGGIDSALVLAMAVDALGGENVTAVRLPSRYTAGLSNDLAEEQCRALGVKLE 351

Query: 352 VLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEI 411
            + I        + +     +    I  EN+QSR RG ILMALSN    ++LTT NKSE 
Sbjct: 352 TIAIEPAFEGLLAALGPLFADTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEY 411

Query: 412 SVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSA 471
           +VGY T+YGDM GG+ PLKDLYKT+VF LA WRN+ G          VIPP+++ + PSA
Sbjct: 412 AVGYATIYGDMCGGYAPLKDLYKTEVFGLAKWRNTVGG-------APVIPPAVISRPPSA 464

Query: 472 ELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRR 530
           ELR +QTDQ+SLPPY +LD I+ R V+ E+S  +     Y  +TV +V  L+  +E+KR 
Sbjct: 465 ELRDNQTDQDSLPPYDVLDGILYRYVDQEQSRDDIVAAGYAADTVEHVLRLVRLNEWKRH 524

Query: 531 QAPVGTKITAKSFGRDRLYPISNKFR 556
           QA  G K++ ++FGR+R YPI+N + 
Sbjct: 525 QAAPGPKVSRRAFGRERRYPITNGYS 550


>gi|257454474|ref|ZP_05619734.1| glutamine-dependent NAD(+) synthetase [Enhydrobacter aerosaccus
           SK60]
 gi|257448132|gb|EEV23115.1| glutamine-dependent NAD(+) synthetase [Enhydrobacter aerosaccus
           SK60]
          Length = 614

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 221/553 (39%), Positives = 320/553 (57%), Gaps = 15/553 (2%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           LKIA+AQ   +VGD+  N  K     ++A  +G ++I+F EL + GYPPEDL+ + S   
Sbjct: 70  LKIAVAQQQFIVGDVINNAKKMVELAKDARDKGANIIVFPELSLLGYPPEDLLLRPSLAS 129

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
               A + L          ++VG+P  D  G  NSV I+  G       K  LPNY  F 
Sbjct: 130 RVKLAFELL---YTVKDIVMLVGYPHIDPNGTFNSVAIIHNGQQKGFYHKQCLPNYGVFD 186

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E+R F +G++     ++ + +G+LICED+W      + LK++GAE + SLNASP+  NK 
Sbjct: 187 ERRYFNTGHNQVLFDYQGLTIGLLICEDLW-QDAPIRALKEKGAEIIISLNASPFEQNKQ 245

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           ++R  ++  + +  ++PI+Y N VGGQD+L+FDG S   + Q ++  +   F +      
Sbjct: 246 EQRKALLKSRATEHNIPIVYANSVGGQDDLVFDGGSMVVNAQGKIVQEAPRFLQHTLYVV 305

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
             +D Q  Q        +    + L +    Y A V+ LRDYV  + F  V++GLSGGID
Sbjct: 306 ARHDAQSGQVILSEQRKS---PLALSQIAETYQALVVGLRDYVNHSGFKGVLVGLSGGID 362

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL   IAVDALG + V  +M+PY+YTS  SL+DA A A  L   Y V PIH  V     
Sbjct: 363 SALTLCIAVDALGADKVYAVMMPYEYTSQISLQDAQAQAHRLNVSYTVCPIHAAVEGMRH 422

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            +        +    ENIQ+R RG ILMALSN    +++TT NKSE++VGY TLYGDM+G
Sbjct: 423 TLEPMFSNTTADTTEENIQARARGMILMALSNKFGHLVITTGNKSEMAVGYATLYGDMAG 482

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF+ LKD+YKTQV+ LA++RN           T VIP  ++ + PSAELRP Q DQ+SLP
Sbjct: 483 GFDVLKDVYKTQVYALANYRNRL-------EETPVIPERVITRPPSAELRPDQKDQDSLP 535

Query: 485 PYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
            Y  LD +++  ++ +  +    +  Y+ + V+ V  ++  +EYKRRQA +GTKIT ++F
Sbjct: 536 DYDTLDKMLELYIDRDFGYDAIVEAGYDKDVVKKVLSMVDRNEYKRRQAAIGTKITHRAF 595

Query: 544 GRDRLYPISNKFR 556
           GR+R YP+ N + 
Sbjct: 596 GRERRYPLVNHWS 608


>gi|223935581|ref|ZP_03627497.1| NAD+ synthetase [bacterium Ellin514]
 gi|223895589|gb|EEF62034.1| NAD+ synthetase [bacterium Ellin514]
          Length = 545

 Score =  482 bits (1241), Expect = e-134,   Method: Composition-based stats.
 Identities = 221/567 (38%), Positives = 314/567 (55%), Gaps = 39/567 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+A+AQ+N  VGD+AGN AK     + A   G+DL++F EL I+GYPP DL+ KK FI 
Sbjct: 1   MKVALAQINTTVGDLAGNEAKILAGYQRAVEAGVDLVMFPELTITGYPPRDLLHKKRFIA 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG----VLNSVVILDAGNIIAVRDKINLPNY 120
                ++ L + +   G   +VG+  +++      + N V +L  G I+  R K  LP Y
Sbjct: 61  ENLEVLNRLAAVSGKVGM--LVGYVTENKTRPGKELSNCVALLQNGKIVESRIKTLLPTY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNIC----------KHLKKQGAEF 170
             F E R F     N P+ F   +LG+ ICEDIW + +              L   GA  
Sbjct: 119 DVFDEDRYFEPANENQPVEFNGTKLGLTICEDIWNDEDFWPERRYRHNPPMELAGAGAGI 178

Query: 171 LFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLA 230
           LF+++ASP+   K + R+ ++         P+++ NQ+GG DELIFDG S  F+ +  L 
Sbjct: 179 LFNVSASPWSLGKEETRYNMLRSMAIKSKRPVVFCNQIGGNDELIFDGGSLAFNAEGTLI 238

Query: 231 FQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKN 290
            +   F+E  F+ +     ++ +  +               EE  Y A VL LRDY+ K 
Sbjct: 239 GRGDMFAEDFFVVDTESSVEVPRMEW-------------SAEEFIYKALVLGLRDYLHKC 285

Query: 291 NFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKY 350
            F   ++GLSGGIDSAL A IAVDALGKE+V+ + LP +Y+S  SL+DA   A+ LG +Y
Sbjct: 286 GFKSAVLGLSGGIDSALTAVIAVDALGKEHVRGVSLPSQYSSQGSLDDAQILAERLGIRY 345

Query: 351 DVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSE 410
           DV+PI          ++            ENIQ+R+RG  LMA+SN   A+LLTT NKSE
Sbjct: 346 DVVPIQPEFEAVKKQLASVFTGLKEDTTEENIQARLRGVTLMAMSNKFGALLLTTGNKSE 405

Query: 411 ISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPS 470
           ++VGY TLYGDM GG   + D+ KT V+Q++ W N            E+IP   + K PS
Sbjct: 406 LAVGYCTLYGDMCGGLAVISDVPKTMVYQISKWINREQ---------EIIPRDTITKPPS 456

Query: 471 AELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKR 529
           AELRP+QTDQ+SLPPY +LD I+   V   +         + + TV+ V  L+  +EYKR
Sbjct: 457 AELRPNQTDQDSLPPYEVLDAILDAYVVQGKGMREIIALGFEEPTVKRVIRLIDFNEYKR 516

Query: 530 RQAPVGTKITAKSFGRDRLYPISNKFR 556
           RQA  G K+T+K+FG  R  PI+ K++
Sbjct: 517 RQAAPGLKVTSKAFGVGRRIPIAQKYQ 543


>gi|238028323|ref|YP_002912554.1| NAD synthetase [Burkholderia glumae BGR1]
 gi|237877517|gb|ACR29850.1| NAD+ synthetase [Burkholderia glumae BGR1]
          Length = 561

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 230/576 (39%), Positives = 321/576 (55%), Gaps = 34/576 (5%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  +IA+AQLN  VGD AGN+A+   A   A+  G  L++  EL +SGYPPEDL+ + +
Sbjct: 1   MKT-RIALAQLNVTVGDFAGNVARIVEAARAAHDDGAQLLVAPELALSGYPPEDLLLRPA 59

Query: 62  FIQACSSAIDTLKSDTHDG-GAGIVVGFPRQDQEG----------------VLNSVVILD 104
           F    + A+  L        G  ++VG P +                      N+  +L 
Sbjct: 60  FYTEAAEALARLAECLKPFEGLAVLVGHPLRTPSADGNANRPIGRGATPVDTYNAASLLV 119

Query: 105 AGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLK 164
            G I A   K +LPN   F EKR F +            R G++ICED W  S      K
Sbjct: 120 GGAIAATYRKQDLPNTEVFDEKRYFATDPQPCVFELNGTRFGVIICEDAWHASAAQ-LAK 178

Query: 165 KQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFD 224
             GAE L   N SPY+ +K   R  IV  +I    LP++YVN VGGQDEL+FDG SF  D
Sbjct: 179 AAGAEVLLVPNGSPYHMDKDAVRVGIVRARIRETGLPVVYVNLVGGQDELVFDGGSFVLD 238

Query: 225 GQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLR 284
           G  +L  +M  F   + + E+   + L             +  PL  E   Y A VL +R
Sbjct: 239 GAGELVARMPQFEAGHAIVEFDGARPLPG----------EIAAPLPVEAQVYRALVLGVR 288

Query: 285 DYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAK 344
           DY+ KN F   +IGLSGG+DSAL  A+A DALG E V+ +M+P +YT+  S  DAA  A+
Sbjct: 289 DYIGKNGFPGALIGLSGGVDSALVLAVACDALGPERVRAVMMPSRYTADISTTDAAEMAR 348

Query: 345 ALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLT 404
            +G +YD + I  + + F   ++            ENIQ+RIRG +LMALSN   +++LT
Sbjct: 349 RVGVRYDEIAIAPMFDAFCGALADEFAGRDEDATEENIQARIRGTLLMALSNKFGSIVLT 408

Query: 405 TSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSI 464
           T NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +RN+          TEVIP  I
Sbjct: 409 TGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCHYRNAAAEFGS----TEVIPARI 464

Query: 465 LEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLY 523
           L ++PSAELR +QTDQ+SLPPY +LD I++  +E ++         Y++  V  V  L+ 
Sbjct: 465 LSRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDQPLAAIVAAGYDEADVTRVTRLIK 524

Query: 524 GSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
            +EYKRRQAP+G ++T ++FGRD  YPI+++F + I
Sbjct: 525 INEYKRRQAPIGIRVTHRAFGRDWRYPITSRFTERI 560


>gi|326564236|gb|EGE14470.1| NAD+ synthetase [Moraxella catarrhalis 46P47B1]
          Length = 563

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 226/554 (40%), Positives = 318/554 (57%), Gaps = 19/554 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           ++  AI Q N  VGDIAGN+ K      +A  +G D+++F EL + GYPPEDL+ + +  
Sbjct: 25  QMTFAIIQTNFWVGDIAGNVKKMHALTLDAKARGADIVIFPELALVGYPPEDLLLRPTLG 84

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +    A+  L       G  +++G+P  D  G  NS  IL  G+      K  LPNY  F
Sbjct: 85  ERVREAMAKLAEI---EGIVVILGYPHIDHHGTFNSAAILQDGSQKGFYHKQCLPNYGIF 141

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F  G +     ++ + +G+LICEDIW +    + LK+ GA+ +  +NASP+   K
Sbjct: 142 DEQRYFQKGLNQVLFDYKGVTIGLLICEDIWHDEP-IQALKQAGADLVIVINASPFEIGK 200

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
              R  ++T   S  HLPIIYVN VG QD+++FDG S       ++A +   F  Q  M 
Sbjct: 201 QTARKSLLTRHSSTHHLPIIYVNTVGAQDDIVFDGGSLITQSDGRVAHEGVRFLNQLLMA 260

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
            +    +       + D+ +   + L EE   Y A V+ LRDYV ++ F  VI+GLSGGI
Sbjct: 261 RFDTQNK-------TFDTQAKAPLVLSEESEMYQALVVGLRDYVNRSGFKGVIVGLSGGI 313

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IAVDALG + V  +M+PY+YT+  SLEDA A A  L   Y V PIHD V    
Sbjct: 314 DSALTLCIAVDALGCDRVYAVMMPYEYTAQISLEDAEAQAARLNVSYTVCPIHDAVAGLR 373

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++  L      +  EN+Q+R RG ILMALSN    M+++T NKSE +VGY TLYGDM 
Sbjct: 374 SALAPLLANSEPDVTEENLQARARGTILMALSNKFGHMVISTGNKSENAVGYSTLYGDMV 433

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+YKT V++LA++RN             VIP  ++ + PSAELRP+Q DQ+SL
Sbjct: 434 GGFDVLKDVYKTDVYRLANYRNRL-------EDNPVIPERVITRPPSAELRPNQKDQDSL 486

Query: 484 PPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
             Y  LD I+K  ++++  +       +  +TV  +  ++  +EYKRRQ  +GTKIT KS
Sbjct: 487 GDYETLDSILKMYIDDDLGYKAIVAAGFEPKTVEKILGMVDRAEYKRRQGAIGTKITKKS 546

Query: 543 FGRDRLYPISNKFR 556
           FGR+R YP+ N + 
Sbjct: 547 FGRERRYPLVNGWS 560


>gi|312115466|ref|YP_004013062.1| NAD+ synthetase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220595|gb|ADP71963.1| NAD+ synthetase [Rhodomicrobium vannielii ATCC 17100]
          Length = 554

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 282/560 (50%), Positives = 373/560 (66%), Gaps = 8/560 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M    +IA AQLNPV+GD+AGN+A AR AR++A     DL++FTELFI+GYPPEDL+ K 
Sbjct: 1   MTASFRIACAQLNPVLGDLAGNVALARAARDDARALAADLVVFTELFIAGYPPEDLILKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+ AC  A   L + T DGG  +++G P  +     N+V +L  G I A+R K++LPNY
Sbjct: 61  AFVAACMEATRALAATTADGGPALLIGTPWGEDGKAYNAVALLAGGRIQALRYKVDLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F EKR F  G   +P+ F  +RLG+ ICEDIW  + +   L  +GAE L S N SP+ 
Sbjct: 121 SVFDEKRVFAPGPLPEPVDFAGLRLGLPICEDIWTPAVVG-SLAARGAELLISPNGSPFT 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  +R ++   +++   LP++Y+NQ GGQDEL+FDGASF  +    LA Q+  +    
Sbjct: 180 LKKRTQRLDVARARVAETGLPLLYINQFGGQDELVFDGASFALNRDGALAAQLPAWETAL 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +TEW  D     W  +   SA       +  EA Y ACV+ LRDYV+KN F  V++GLS
Sbjct: 240 AITEWRRDAG--GWACVEGPSARVE----EGREAAYLACVIGLRDYVEKNRFPGVVLGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+CAA+A DALG   V  IMLPY+YTS  SL+DAAACA+ALG +YD++PIH  V 
Sbjct: 294 GGIDSAICAAMATDALGAARVHCIMLPYRYTSNASLDDAAACAEALGVRYDIVPIHTAVE 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F  +++   +    G+  EN+QSRIRG  LMA+SN    M++TT NKSE+S GY TLYG
Sbjct: 354 AFGGMLAPLFKGAEPGLAEENLQSRIRGTTLMAVSNKFGGMVVTTGNKSEVSAGYATLYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNP+KDLYKTQVF L+ +RN H     LGP   VIP +I+ K+P+AELR +QTDQ
Sbjct: 414 DMNGGFNPIKDLYKTQVFALSRFRNEHVPKGCLGPGGVVIPDNIITKAPTAELRENQTDQ 473

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LDDI++ +V+ EE       + +  ETV+ VE LLY SEYKRRQA  G KIT
Sbjct: 474 DSLPPYDVLDDILESLVDREEPLSAVVARGHAPETVKKVERLLYLSEYKRRQAAPGVKIT 533

Query: 540 AKSFGRDRLYPISNKFRDHI 559
            ++FGRDR YPI N+FR+ +
Sbjct: 534 ERNFGRDRRYPIVNRFREQL 553


>gi|296112564|ref|YP_003626502.1| NAD+ synthetase [Moraxella catarrhalis RH4]
 gi|295920258|gb|ADG60609.1| NAD+ synthetase [Moraxella catarrhalis RH4]
 gi|326571668|gb|EGE21683.1| NAD+ synthetase [Moraxella catarrhalis BC7]
          Length = 563

 Score =  481 bits (1239), Expect = e-133,   Method: Composition-based stats.
 Identities = 227/554 (40%), Positives = 318/554 (57%), Gaps = 19/554 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           ++  AI Q N  VGDIAGN+ K      +A  +G D+++F EL + GYPPEDL+ + +  
Sbjct: 25  QMTFAIIQTNFWVGDIAGNVKKMHALTLDAKARGADIVIFPELALVGYPPEDLLLRPTLG 84

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +    A+  L       G  +++G+P  D  G  NS  IL  G+      K  LPNY  F
Sbjct: 85  ERVREAMAKLAEI---EGIVVILGYPHIDHHGTFNSAAILQDGSQKGFYHKQCLPNYGIF 141

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E+R F  G +     ++ + +G+LICEDIW +  I   LK+ GA+ +  +NASP+   K
Sbjct: 142 DEQRYFQKGLNQVLFDYKGVTIGLLICEDIWHDEPIY-MLKQAGADLVIVINASPFEIGK 200

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
              R  ++T   S  HLPIIYVN VG QD+++FDG S       ++A +   F  Q  M 
Sbjct: 201 QTARKSLLTRHSSTHHLPIIYVNTVGAQDDIVFDGGSLITQSDGRVAHEGVRFLNQLLMA 260

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
            +    +       + D+ +   + L EE   Y A V+ LRDYV ++ F  VI+GLSGGI
Sbjct: 261 RFDTQNK-------TFDTQAKAPLVLSEESEMYQALVVGLRDYVNRSGFKGVIVGLSGGI 313

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL   IAVDALG + V  +M+PY+YT+  SLEDA A A  L   Y V PIHD V    
Sbjct: 314 DSALTLCIAVDALGCDRVYAVMMPYEYTAQISLEDAEAQAARLNVSYTVCPIHDAVAGLR 373

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           S ++  L      +  EN+Q+R RG ILMALSN    M+++T NKSE +VGY TLYGDM 
Sbjct: 374 SALAPLLANSEPDVTEENLQARARGTILMALSNKFGHMVISTGNKSENAVGYSTLYGDMV 433

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+YKT V++LA++RN             VIP  ++ + PSAELRP+Q DQ+SL
Sbjct: 434 GGFDVLKDVYKTDVYRLANYRNRL-------EDNPVIPERVITRPPSAELRPNQKDQDSL 486

Query: 484 PPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
             Y  LD I+K  ++++  +       +  +TV  +  ++  +EYKRRQ  +GTKIT KS
Sbjct: 487 GDYETLDSILKMYIDDDLGYKAIVAAGFEPKTVEKILGMVDRAEYKRRQGAIGTKITKKS 546

Query: 543 FGRDRLYPISNKFR 556
           FGR+R YP+ N + 
Sbjct: 547 FGRERRYPLVNGWS 560


>gi|296139215|ref|YP_003646458.1| NAD+ synthetase [Tsukamurella paurometabola DSM 20162]
 gi|296027349|gb|ADG78119.1| NAD+ synthetase [Tsukamurella paurometabola DSM 20162]
          Length = 582

 Score =  481 bits (1239), Expect = e-133,   Method: Composition-based stats.
 Identities = 218/590 (36%), Positives = 310/590 (52%), Gaps = 44/590 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  L++A  Q+NPVVGD+  N+++   A  +A  +G  + +F E+ ++GYP EDL+ ++S
Sbjct: 1   MTPLRVAACQINPVVGDLDANVSRITAAARDAAERGAQVAVFGEMALTGYPVEDLLLRRS 60

Query: 62  FIQACSSAIDTLK---SDTHDGGAGIVVGFPRQDQ----------EGVLNSVVILDAGNI 108
           F      A+  L         G   +VVGF  +D            G  N+  +L  G +
Sbjct: 61  FAVDSREAVHDLAHSLDAAGCGDLIVVVGFLDRDPDAPETSTNPTGGARNAAGVLHRGEL 120

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA 168
           +A  DK  LPNY  F EKR F  G     +    +RLG+ ICED+W        L + G 
Sbjct: 121 VARYDKHFLPNYGVFDEKRWFTPGDRLVVLDVDGVRLGLAICEDVWWPDGPVAGLGELGV 180

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
           + +  LNASP+   K ++R E+V  +++    P+IYVN VGGQDEL+FDG SF F  +  
Sbjct: 181 DAVLCLNASPFEVGKPEQRREVVAQRVAEGGAPVIYVNLVGGQDELVFDGDSFVFGPEGA 240

Query: 229 LAFQMKHFSEQNFMTEWH---------------YDQQLSQWNYMSDDSASTMYIPLQEEE 273
            A     F E   + +                     L+           T +  L E  
Sbjct: 241 PAT-GPQFVEFTQLVDVSPRGREHATTVEGWQVESLALAARPTPLAPQVVTDWPELDEYA 299

Query: 274 ADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSP 333
             + A V   RDYV K     V +G+SGGIDSAL A IA DA+G +NV  + +P KY+S 
Sbjct: 300 QIWAALVTGTRDYVHKVGGSTVALGMSGGIDSALVAVIAADAVGADNVYGVGMPSKYSSD 359

Query: 334 QSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMA 393
            S +DAA  A+ +G  +   PI  +V  F   +        +G+  ENIQ+R RG  LM+
Sbjct: 360 HSKDDAADQAQRMGIHFRFEPIEHMVESFVGQLH------LTGLAEENIQARCRGMTLMS 413

Query: 394 LSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGL 453
           LSN    ++L T NKSE++VGY T+YGD  G + P++D+ K+ V+ LA WRN   +  G 
Sbjct: 414 LSNLDGHLVLATGNKSELAVGYSTIYGDAVGAYAPIRDVEKSLVWDLARWRNKLAVERGE 473

Query: 454 GPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINND------ 507
            P    IP + + K PSAELRP Q D +SLP Y ILDDI++R VE ++            
Sbjct: 474 TP---PIPENSITKEPSAELRPGQKDSDSLPDYEILDDILRRYVEQDQGVAEIAADGNNG 530

Query: 508 QEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
             Y  + +R V  L+  +EYKRRQ P+G KIT K+FGRDR  PI+N++ D
Sbjct: 531 AGYEPDLIRTVARLVDRAEYKRRQYPLGPKITPKAFGRDRRMPITNRWHD 580


>gi|311693416|gb|ADP96289.1| NAD+ synthetase [marine bacterium HP15]
          Length = 538

 Score =  481 bits (1239), Expect = e-133,   Method: Composition-based stats.
 Identities = 221/550 (40%), Positives = 316/550 (57%), Gaps = 19/550 (3%)

Query: 9   IAQLNPVVGDIAGNIAKARRAREEANRQG-MDLILFTELFISGYPPEDLVFKKSFIQACS 67
           +AQL+ +VGDI GN      A   A+ +   D+++F EL ++GYPPEDL+ + S     +
Sbjct: 3   MAQLDFLVGDIPGNTELVLDAARRASSEHQADVVVFPELCLTGYPPEDLLLRPSMEVRVN 62

Query: 68  SAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKR 127
            A++ L+         IV+G P +    + N+ V++DAG I     K   PNY  F EKR
Sbjct: 63  EALERLQ--AERLDPVIVIGAPLRHGALLYNAAVVIDAGEITGRYFKRFPPNYQVFDEKR 120

Query: 128 TFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKR 187
            F  G     +  R + +GI +CED+WK     +     GA  + +LNASPY  +K  +R
Sbjct: 121 YFAEGRDVLTLDIRGVPVGITVCEDLWKEGP-VEDCAAAGARLILNLNASPYDIDKQARR 179

Query: 188 HEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHY 247
             ++  +     + I+YVN VGGQDEL+FDG S  FD    L  +   F E  +  ++  
Sbjct: 180 KALLERKSRENLVSIVYVNLVGGQDELVFDGGSMVFDHSGVLTAEAPQFGEGLYPVDF-- 237

Query: 248 DQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSAL 307
              L + +      A      L  E   Y A V  +RDYV KN F  V++GLSGGIDSA+
Sbjct: 238 ---LCEHHCQPVSQALPEEPTL--EANVYRALVTGVRDYVNKNGFKSVVLGLSGGIDSAV 292

Query: 308 CAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMS 367
             A+AVDALGK+ V+ +M+P++YTS  SLEDA A A ALG +YDV  I  + + F   ++
Sbjct: 293 TLAVAVDALGKDRVRAVMMPFRYTSSMSLEDAEAEAVALGVQYDVFSIEPMYDAFMETLA 352

Query: 368 QFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFN 427
              +        EN+Q+R+RG +LM+LSN   +++LTT NKSE++VGY TLYGDM+GGF+
Sbjct: 353 GPFEGTTPDTTEENLQARLRGVLLMSLSNKFGSLVLTTGNKSEMAVGYSTLYGDMAGGFD 412

Query: 428 PLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYP 487
            LKD+ KT VF+LA +RN+           EVIP  ++ + PSAEL P Q D++SLP Y 
Sbjct: 413 VLKDVPKTLVFRLAKYRNTLS-------EGEVIPERVITRPPSAELAPDQKDEDSLPGYD 465

Query: 488 ILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRD 546
           +LD I+   VE + S        +    V  V  L+  +EYKRRQAP+G +IT + FG+D
Sbjct: 466 VLDQILNLYVERDFSADAIVAEGFERVDVERVIRLVDINEYKRRQAPIGVRITERGFGKD 525

Query: 547 RLYPISNKFR 556
           R YPI+N ++
Sbjct: 526 RRYPITNGWK 535


>gi|260752640|ref|YP_003225533.1| NAD synthetase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258552003|gb|ACV74949.1| NAD+ synthetase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 558

 Score =  481 bits (1239), Expect = e-133,   Method: Composition-based stats.
 Identities = 244/557 (43%), Positives = 349/557 (62%), Gaps = 6/557 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  +L I +AQ+   VG    N     + R+EA    +DLILF EL + GYPPEDLV K 
Sbjct: 3   MTDQLTILLAQIPQTVGHCRRNADAMLKIRQEA--GKVDLILFPELQLIGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S +Q     ++ L   T DGGA ++VG   Q++  + N+V +LD G I A+R K +LPNY
Sbjct: 61  SLLQNAKEELERLALATSDGGAAMLVGTAWQEKGRIFNAVALLDQGKIAAIRYKHDLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G   +P++FRD+ LGI +CEDIW       HLK++GAE L   N SP+ 
Sbjct: 121 GTFDEKRIFSAGPLPEPVLFRDVSLGIPVCEDIWTEKLCA-HLKERGAEILLVPNGSPFE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R ++V  ++    LP +Y+N+VGGQDE++FDG SF  +    +   +  +    
Sbjct: 180 SGKYPVRRKVVADRVKETGLPCLYLNRVGGQDEVVFDGGSFVVNRDGAVPVSLPQWQADC 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           ++T WH  ++   W+      +  +          Y A ++ L DYV++N F  V++GLS
Sbjct: 240 YVTHWHKTEE--GWSCDEGLQSKILEGEDGRLSDIYQAMMMGLGDYVRQNGFSGVLLGLS 297

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL AA+AVDALG + V  +MLP +YTS +SL+DA ACA+ LGC+ D +PI+  V 
Sbjct: 298 GGIDSALSAAVAVDALGADKVWCVMLPSRYTSQESLDDARACAEMLGCRLDSVPINPAVE 357

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
               +++     +   I  ENIQSR+RG +LMA+SN    M+LTT NKSE++VGY TLYG
Sbjct: 358 AIDGMLAPLFSGKKPDITEENIQSRLRGVVLMAISNKFSPMVLTTGNKSEMAVGYATLYG 417

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG++ LKDLYK+ VF+++ WRNSH     LGP   V+P  ++ K PSAELR  Q D 
Sbjct: 418 DMNGGYSVLKDLYKSDVFKVSRWRNSHKPAHALGPDGYVMPDRVITKPPSAELREDQKDS 477

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD ++  ++E + S  +   + Y+ + V  +E+LL+ +EYKRRQAP G K+ 
Sbjct: 478 DSLPPYDILDAVLHGLIEEDLSCSDLVKRGYDPDLVTRIENLLHRAEYKRRQAPPGVKLG 537

Query: 540 AKSFGRDRLYPISNKFR 556
           +++FGRDR YP+S++FR
Sbjct: 538 SRNFGRDRRYPLSHQFR 554


>gi|239940755|ref|ZP_04692692.1| putative NH3-dependent NAD+ synthetase [Streptomyces roseosporus
           NRRL 15998]
 gi|239987233|ref|ZP_04707897.1| putative NH3-dependent NAD+ synthetase [Streptomyces roseosporus
           NRRL 11379]
          Length = 584

 Score =  481 bits (1239), Expect = e-133,   Method: Composition-based stats.
 Identities = 212/591 (35%), Positives = 314/591 (53%), Gaps = 44/591 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+ Q++  VGD+AGN          A  QG  L+ F E+ ++GYP EDL  + S
Sbjct: 1   MPQLRLALNQIDSTVGDLAGNSEAIVHWTRHAAEQGAHLVAFPEMVLTGYPVEDLALRSS 60

Query: 62  FIQACSSAIDTLKSDTHDGG---AGIVVGFPRQDQ----------EGVLNSVVILDAGNI 108
           F++A   A+  L +     G     +VVG+  + +              N+  +L  G I
Sbjct: 61  FVEASRQALRALAARLDTEGFGELPVVVGYLDRSEHAAARYGQPAGSPRNAAAVLHRGGI 120

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA 168
                K +LPNY  F E R F+ G S   +    I + + ICED+W++       +  GA
Sbjct: 121 ALNFAKHHLPNYGVFDEFRYFVPGDSMPVVRVHGIDVALAICEDLWQDGGRVPAARSAGA 180

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
             L S+NASPY  +K   R E+V  +         Y+  +GGQDEL+FDG S   D + +
Sbjct: 181 GLLLSINASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDKEGE 240

Query: 229 LAFQMKHFSEQNFMTEWHY------------DQQLSQWNYMSDDSASTMYIP-------- 268
           +  +   FSE + + +               D  L   + +  D     Y P        
Sbjct: 241 VIARAPQFSEGSVILDLELPAAAAVAPSGVVDDGLRIDHVVISDEPVAAYEPELAGGYAE 300

Query: 269 -LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLP 327
            L++EE  Y+A V+ LR Y  KN F  V+IGLSGGIDSA+CAAIA DALG +NV  + +P
Sbjct: 301 RLEDEEEIYSALVVGLRAYAAKNGFSSVLIGLSGGIDSAICAAIACDALGAQNVYGVSMP 360

Query: 328 YKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIR 387
            KY+S  S +DAA  A+  G  +  +PI  + + +   +      + +G+  EN+Q+R+R
Sbjct: 361 SKYSSGHSKDDAAELARRTGLNFRTVPIAPMFDAYMESL------QLTGLAEENLQARLR 414

Query: 388 GNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSH 447
           G  LMA+SN    ++L   NKSE++VGY TLYGD  G + P+KD+YK+ VF+LA WRN  
Sbjct: 415 GTTLMAISNQEGQIVLAPGNKSELAVGYSTLYGDAVGAYGPIKDVYKSSVFRLAKWRNRA 474

Query: 448 GITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN- 506
               G  P    IP + + K PSAELRP Q D +SLP Y +LD I++  V+ ++      
Sbjct: 475 AEERGQTP---PIPEASITKPPSAELRPGQVDTDSLPDYEVLDAILELYVDRDQGMDAIV 531

Query: 507 DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
              ++ E V     ++  +EYKRRQ P GTKI+ K FG+DR  PI+N++R+
Sbjct: 532 AAGFDAELVAKTLRMVDTAEYKRRQYPPGTKISPKGFGKDRRLPITNRWRE 582


>gi|117928126|ref|YP_872677.1| NH(3)-dependent NAD(+) synthetase [Acidothermus cellulolyticus 11B]
 gi|117648589|gb|ABK52691.1| NH(3)-dependent NAD(+) synthetase [Acidothermus cellulolyticus 11B]
          Length = 591

 Score =  481 bits (1239), Expect = e-133,   Method: Composition-based stats.
 Identities = 222/592 (37%), Positives = 317/592 (53%), Gaps = 45/592 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+AQ++PVVGDIAGN+       + A  +   L+ F E+ ++GYP EDL  + S
Sbjct: 1   MPQLRLALAQVDPVVGDIAGNLELVVAWTKHAASRSAHLVAFPEMMLTGYPVEDLALRPS 60

Query: 62  FIQACSSAIDTLKSDTHD---GGAGIVVGF--------PRQDQEGV-LNSVVILDAGNII 109
           F+ A   A+  L         G  G++VG+        PR    G+  +S   L  G ++
Sbjct: 61  FVAASRRAVVELAERLAREGLGNIGVIVGYLDAAPDDRPRPGGRGLPTDSAAFLIGGRVV 120

Query: 110 AVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAE 169
           A  DK +LPNY  F E R F  G     +    + + + ICED+W++          G  
Sbjct: 121 ARYDKHHLPNYGVFDEYRYFSRGERLVVVRHLGVDIAMTICEDLWQDGGPLTAAWAAGVG 180

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            + ++N SPY   K   R  +   + + V  PI YVN VGGQDEL+FDG SF  D     
Sbjct: 181 LVVTINGSPYERGKPDARLRLAQRRAAEVRAPIAYVNMVGGQDELVFDGDSFVVDADGTP 240

Query: 230 AFQMKHFSEQNFMTEWHYDQQLSQWNYMSD---------------DSASTMYIPLQ---- 270
             +   F E   + +       S+     D                 +   Y P      
Sbjct: 241 LVRAPQFDEGLAVIDLSLQPGTSRRRGSVDVRDGSRMTIERVDLKTPSLPDYPPAPTGLA 300

Query: 271 ----EEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIML 326
                E   Y A V   RDY++KN F  V++GLSGGIDSAL   IAVDA+G E V T+ +
Sbjct: 301 ARLAPEAEVYAALVTGTRDYIRKNRFRSVLVGLSGGIDSALVTTIAVDAIGAEAVHTVAM 360

Query: 327 PYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRI 386
           P +++S  SL DA   A+  G ++ V+PI D+V+ F   +      +  G+ AEN+Q+R+
Sbjct: 361 PSRWSSDHSLADAEELARRQGTRHTVIPITDMVDAFERHL------DLHGLAAENLQARV 414

Query: 387 RGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNS 446
           RG ILM+LSN    ++LTT NKSE++ GY TLYGD +GGF PLKD+ KT V++LA WRN+
Sbjct: 415 RGTILMSLSNEHGHLVLTTGNKSELATGYSTLYGDSAGGFAPLKDVPKTLVWELARWRNA 474

Query: 447 HGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN 506
               SG  P    IP   ++K PSAELRP Q D +SLPPYP LD +++  VE++ S  + 
Sbjct: 475 QAERSGAVP---PIPQRCIDKPPSAELRPGQLDTDSLPPYPELDAVLRLYVEHDASRDDI 531

Query: 507 -DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
               ++   V  V  L+  +EYKRRQ P G KIT ++FGRDR  PI+N++ +
Sbjct: 532 VAAGHDPFLVDRVIRLVDNAEYKRRQYPPGPKITTRNFGRDRRLPITNRWVE 583


>gi|134094248|ref|YP_001099323.1| NAD synthetase [Herminiimonas arsenicoxydans]
 gi|133738151|emb|CAL61196.1| glutamine-dependent NAD(+) synthetase (NAD(+) synthase
           [glutamine-hydrolyzing]) (NadE) [Herminiimonas
           arsenicoxydans]
          Length = 537

 Score =  481 bits (1238), Expect = e-133,   Method: Composition-based stats.
 Identities = 234/556 (42%), Positives = 324/556 (58%), Gaps = 22/556 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            +K+AIAQ+N  VGD+AGN AK       A  QG D++L  EL + GYPPEDL+ ++SF 
Sbjct: 2   TVKVAIAQINSTVGDLAGNRAKIAEFSRRAAEQGADIVLTPELSLVGYPPEDLLLRQSFY 61

Query: 64  QACSSAIDTLKSDTHD-GGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
              + A+D L +D  +     +VVG P +      N+  +L  G I A   K +LPN + 
Sbjct: 62  AKSAQALDALAADLAELKNLHVVVGHPFEKDGQRFNAASVLLNGKISATYCKHDLPNATV 121

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F S         + +R GI ICED W            GA+ L   N SPY+ N
Sbjct: 122 FDEKRYFSSCDQAVVFDVKGVRFGINICEDTWFPQAPA-RAAAAGAQVLLVPNGSPYHMN 180

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K   R +++   ++   + ++Y N VG QDELIFDG SF  D   +   Q++H  E   +
Sbjct: 181 KQHVRIDVMHANVTTHGMSLVYANLVGAQDELIFDGNSFVLDQAGETRAQLQHCVEDLQI 240

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
            E+   Q L            T+      E   Y A VL +RDY+ KN F   +IG+SGG
Sbjct: 241 VEFRGGQPLDG----------TIVEEPSVEAQVYKALVLGVRDYIGKNGFPGALIGMSGG 290

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           +DSAL  A+AVDALG + V+TIM+P  YT+  SL D+    + +G +YD + I+D    F
Sbjct: 291 VDSALTLAVAVDALGADKVRTIMMPSPYTAEISLLDSRDMVQRVGVRYDEIGINDCFEAF 350

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
              ++   +  P     ENIQ+RIRG ILMALSN   A++LTT NKSE++VGY TLYGDM
Sbjct: 351 NRTLANEFKGLPEDATEENIQARIRGTILMALSNKHGAIVLTTGNKSEMAVGYCTLYGDM 410

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF  LKD+ KT V++L ++RNS         +++VIP  IL ++PSAELRP QTDQ+S
Sbjct: 411 AGGFAVLKDIAKTLVYRLCAYRNS---------VSDVIPERILTRAPSAELRPGQTDQDS 461

Query: 483 LPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY ILD I++  +E  +S  +     Y  E V  + HL+  +EYKRRQ+PVG ++T +
Sbjct: 462 LPPYDILDAIMQMYMEENQSGADIIAAGYRAEDVARITHLIKINEYKRRQSPVGIRVTHR 521

Query: 542 SFGRDRLYPISNKFRD 557
           +FGRD  YPI++KFR+
Sbjct: 522 AFGRDWRYPITSKFRE 537


>gi|83749198|ref|ZP_00946200.1| Glutamine-dependent NAD(+) synthetase [Ralstonia solanacearum
           UW551]
 gi|207742674|ref|YP_002259066.1| nh3-dependent nad+ synthetase protein [Ralstonia solanacearum
           IPO1609]
 gi|83724139|gb|EAP71315.1| Glutamine-dependent NAD(+) synthetase [Ralstonia solanacearum
           UW551]
 gi|206594068|emb|CAQ60995.1| nh3-dependent nad+ synthetase protein [Ralstonia solanacearum
           IPO1609]
          Length = 546

 Score =  481 bits (1238), Expect = e-133,   Method: Composition-based stats.
 Identities = 221/562 (39%), Positives = 318/562 (56%), Gaps = 31/562 (5%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           +A+AQ+N  VGD+AGN A+   A  EA++ G  +++  EL ++GYPPEDL+ + +F+ A 
Sbjct: 5   VALAQINCTVGDLAGNAARILAAAREAHQAGARILVTPELSLTGYPPEDLLLRPAFLGAT 64

Query: 67  SSAIDTL-KSDTHDGGAGIVVGFPRQDQE---------GVLNSVVILDAGNIIAVRDKIN 116
           S A+D L        G  +++G P+   E            N+  +   G  +    K+ 
Sbjct: 65  SRALDALVAELAAFPGLHVLIGHPQLSFEAPAPGSALPKPTNTATVAVDGRTLGQYHKLE 124

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LPN   F EKR F +G           R G++ICED W            GAE +   NA
Sbjct: 125 LPNNEVFDEKRYFQAGCEPFVFEVEGTRFGVIICEDAWYPQATAWAKTA-GAEVVLIPNA 183

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY+ +K   R +I+  +     LP +YVN VGGQDEL+FDG SF  D   +   +M  F
Sbjct: 184 SPYHLDKEDLREQIIGARAKESGLPHVYVNLVGGQDELVFDGGSFALDAHGKPVARMAQF 243

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
           +E      +            +      +      E   Y A  L +RDY+ KN F   I
Sbjct: 244 AEGVGYVRFD----------GARPQPGEIAQEATLEAQVYEALKLGVRDYIGKNGFPGAI 293

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           IGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA   A  LG +YD +PI 
Sbjct: 294 IGLSGGVDSALVLAIAVDALGADRVRAVMMPSRYTADISWVDARDMAVRLGVRYDEIPIM 353

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            + + F   ++   +  P     ENIQ+RIRG +LMALSN S  ++LTT NKSE++VGY 
Sbjct: 354 PMFDAFRGALADEFRNLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSEMAVGYC 413

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGF  +KD++KT V++L  +RN+         L+EVIP  IL ++PSAELR +
Sbjct: 414 TLYGDMAGGFAVIKDIFKTLVYRLCRYRNA---------LSEVIPERILTRAPSAELREN 464

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           QTDQ+SLP Y  LD I++R +E  +  ++     + +  V+ +  LL  +EYKRRQAPVG
Sbjct: 465 QTDQDSLPEYAALDAIVQRYMEQNQPVVDIIAAGFAEADVQKIVRLLKINEYKRRQAPVG 524

Query: 536 TKITAKSFGRDRLYPISNKFRD 557
            ++T ++FGRD  YPI+++F++
Sbjct: 525 IRVTQRAFGRDWRYPITSRFKE 546


>gi|307151612|ref|YP_003886996.1| NAD+ synthetase [Cyanothece sp. PCC 7822]
 gi|306981840|gb|ADN13721.1| NAD+ synthetase [Cyanothece sp. PCC 7822]
          Length = 561

 Score =  481 bits (1238), Expect = e-133,   Method: Composition-based stats.
 Identities = 219/576 (38%), Positives = 322/576 (55%), Gaps = 42/576 (7%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQLNP VGD+  N      A  +A  QG+ L+L  EL + GYPP+DL+   SF+ 
Sbjct: 1   MKIAIAQLNPTVGDLWSNANNILEAAHQAASQGVRLLLTPELSLCGYPPKDLLLNPSFVH 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPR-------QDQEGVLNSVVILDAGNIIAVRDKINL 117
           + S  ++ L          ++VG          + ++ + NS+ +LD G +  +  K  L
Sbjct: 61  SLSVELENLAEKIP-PQLAVLVGTVEANTDADSRGEKPLYNSIALLDEGKVKQIFHKRLL 119

Query: 118 PNYSEFHEKRTFISGYS-------NDPIVFRDIRLGILICEDIWKNSNIC---------- 160
           P Y  F E R F  G           P     +++G+ ICED+W + +            
Sbjct: 120 PTYDVFDEDRYFEPGRQSNAFTIFPTPESENFVKVGVTICEDLWNDKDFWGKQTYEVNPI 179

Query: 161 KHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGAS 220
           + L +   +F+ +L+ASPY   K K R  ++T   +  H+PI+YVNQVGG D+LIFDG S
Sbjct: 180 EDLVQLEVDFVVNLSASPYSVKKQKLRESMLTYSAAKYHVPILYVNQVGGNDDLIFDGNS 239

Query: 221 FCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACV 280
           F  + Q ++  + K       + E+  ++Q     ++             EE   + A V
Sbjct: 240 FAVNRQGEVFCRAKALETDVKILEFCPEKQDLLAAFIQPFIEI-------EEAEIFAALV 292

Query: 281 LSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAA 340
           L L+DY +K  F KV++GLSGGIDS+L AAIA +A+GK+NV  +++P  Y+S  S+ DA 
Sbjct: 293 LGLKDYARKCGFTKVVLGLSGGIDSSLVAAIAAEAMGKDNVLGVLMPSPYSSDHSITDAE 352

Query: 341 ACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKA 400
           A AK LG K   LPI   +  +  ++       P GI  ENIQSRIRGN+LMA++N    
Sbjct: 353 ALAKNLGIKSYQLPIEPAMKVYDQMLEPLFTGTPFGIAEENIQSRIRGNLLMAIANKFGY 412

Query: 401 MLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVI 460
           +LL+T NKSE++VGY TLYGDM+GG   + D+ KT+V+ +  W N            E+I
Sbjct: 413 LLLSTGNKSEMAVGYCTLYGDMNGGLAVISDVPKTRVYDICQWLNREQ---------EII 463

Query: 461 PPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVE 519
           P ++L K PSAEL+P Q DQ+SLPPY ILDDI+ R++   +S     D  Y+ E V+ V 
Sbjct: 464 PHNVLIKPPSAELKPDQKDQDSLPPYEILDDILYRMINKHQSIPQIVDAGYDAEVVKKVM 523

Query: 520 HLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
            L+  +E+KR+QAP G KIT ++FG     PI++++
Sbjct: 524 KLVMRAEFKRKQAPPGLKITDRAFGTGWRMPIASRW 559


>gi|114770388|ref|ZP_01447926.1| NAD(+) synthase [alpha proteobacterium HTCC2255]
 gi|114549225|gb|EAU52108.1| NAD(+) synthase [alpha proteobacterium HTCC2255]
          Length = 552

 Score =  481 bits (1238), Expect = e-133,   Method: Composition-based stats.
 Identities = 250/559 (44%), Positives = 335/559 (59%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M K+ K+ +AQLN  VGD  GN+ KAR A   A ++G D++ F E+F++GY  +DLV K 
Sbjct: 1   MTKEFKLTMAQLNASVGDFDGNLNKARDAYSIACKEGADMLAFPEMFLTGYQTQDLVQKS 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++   S +     +  D G  I +G P QD + V N+  IL  G II    K +LPNY
Sbjct: 61  AFVEDAQSKLIEFAKECSD-GPTIGIGVPLQDGDKVYNAYAILQNGKIITQIRKHHLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F SG  + P V   +R+G  ICED W      + L++ GAE L S N SPYY
Sbjct: 120 KVFDEKRVFDSGEIHGPYVVNGVRIGSPICEDAWFPDVC-ETLEETGAEILISPNGSPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K  KR  ++  +    +LP+ Y+N VGGQD+ +FDG SF  +    LA QM  F E  
Sbjct: 179 RGKFDKRISLMVSRAVENNLPMAYLNLVGGQDDQVFDGGSFVINSDGALALQMPLFEENI 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                 + +   +W       AS         E DY+  VL+LRDY++K  F K ++G+S
Sbjct: 239 E--TITFKRTQDRWVAQEGKKASYP----DHWEQDYHVMVLALRDYMKKTGFKKALLGMS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL AAIA DALG ENV+ +MLP KYTS  SL+DAA CA  L  K   +PI D  N
Sbjct: 293 GGIDSALVAAIACDALGSENVRLVMLPSKYTSQNSLDDAANCANLLKAKIQTIPISDSFN 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                +    +        ENIQSR+RG +LM LSN    MLLTT NKSE+SVGY T+YG
Sbjct: 353 SVLKTLEPIFEGLDEDTTEENIQSRLRGLLLMGLSNKFNEMLLTTGNKSEVSVGYSTIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGFNP+KDLYK +VF+ + WRN++  +   G   EVIP  I++K P+AELR  Q D 
Sbjct: 413 DMAGGFNPIKDLYKVRVFETSRWRNNNYFSWMKGSRGEVIPNEIIQKPPTAELRNDQKDS 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y ILD I++ +++N+ S  +     Y    V++VE LLY SEYKR Q+  GT+++
Sbjct: 473 DSLPDYEILDGILEMLMDNDASVADCVVAGYELSDVKHVEKLLYLSEYKRFQSAPGTRLS 532

Query: 540 AKSFGRDRLYPISNKFRDH 558
            K+F  DR YPI+NK+RD+
Sbjct: 533 LKAFWLDRRYPIANKWRDN 551


>gi|166064263|gb|ABY79062.1| NAD(+) synthase [endosymbiont of Ridgeia piscesae]
          Length = 553

 Score =  481 bits (1238), Expect = e-133,   Method: Composition-based stats.
 Identities = 236/559 (42%), Positives = 334/559 (59%), Gaps = 8/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  K ++ +AQLNP VG +A N A A  A ++    G D++  TE+FI+GY  +DLV K 
Sbjct: 1   MSDKFRLTLAQLNPTVGALADNAALALDAWQQGRAAGADMVALTEMFITGYQVQDLVMKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F     + I+ L  D  D G  + +G P  D + + N+  IL+ G I A   K  LPN 
Sbjct: 61  AFTADAMAHIEQLAKDCAD-GPALGIGGPFADGDKLYNAYYILEGGKIAARVLKQKLPNE 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R +  G    P     +R+G  ICED W    +C+ L + GAE L   N SPYY
Sbjct: 120 TVFDEVRLYDVGPEQGPYQVGPLRIGSPICEDAWHAEEVCETLAETGAEILLVPNGSPYY 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            +KL  R   +  ++    LP++Y+N VGGQD+ +FDGASF  +    LA QM  F    
Sbjct: 180 RDKLAVRMNHMVARVVETDLPLVYLNMVGGQDDQVFDGASFVLNRGGALALQMPAF--DT 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +    + +  + W     D A    +     E DY   VL LRDY++K  F K+++G+S
Sbjct: 238 AIAHVDFTRTDAGWQAKVGDMAPQPDV----WEQDYRTMVLGLRDYMRKTGFRKILLGMS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A IA DALG +NV+ +MLP +YTS  SL DA   A+ LGC+YD +PI +   
Sbjct: 294 GGIDSAIVATIATDALGADNVRCVMLPSEYTSEDSLNDAKEIAQNLGCRYDFVPISEGRA 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
              + ++   +   + +  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 354 AITNTLAPLFEGTKADVTEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYATIYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KD+YKT+VF+   WRN++     +GP  E+IPP +++K P+AELR  Q D 
Sbjct: 414 DMAGGYNPIKDMYKTRVFETCRWRNANKRDWMMGPSGEIIPPRVIDKPPTAELREDQRDD 473

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I+  +V++E+S        +  + V+ VEHLLY SEYKR Q+  G ++T
Sbjct: 474 DSLPPYDVLDAILTGLVDDEKSVAELVADGFARDVVKKVEHLLYISEYKRFQSAPGPRLT 533

Query: 540 AKSFGRDRLYPISNKFRDH 558
            +SF  DR YPI N++RD 
Sbjct: 534 MRSFWLDRRYPIVNRWRDQ 552


>gi|21232521|ref|NP_638438.1| NAD synthetase [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66767395|ref|YP_242157.1| NAD synthetase [Xanthomonas campestris pv. campestris str. 8004]
 gi|21114312|gb|AAM42362.1| NH3-dependent NAD synthetase [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66572727|gb|AAY48137.1| NH3-dependent NAD synthetase [Xanthomonas campestris pv. campestris
           str. 8004]
          Length = 552

 Score =  481 bits (1238), Expect = e-133,   Method: Composition-based stats.
 Identities = 222/566 (39%), Positives = 316/566 (55%), Gaps = 26/566 (4%)

Query: 1   MLK------KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPP 53
           M++       L+IA+AQ +  VG +  N  +       A  +   D++LF EL ISGYPP
Sbjct: 1   MMESAVTAHTLRIAMAQFDFPVGAVTQNTDRIIEYIAAARDEFEADIVLFPELAISGYPP 60

Query: 54  EDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRD 113
           EDL+ +  F+  C  A+  + + T   G   VVG+P+     V N+  +L  G I A   
Sbjct: 61  EDLLLRPGFLAHCEQALARIAAATR--GIVAVVGWPQSAGSVVYNAASVLREGRIEATYR 118

Query: 114 KINLPNYSEFHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFL 171
           K  LPNY+ F E+R F       N  +  + +++G++ICED+W    + K ++  GAE +
Sbjct: 119 KRELPNYAVFDERRYFDVDPDGDNCVVTVKGVQVGVVICEDLWFAEPLAKTVQA-GAELV 177

Query: 172 FSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAF 231
              NASPY   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +  
Sbjct: 178 LVPNASPYERGKHAQRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHP 237

Query: 232 QMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNN 291
               F +Q  + ++   ++        DD   +M      +   + A V  L+DY  KN 
Sbjct: 238 AAAAFVDQWLVVDYAAGERSFTPVVWVDDGDESM------DALAWRAVVRGLKDYCGKNG 291

Query: 292 FHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYD 351
           F KV +GLSGGIDSAL  A+AVDALG ENV  + LP +YT+  S + A    +ALG K +
Sbjct: 292 FRKVWLGLSGGIDSALVLAMAVDALGGENVTAVRLPSRYTAGLSNDLADEQCRALGVKLE 351

Query: 352 VLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEI 411
            + I        + +     +    I  EN+QSR RG ILMALSN    ++LTT NKSE 
Sbjct: 352 TIAIEPAFEGLLAALGPLFADTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEY 411

Query: 412 SVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSA 471
           +VGY T+YGDM GG+ PLKDLYKT+VF LA WRN+ G          VIPP+++ + PSA
Sbjct: 412 AVGYATIYGDMCGGYAPLKDLYKTEVFGLAKWRNTVGG-------APVIPPAVISRPPSA 464

Query: 472 ELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRR 530
           ELR +QTDQ+SLPPY +LD I+ R V+ E+S  +     Y  +TV +V  L+  +E+KR 
Sbjct: 465 ELRDNQTDQDSLPPYDVLDGILYRYVDQEQSRDDIVAAGYAADTVEHVLRLVRLNEWKRH 524

Query: 531 QAPVGTKITAKSFGRDRLYPISNKFR 556
           QA  G K++ ++FGR+R YPI+N + 
Sbjct: 525 QAAPGPKVSRRAFGRERRYPITNGYS 550


>gi|302560983|ref|ZP_07313325.1| phenylalanyl-tRNA synthetase, beta subunit [Streptomyces
           griseoflavus Tu4000]
 gi|302478601|gb|EFL41694.1| phenylalanyl-tRNA synthetase, beta subunit [Streptomyces
           griseoflavus Tu4000]
          Length = 586

 Score =  481 bits (1237), Expect = e-133,   Method: Composition-based stats.
 Identities = 211/591 (35%), Positives = 310/591 (52%), Gaps = 44/591 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+ Q++  VGD+AGN     R    +  QG  L+ F E+ ++GYP EDL  + S
Sbjct: 1   MPQLRLALNQIDSSVGDLAGNAETIVRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAG---IVVGFPRQD----------QEGVLNSVVILDAGNI 108
           F++A  + + +L S   + G G   +VVG+  +                N+  +L  G +
Sbjct: 61  FVEASRAGLRSLASRLAEEGLGELPVVVGYLDRSAAAQPKYGQPAGAPQNAGAVLYGGEV 120

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA 168
           +    K +LPNY  F E R F+ G +   +  R I + + ICED+W++       +   A
Sbjct: 121 VLSFAKHHLPNYGVFDEFRYFVPGDTMPVVRVRGIDVALAICEDLWQDGGRVPAARSARA 180

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
             L S+NASPY  +K   R E+V  +         Y+  +GGQDEL+FDG S   D    
Sbjct: 181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMMGGQDELVFDGDSIVVDRDGG 240

Query: 229 LAFQMKHFSEQNFMTEWHY------------DQQLSQWNYMSDDSASTMYIP-------- 268
           +  +   FSE   + +               D  L     +  +     Y          
Sbjct: 241 VVARAPQFSEACVVVDLELPAAVADAPVGVVDDGLRIDRVVLSEEPVPAYEAGSGEAYAE 300

Query: 269 -LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLP 327
            L ++E  Y+A V+ LR YV KN F  V+IGLSGGIDSAL AA+A DA+G ENV  + +P
Sbjct: 301 RLDDDEEVYSALVVGLRAYVAKNGFRSVVIGLSGGIDSALVAALACDAVGAENVYGVSMP 360

Query: 328 YKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIR 387
            KY+S  S +DAA  A+  G  Y  + I  + + +   +        +G+  EN+QSR+R
Sbjct: 361 SKYSSEHSKDDAAELARRTGLNYRTVAIEPMFDAYMGALG------LTGLAEENLQSRLR 414

Query: 388 GNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSH 447
           G +LMA+SN    ++L   NKSE++VGY TLYGD  G + P+KD+YKT VF+LA WRN  
Sbjct: 415 GTLLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSVFRLAEWRNRA 474

Query: 448 GITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN- 506
            +  G  P    IP + + K PSAELRP Q D +SLP YP+LD I+   V+ +       
Sbjct: 475 AVERGETP---PIPENSISKPPSAELRPGQVDTDSLPDYPVLDAILALYVDRDRGADEIV 531

Query: 507 DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
              ++ E V     ++  +EYKRRQ P GTKI+ K FG+DR  PI+N +R+
Sbjct: 532 AAGFDAELVTRTLRMVDRAEYKRRQYPPGTKISPKGFGKDRRLPITNGWRE 582


>gi|303257762|ref|ZP_07343774.1| NAD+ synthetase [Burkholderiales bacterium 1_1_47]
 gi|331001199|ref|ZP_08324826.1| NAD+ synthase [Parasutterella excrementihominis YIT 11859]
 gi|302859732|gb|EFL82811.1| NAD+ synthetase [Burkholderiales bacterium 1_1_47]
 gi|329569131|gb|EGG50923.1| NAD+ synthase [Parasutterella excrementihominis YIT 11859]
          Length = 540

 Score =  481 bits (1237), Expect = e-133,   Method: Composition-based stats.
 Identities = 210/559 (37%), Positives = 314/559 (56%), Gaps = 23/559 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M++K+ +++AQLN   GD+ GN  +   A E+A     D+++  EL + GYPPEDL+F  
Sbjct: 1   MIEKVVVSMAQLNQTAGDLEGNFKRIAEAAEKAK--HSDILVTPELSLCGYPPEDLLFLD 58

Query: 61  SFIQACSSAIDTLKSDTHDG-GAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
           SF++ C+  ++ L   +       I+ G+P ++   + N V ++  G I+    K NLPN
Sbjct: 59  SFLEDCAKKLNELVEYSTRFPKLHILAGYPLKEAGRLYNVVSVILNGKILLTYRKKNLPN 118

Query: 120 YSEFHEKRTFISG-YSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           Y  F E+R F  G          D R G+ ICEDIW      +  K+QGA+ L   NASP
Sbjct: 119 YGVFDEERYFTPGGEDVCTFDVGDTRFGVNICEDIWFPEAPSQA-KEQGAQVLLIANASP 177

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           +   K ++R  +V   ++ + +   YVN  G QDE++FDG +F      ++  +  H  E
Sbjct: 178 FEEGKEEQRLNMVRRHVNAIGMDACYVNMCGAQDEIVFDGETFACSAD-EVLARAPHMKE 236

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
                E    +     +            PL +    Y A V+S+RDY+ KN F  V++G
Sbjct: 237 SLLSVEVRKGRICRGEDSQ----------PLSDWAVLYEALVVSMRDYINKNGFKGVVLG 286

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGG+DSAL   IAVDA+G + V  +M+P  YTS  S  DAA  A  LG + + + I D 
Sbjct: 287 LSGGVDSALVLKIAVDAVGNDKVLAVMMPSVYTSSLSRGDAAKLASRLGVRLETISIQDG 346

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
              F  ++++     P  +  EN+Q+RIRG ILMA+SN   +M+ TT NKSE++VGY TL
Sbjct: 347 YTAFEFMLAKQFNGMPHDVTEENLQARIRGVILMAISNKFGSMVATTGNKSEMAVGYSTL 406

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGD++GGF  +KD+YKTQV+ L  W N             V P +IL ++PSAELR +Q 
Sbjct: 407 YGDLAGGFAVIKDVYKTQVYALCRWINEC------SKENPVFPETILTRAPSAELRENQK 460

Query: 479 DQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLP Y +LD+I++R +E+ E         ++   V  V  ++  +EYKRRQ+P+G K
Sbjct: 461 DQDSLPDYSVLDEILRRFIEDREGPEEIVAAGFDRAVVDKVLRMVSRAEYKRRQSPIGPK 520

Query: 538 ITAKSFGRDRLYPISNKFR 556
           +T  +FGRD  +P++NK+R
Sbjct: 521 VTKVAFGRDWRFPVTNKYR 539


>gi|297537993|ref|YP_003673762.1| NAD+ synthetase [Methylotenera sp. 301]
 gi|297257340|gb|ADI29185.1| NAD+ synthetase [Methylotenera sp. 301]
          Length = 537

 Score =  481 bits (1237), Expect = e-133,   Method: Composition-based stats.
 Identities = 237/549 (43%), Positives = 326/549 (59%), Gaps = 23/549 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQ+N +VGDIAGN+AK       A + G  L++  EL + GYPPEDL+ ++ F+Q
Sbjct: 1   MKIAIAQMNCLVGDIAGNVAKIMANAALAKQHGATLMVTPELSLCGYPPEDLLLREDFLQ 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC +A++ L +   D    ++VG PRQ  +   N+  +L  G + A   K  LPNYS F 
Sbjct: 61  ACDAALEKLSTALTD--ITVIVGHPRQVGDECFNAASVLKDGEVFATYHKHALPNYSVFD 118

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           EKR F +G          +++G+LIC D+W   N     K  GAE L +LNASP++  K 
Sbjct: 119 EKRYFTAGGEPLVFEHCGVQIGVLICADVW-EPNPATLAKAAGAEVLIALNASPFHMEKQ 177

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
             R EI+  + S   L IIY N VGGQDEL+FDGASF  +    L  Q+  F     + E
Sbjct: 178 STRLEILRERASETDLAIIYTNMVGGQDELVFDGASFVLNSNGDLTQQLPAFDAALEIVE 237

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
           +                 + +   L  E + Y A  L L+DYV+KN F  V++GLSGG+D
Sbjct: 238 F----------MGLQPIPAAVTPQLSIEASVYTALKLGLQDYVRKNGFPGVVLGLSGGVD 287

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL  AIAVDALG E VQ +M+P ++T+  S+ DAA  AK LG KY  +PI +L   F  
Sbjct: 288 SALTMAIAVDALGAEKVQAVMMPSEFTADISVNDAAEMAKLLGVKYSQMPIANLYESFRV 347

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
            ++   +  P     EN+Q+RIRG +LMA+SN   ++++TT NKSE +VGY TLYGDM+G
Sbjct: 348 ALADEFKGLPFDTTEENLQARIRGMLLMAISNKFGSIVVTTGNKSETAVGYCTLYGDMAG 407

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF  LKD+ KT V++L  +RNS         L+  IP  I+ + PSAELR +Q DQ+SLP
Sbjct: 408 GFALLKDVPKTLVYRLCDYRNS---------LSRAIPQRIITRPPSAELRANQLDQDSLP 458

Query: 485 PYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
           PY +LD II+  VE+  S  +     Y+   V  V  L+  +EYKRRQ+PVG +IT + F
Sbjct: 459 PYDVLDVIIEAYVEDNLSARDIIAMGYSSTDVNRVITLIDRNEYKRRQSPVGVRITHRGF 518

Query: 544 GRDRLYPIS 552
           G+DR +PI+
Sbjct: 519 GKDRRHPIT 527


>gi|126730056|ref|ZP_01745868.1| NAD synthetase [Sagittula stellata E-37]
 gi|126709436|gb|EBA08490.1| NAD synthetase [Sagittula stellata E-37]
          Length = 562

 Score =  480 bits (1236), Expect = e-133,   Method: Composition-based stats.
 Identities = 242/559 (43%), Positives = 334/559 (59%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + ++ +AQLNP VGD+AGN AKAR A EE   QG DL+   E+FI+GY  +DL+ K 
Sbjct: 11  MTDRFRLTMAQLNPTVGDLAGNAAKARAAWEEGRAQGADLVALPEMFITGYQAQDLIVKP 70

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+ A    I+ L     D G  + +G P  +   + NS  +L  G + AV  K  LPN+
Sbjct: 71  AFVNAAVREIEALAKACAD-GPALAIGGPCPEGAKLHNSYYVLQGGKVAAVTHKYFLPNF 129

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E R F       P+    +R+G+ +CED W      + +++ GAE L   N SPY+
Sbjct: 130 NVFDEVRLFSRDQLQGPVSINGVRVGMPVCEDAWYPDV-VEAMEESGAEILVVPNGSPYF 188

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK + R   +  ++    LP+ Y+N VGGQD+ +FDG SF  + + +LA Q+  F E  
Sbjct: 189 RNKYETRLNKMIARVVESGLPLAYLNMVGGQDDQVFDGGSFVMNPRARLAVQLPVFEE-- 246

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
             T   + +    W        +         E DYN  VL+LRDY +K  F KV++G+S
Sbjct: 247 VTTTVDFVRGDEGWTAEEGTFVTHP----DAWEQDYNVMVLALRDYCRKTGFGKVLLGMS 302

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GG+DSAL A IAVDALG ENV+ +MLP +YTS  SLEDA ACA ALGC+YD +PI    +
Sbjct: 303 GGVDSALVATIAVDALGAENVRCVMLPSEYTSEHSLEDAKACANALGCRYDFVPIGKGRD 362

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +     +  ENIQSR+RG +LMALSN    MLLTT NKSE++VGY T+YG
Sbjct: 363 AITETLAPLFEGTQPDLAEENIQSRLRGLLLMALSNKFGEMLLTTGNKSEVAVGYATIYG 422

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF+   WRN++      GP  EVIP  I+ K PSAELR  Q D 
Sbjct: 423 DMAGGYNPIKDLYKTRVFETCRWRNANHRGWMKGPEGEVIPERIITKPPSAELRADQKDS 482

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP YP+LD I+  +V+ + +  +     Y+ E    V+HLLY SEYKR Q+  G ++T
Sbjct: 483 DSLPDYPVLDAILDILVDQDGAVSDCVAAGYSREDAMRVQHLLYISEYKRFQSAPGARLT 542

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++F  DR YPI N++RD 
Sbjct: 543 NRAFWLDRRYPIVNRWRDE 561


>gi|268593219|ref|ZP_06127440.1| NAD(+) synthase [Providencia rettgeri DSM 1131]
 gi|291311267|gb|EFE51720.1| NAD(+) synthase [Providencia rettgeri DSM 1131]
          Length = 540

 Score =  480 bits (1236), Expect = e-133,   Method: Composition-based stats.
 Identities = 225/556 (40%), Positives = 336/556 (60%), Gaps = 23/556 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M +KL I++AQLN +VGDI GN  +  +   E      D+++F+EL ++GYPPEDL+F+ 
Sbjct: 1   MSRKLNISLAQLNWLVGDIEGNCDRMLQVVSE-QAPNTDIVMFSELSLTGYPPEDLIFRA 59

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F   C   +D L+  + +    I+VG P  + + + N++     G + A   K  LPNY
Sbjct: 60  DFEDRCLVQLDRLQKASQE--TAIIVGHPWYEGDDIYNALSFFYQGKLHARYFKQELPNY 117

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F +      + F+  +LG+LICEDIW +      +K  GAE L ++NASPY 
Sbjct: 118 GVFDEPRYFTADEKTCVVEFKGYQLGLLICEDIWYDEP-VDAVKGAGAEILLTINASPYD 176

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
            NK   R +++       H+PI+Y+NQVGGQDEL+FDG S     + +  F+++ F EQ 
Sbjct: 177 INKEHIRTDLLVDHCKRTHMPIVYLNQVGGQDELVFDGGSKIIANKGKQTFKLEEFKEQV 236

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
              ++     +S+          +++I        Y A V+S RDY+ KN F+  I+GLS
Sbjct: 237 ITVQFDELALVSE---------GSVFIENDPVAQVYQALVMSTRDYINKNGFNGAILGLS 287

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDS L  AIAVDA+GKE+VQ +M+P++YTS  S+ DA   A  LG ++D++ I  + +
Sbjct: 288 GGIDSGLTVAIAVDAIGKEHVQAVMMPFRYTSEMSIHDAKEQADLLGVEFDIVSIEPMFD 347

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + ++   +        EN+Q+R R  ILMA+SN  + ++LTTSNKSE +VGY TLYG
Sbjct: 348 AFMAQLTPMFEGTAVDTTEENLQARCRAVILMAMSNKRRRLVLTTSNKSESAVGYSTLYG 407

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+         ++  IP  ++++ PSAEL P Q DQ
Sbjct: 408 DMAGGFDVLKDVPKTLVFELAKYRNT---------ISPAIPQRVIDRPPSAELAPGQLDQ 458

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD +++  VE + S  +     ++ + VR V  L+  +EYKRRQAPVG +IT
Sbjct: 459 DSLPPYDVLDALLEGYVEKDLSVNDLIKLGFDKDVVRKVVRLVDINEYKRRQAPVGPRIT 518

Query: 540 AKSFGRDRLYPISNKF 555
            ++FG+DR YPI++ F
Sbjct: 519 MRNFGKDRRYPITSGF 534


>gi|294676904|ref|YP_003577519.1| NAD(+) synthase (glutamine-hydrolyzing) [Rhodobacter capsulatus SB
           1003]
 gi|547988|sp|Q03638|NADE_RHOCA RecName: Full=Glutamine-dependent NAD(+) synthetase; AltName:
           Full=NAD(+) synthase [glutamine-hydrolyzing]
 gi|45986|emb|CAA42042.1| NAD synthetase [Rhodobacter capsulatus]
 gi|294475724|gb|ADE85112.1| NAD(+) synthase (glutamine-hydrolyzing) [Rhodobacter capsulatus SB
           1003]
          Length = 552

 Score =  480 bits (1236), Expect = e-133,   Method: Composition-based stats.
 Identities = 235/559 (42%), Positives = 335/559 (59%), Gaps = 9/559 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  + +I +AQLNP VG +A N  KA  A +     G DL+   E+F++GY  +DLV K 
Sbjct: 1   MTDRFRITLAQLNPTVGALAANAEKAMAAWQAGRAAGADLVALPEMFLTGYQTQDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F++   +A+  L +   D G  + +G P  D+ G  N+  +L  G +IA   K +LP+ 
Sbjct: 61  AFLRDAMAAMAALAAQVVD-GPALGIGGPYVDETGSYNAWWVLKDGRVIARALKHHLPHD 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F  G  +DP+    + LG+ +CED W        L   GAE L   N SPY 
Sbjct: 120 DVFDEMRLFDQGPVSDPLRLGPVALGVPVCEDAWHPDVAG-ALAAAGAEVLMVPNGSPYR 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             KL  R ++   +++   LP++Y+N VGGQD+ +FDGASF  +    +A Q+  F E  
Sbjct: 179 RGKLDLRRQVTGARVAETGLPLLYLNMVGGQDDQLFDGASFVLNPDGSVAVQLPAFEEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +     ++  + W  +  D    +  P  + E DY A VL L+DY++K+ F +V++GLS
Sbjct: 238 -VVHVDLERGAADWRAVPAD----IVAPPGDIEQDYRAMVLGLQDYLRKSGFSRVVLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL A IA DALG  NV  +MLP +YTS  SL+DAA  A+ LG + D + I     
Sbjct: 293 GGIDSALVAVIAADALGAGNVHCVMLPSRYTSQGSLDDAADLARRLGARLDTVEIEGPRA 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++  L      +  ENIQSR+RG ILMA+SN   AMLLTT NKSE++VGY T+YG
Sbjct: 353 AVEGALAHVLAGTAPDVTEENIQSRLRGVILMAISNKFGAMLLTTGNKSEVAVGYCTIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NPLKDLYKT+VF+   WRN+        P  E+IP +I++K PSAELR +QTDQ
Sbjct: 413 DMAGGYNPLKDLYKTRVFETCRWRNATHRPWMQAPAGEIIPVAIIDKPPSAELRENQTDQ 472

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I++R+VE ++S        ++  TV+ +EHLLY SE+KR Q+  G ++T
Sbjct: 473 DSLPPYEVLDAILERLVEGDQSVDQIVAAGFDRATVKRIEHLLYISEWKRFQSAPGPRLT 532

Query: 540 AKSFGRDRLYPISNKFRDH 558
            ++F  DR YP+ N++RD 
Sbjct: 533 TRAFWLDRRYPMVNRWRDQ 551


>gi|291440029|ref|ZP_06579419.1| NAD(+) synthase [Streptomyces ghanaensis ATCC 14672]
 gi|291342924|gb|EFE69880.1| NAD(+) synthase [Streptomyces ghanaensis ATCC 14672]
          Length = 615

 Score =  480 bits (1236), Expect = e-133,   Method: Composition-based stats.
 Identities = 210/591 (35%), Positives = 309/591 (52%), Gaps = 44/591 (7%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
            +L++A+ Q++  VGD+ GN     R    +  +G  L+ F E+ ++GYP EDL  + SF
Sbjct: 29  PQLRLALNQIDSRVGDLDGNTETILRWTRHSAERGAHLVAFPEMVLTGYPVEDLALRSSF 88

Query: 63  IQACSSAIDTLKSDTHDGG---AGIVVGFPRQD----------QEGVLNSVVILDAGNII 109
           ++A  +A+ +L +   + G     +VVG+  +                N+  +L  G ++
Sbjct: 89  VEASRAALRSLAARLAEEGFGELPVVVGYLDRSAAAQPKYGQPAGAPQNAGAVLYGGEVV 148

Query: 110 AVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAE 169
               K +LPNY  F E R F+ G +   +    + + + ICED+W++       +  GA 
Sbjct: 149 LAFAKHHLPNYGVFDEFRYFVPGDTMPVVRVHGVDVALAICEDLWQDGGRVPAARSAGAG 208

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            L S+NASPY   K   R E+V  +         Y+   GGQDEL+FDG S   D    +
Sbjct: 209 LLLSINASPYEREKDDTRLELVRKRAQEAGCTTAYLAMTGGQDELVFDGDSIVVDRDGAV 268

Query: 230 AFQMKHFSEQNFMT------------EWHYDQQLSQWNYMSDDSASTMYIP--------- 268
             +   F+E  F+                 D  L     +  ++    Y P         
Sbjct: 269 VTRAPQFTEGCFVVDLDLPAAAADAPTGTVDDGLRIDRVVLSEAPLPAYEPEQAGGCAER 328

Query: 269 LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPY 328
           L ++E  Y+A V+ LR YV+KN F  V+IGLSGGIDSAL AAIA DA+G ENV  + +P 
Sbjct: 329 LDDDEEVYSALVVGLRAYVEKNGFESVLIGLSGGIDSALVAAIACDAVGAENVYGVSMPS 388

Query: 329 KYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRG 388
           KY+S  S +DAA  A+  G  Y  + I  + + +   +        +G+  EN+QSR+RG
Sbjct: 389 KYSSGHSRDDAAELARRTGLNYRTVAIEPMFDAYMGALG------LTGLAEENLQSRLRG 442

Query: 389 NILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG 448
            +LMALSN    ++L   NKSE++VGY TLYGD  G + P+KD+YKT VF+LA WRN   
Sbjct: 443 TLLMALSNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSVFRLARWRNRAA 502

Query: 449 ITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-D 507
              G  P    IP + + K PSAELRP Q D +SLP YP+LD I++  V+ +        
Sbjct: 503 QERGETP---PIPENSISKPPSAELRPGQVDTDSLPDYPVLDAILELYVDRDRGADEIVA 559

Query: 508 QEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
             ++ E V     ++  +EYKRRQ P GTKI+ K FG+DR  PI+N +R+ 
Sbjct: 560 AGFDRELVAKTLRMVDRAEYKRRQYPPGTKISPKGFGKDRRLPITNGWREQ 610


>gi|254415451|ref|ZP_05029211.1| NAD synthase family [Microcoleus chthonoplastes PCC 7420]
 gi|196177632|gb|EDX72636.1| NAD synthase family [Microcoleus chthonoplastes PCC 7420]
          Length = 586

 Score =  480 bits (1236), Expect = e-133,   Method: Composition-based stats.
 Identities = 210/587 (35%), Positives = 315/587 (53%), Gaps = 44/587 (7%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +K+AIAQLNP +GD+  N  K   A  +A RQG+ L+L  EL + GYPP DL+   SF++
Sbjct: 1   MKLAIAQLNPTIGDLTSNAQKILDAANQAARQGVRLLLTPELSLCGYPPRDLLLNPSFME 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFP------RQDQEG-VLNSVVILDAGNIIAVRDKINL 117
           + +  +D L          ++VG               + NS+ +L+ G I  V  K  L
Sbjct: 61  SMADCLDNLAEQLPST-LAVLVGTVTANPKAESSGGKPLFNSIALLEGGKIQQVFHKRLL 119

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRD-----IRLGILICEDIW----------KNSNICKH 162
           P Y  F E R F +G  ++           I++G+ ICED+W             N    
Sbjct: 120 PTYDVFDENRYFEAGVQSNSFTLEAESATPIKIGVTICEDLWNDEEFWGKRTYQFNPITD 179

Query: 163 LKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFC 222
           L +Q  + + +L+ASPY   K + R  ++         PI+Y NQVGG D+LIFDG+S  
Sbjct: 180 LNQQNVDLIVNLSASPYSVGKQQLREAMLQHSAKRYQQPILYANQVGGNDDLIFDGSSVG 239

Query: 223 FDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLS 282
           F+   ++  +   F     + ++   Q            ++    P       ++A VL 
Sbjct: 240 FNRAGEMVCRAPAFETDVLLVDFDPVQGDL-------LKSAIAPAPESTNAQIWSALVLG 292

Query: 283 LRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAAC 342
           ++DY +K  F +V+IGLSGGIDS+L AA+A +ALG+ENV  +++P  ++S  S+ DA A 
Sbjct: 293 IQDYARKCGFKRVVIGLSGGIDSSLVAALATEALGRENVLGVLMPSPHSSEHSINDALAL 352

Query: 343 AKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAML 402
           AK LG K   LPI +L+  +   +         G   ENIQ+RIRGN+LMA++N    +L
Sbjct: 353 AKNLGIKTHTLPIGELMQGYDQTLDPLFAGTEFGTAEENIQARIRGNLLMAIANKFDYLL 412

Query: 403 LTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG-------------I 449
           ++T NKSE++VGY TLYGDM+GG   + D+ KT+V+ L  W NS                
Sbjct: 413 ISTGNKSEMAVGYCTLYGDMNGGLAAIADVPKTRVYSLCQWLNSTKVKRQESQATPEQLP 472

Query: 450 TSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEES-FINNDQ 508
                   E+IP ++L K PSAEL+P QTDQ+SLP Y ILDDI++R++ + +S     D 
Sbjct: 473 AQLSDTQPEIIPANVLAKPPSAELKPDQTDQDSLPSYDILDDILQRLIHDHQSAPQIIDA 532

Query: 509 EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
            ++ E V  V  ++  +E+KRRQAP G KIT ++FG     PI++++
Sbjct: 533 GHDPEIVHKVMRMVARAEFKRRQAPPGLKITDRAFGTGWRMPIASRW 579


>gi|319786171|ref|YP_004145646.1| NAD+ synthetase [Pseudoxanthomonas suwonensis 11-1]
 gi|317464683|gb|ADV26415.1| NAD+ synthetase [Pseudoxanthomonas suwonensis 11-1]
          Length = 545

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 219/559 (39%), Positives = 305/559 (54%), Gaps = 20/559 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFK 59
           M   L+IA+AQ +  VG +  N  +      EA  + G D++LF EL ISGYPPEDL+ +
Sbjct: 1   MKDSLRIALAQFDFPVGAVEANAGRIAEMIAEARDEYGADIVLFPELAISGYPPEDLLMR 60

Query: 60  KSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPN 119
            SF+  C  A++ +       G   VVG+P      + N+  +L  G I A   K  LPN
Sbjct: 61  PSFLARCQQALEQVA--AGVHGITAVVGWPESAGSVLYNAASVLRDGRIEATYRKRELPN 118

Query: 120 YSEFHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNAS 177
           Y+ F E+R F               + +G+++CED+W    +     K GA+ +   NAS
Sbjct: 119 YAVFDERRYFEADPDGEPCVFEVGGVPVGVVVCEDLWFPEPMADT-VKAGAQLVLVPNAS 177

Query: 178 PYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFS 237
           P+   K  +R  ++  +       + Y+N VGGQD L+FDGAS   DG   +      F+
Sbjct: 178 PFERGKHAQRDALLAERTRETGAAVAYLNVVGGQDSLVFDGASVVADGNGTVHPAAAAFT 237

Query: 238 EQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVII 297
           +Q  + ++    +        DD   +M      +   + A V  +RDY  KN F +  +
Sbjct: 238 DQWLVVDYDTAGRSFTPVQWMDDGDESM------DALAWRAVVRGIRDYCGKNGFRRAWL 291

Query: 298 GLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHD 357
           GLSGGIDSAL  A+A +ALG ENV  + LP +YT+  S + AA    ALG + + +PI  
Sbjct: 292 GLSGGIDSALVLALAAEALGPENVVAVRLPSRYTAGLSNDLAAEQCAALGVRLETIPIEP 351

Query: 358 LVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGT 417
               F   + Q    + +    EN+QSR RG ILMALSN    +LLTT NKSE +VGY T
Sbjct: 352 AFTGFLQSLEQVFAGQEADTTEENLQSRSRGAILMALSNKFGGLLLTTGNKSEYAVGYAT 411

Query: 418 LYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQ 477
           +YGDM GG+ PLKDLYKT+VF LA WRN+ G          VIPP+++ + PSAELR  Q
Sbjct: 412 IYGDMCGGYAPLKDLYKTEVFGLAKWRNTVGGA-------PVIPPAVISRPPSAELRADQ 464

Query: 478 TDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGT 536
            DQ+SLPPY +LD I+ R V+ E+S        Y  E V  V  L+  SE+KR+QA  G 
Sbjct: 465 LDQDSLPPYDVLDGILYRFVDQEQSRGEIVAAGYAAEVVDRVLRLVRTSEWKRQQAAPGP 524

Query: 537 KITAKSFGRDRLYPISNKF 555
           K++ ++FGR+R YPISN F
Sbjct: 525 KVSRRAFGRERRYPISNGF 543


>gi|33593664|ref|NP_881308.1| NAD synthetase [Bordetella pertussis Tohama I]
 gi|33563737|emb|CAE42977.1| putative NAD synthetase [Bordetella pertussis Tohama I]
 gi|332383068|gb|AEE67915.1| NAD synthetase [Bordetella pertussis CS]
          Length = 544

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 228/558 (40%), Positives = 327/558 (58%), Gaps = 18/558 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +   ++ IAQ+N  VGD+AGN A+  +A  +A  QG D+++  EL ++GYPPEDL+ +  
Sbjct: 1   MSLARVGIAQINACVGDLAGNAARVLQAARQAAGQGADVLVTPELVLTGYPPEDLLLRPR 60

Query: 62  FIQACSSAIDTLKSDTHDG-GAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           FIQ   +  + L  D     G  +V+G     Q+ + N+  ++  G ++    K  LPNY
Sbjct: 61  FIQEQQAVFERLCQDLAGLAGLHVVIGHVLARQDRLYNAATVVCEGRVLGSYCKRELPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F E+R F +         + +R G+ ICEDIW            GA+ L   NASPY 
Sbjct: 121 SVFDEQRYFSAHGEAFGFTVKGVRFGLNICEDIWFERAPR-AAAADGAQVLLVPNASPYN 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K ++R  +    +      +IY N VGGQDEL+FDGASF  D Q +++ ++  F+E  
Sbjct: 180 TGKQEERLSVARRSVQDTGCALIYANLVGGQDELVFDGASFALDAQGRMSARLPDFTEGV 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + E          + +   +      P   EE  +NA VL +RDY+ KN F   IIGLS
Sbjct: 240 NVLEVD------ARSTVRPVTEQAAVQPYGLEEQVWNALVLGVRDYLGKNGFPGAIIGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+  A+AVDA+G +NV+ +M+P +YT+  SL DAA  A+ LG +YDV+ I ++V+
Sbjct: 294 GGIDSAVVLAVAVDAVGADNVRAVMMPSRYTADISLTDAADMARRLGVQYDVIAIGEVVD 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + ++      P     ENIQ+R RG +LMALSN +  ++LTT NKSE++ GY TLYG
Sbjct: 354 RFEAALAPQFAGLPVDATEENIQARARGTLLMALSNKTGRLVLTTGNKSEMTTGYCTLYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  +KD+ KT V++LA+WRN             +IP  I+ + PSAELRP QTDQ
Sbjct: 414 DMAGGFAVIKDVPKTLVYRLANWRNQRQP---------IIPERIITRPPSAELRPDQTDQ 464

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD II+R +E+  S  +     +  E V  V  L+  +EYKRRQAP G +IT
Sbjct: 465 DSLPPYDILDGIIERYMEHNASAADIVAAGFPREAVGQVVRLIRINEYKRRQAPPGPRIT 524

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++FGRD  YP++N FR+
Sbjct: 525 PRAFGRDWRYPVTNGFRE 542


>gi|160903300|ref|YP_001568881.1| NAD+ synthetase [Petrotoga mobilis SJ95]
 gi|160360944|gb|ABX32558.1| NAD+ synthetase [Petrotoga mobilis SJ95]
          Length = 575

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 210/579 (36%), Positives = 325/579 (56%), Gaps = 35/579 (6%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           K++I++AQ+N  VGD  GN+ K +    +A+ +G D+ILF EL ++GYPPEDL+ K  F+
Sbjct: 2   KIRISLAQMNSTVGDYPGNVEKIKDFISKADEKGADIILFPELSLNGYPPEDLILKTQFL 61

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +    +I+ ++  +      IV+G    D E   NS  ++  G I     K+ LPNYS F
Sbjct: 62  KDSLKSIEEIQDFSKSKDVVIVLGAVDWDVES-YNSAFVIYKGEIYGSYKKMFLPNYSVF 120

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            EKR F +G +   +    I++GI ICED+W  +     L + GA  + +L++SP+Y  +
Sbjct: 121 DEKRYFTAGRAPFLMEMERIKIGITICEDLWVPNGPAVSLAQNGANLILNLSSSPFYKGR 180

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
            K R E++  + S +   I Y N +GGQDEL+FDG S   +   ++      F E  +  
Sbjct: 181 NKVRFEMLKTRASELSSWIAYCNIIGGQDELVFDGGSVVINPYGEIELSAPSFEEGLYFI 240

Query: 244 EWH--------------------------YDQQLSQWNYMSDDSASTMYIPLQEEEADYN 277
           +                               ++ +         +         E  Y 
Sbjct: 241 DIDPLEPTRANLREGKRKHYNQSAYYESVNTIKIEKKIREKTPIKAVKVDSFDIYEQLYL 300

Query: 278 ACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLE 337
           A    ++DYV KN F KV++GLSGGIDS+L AAIA DA+G ENV  +++P +Y+S  S++
Sbjct: 301 AVKTGIKDYVLKNGFQKVVLGLSGGIDSSLTAAIAADAIGPENVVGLLMPSQYSSKGSID 360

Query: 338 DAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNH 397
           D+   +K LG  Y ++PI+D+   +   + +  +        ENIQ+RIRGN++MA SN 
Sbjct: 361 DSIELSKNLGINYKIIPINDIYEKYIENLKESFKNTDEDKTEENIQARIRGNLVMAFSNK 420

Query: 398 SKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLT 457
              + L   NKSE + GY TLYGDM+GGF+P+KDLYKT ++++A   N            
Sbjct: 421 FGYLALACGNKSEAATGYATLYGDMAGGFSPIKDLYKTDLYKVARKYNELHG-------K 473

Query: 458 EVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVR 516
           E+I  SILEK+PSAELRP+Q D++ LPPY +LD+I+ + ++ E S+    Q  Y++  ++
Sbjct: 474 EIIIKSILEKAPSAELRPNQKDEDILPPYALLDEILFKYIDREMSYDELLQEGYDEGLLK 533

Query: 517 YVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
            V +++  +EYKRRQ+  G K+T +SFG+DR  PI+NK+
Sbjct: 534 NVINMVNKNEYKRRQSAPGIKLTERSFGKDRRMPITNKY 572


>gi|312195611|ref|YP_004015672.1| NAD+ synthetase [Frankia sp. EuI1c]
 gi|311226947|gb|ADP79802.1| NAD+ synthetase [Frankia sp. EuI1c]
          Length = 597

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 209/599 (34%), Positives = 307/599 (51%), Gaps = 47/599 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L+IA+AQ++  VGD+ GN        + A  +G  L+ F EL ++GYPPEDLV ++S
Sbjct: 1   MPQLRIALAQVDTTVGDLDGNADLVSAWTKRALAEGAHLVAFGELTLTGYPPEDLVLRRS 60

Query: 62  FIQACSSAIDTLKSDTHDGG---AGIVVGF----------PRQDQEGVLNSVVILDAGNI 108
           ++ A  +A+  L     D G     +VVG+            +      N+  +L  G +
Sbjct: 61  YVAASRAALHRLARRLEDEGAGEIAVVVGYLDASPTPAPAVGRPAGEPQNTAAVLWRGEV 120

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA 168
           +A   K +LPNY  F E R F+ G     +    + + + ICED+W+        +  G 
Sbjct: 121 VARYAKHHLPNYGVFDEFRYFVPGNDFPVLRLHGVDVALTICEDLWQAGGPVAVARAAGV 180

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
             L  +N SPY   K   R E+   +      PI YVN VGGQDELIFDG S   D   Q
Sbjct: 181 GLLLCINGSPYEQGKSHHRDELCARRAVEAGAPIAYVNLVGGQDELIFDGDSLVADAAGQ 240

Query: 229 LAFQMKHFSEQNFMTEWHY----------------------DQQLSQWNYMSDDSASTMY 266
           +  + + F+E   + +                            +++    ++   +   
Sbjct: 241 VIARAEVFTETLMVVDLDLPSGAEAGPDGLVTGPVDALDGTSMTVTRRELTTEPLPAFPA 300

Query: 267 IP------LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKEN 320
            P             Y A V   RDYV+KN F  V++GLSGGIDSAL A IAVDALG E 
Sbjct: 301 RPPALAARPDPAAELYEALVTGTRDYVRKNGFRSVVLGLSGGIDSALVATIAVDALGAEA 360

Query: 321 VQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAE 380
           V T+ +P  ++S  S++DAA  A   G +++V+ I   V+ F   +         G+ AE
Sbjct: 361 VHTVAMPSVHSSAGSVQDAADLAHRQGTRHEVIAIQPTVDAFHGALE--GTGGLHGLAAE 418

Query: 381 NIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQL 440
           N+Q+R+RG +LMALSN    ++LTT NKSE++ G+ TLYGD +GG+ P+KD+ KT V+ L
Sbjct: 419 NLQARVRGTLLMALSNEHGHLVLTTGNKSELATGFSTLYGDSAGGYAPIKDVSKTNVWAL 478

Query: 441 ASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENE 500
           + WRN+     G  P    IP  I+ K PSAEL P Q D + LP Y ILD ++   V  +
Sbjct: 479 SRWRNAEAERRGATP---PIPEIIITKPPSAELAPGQLDSDRLPDYGILDPVLDDYVSQD 535

Query: 501 ESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
                     ++   V  V  L+  +EYKRRQ P G K+T+K+FGRDR  PI++++R+ 
Sbjct: 536 MGRAELVAAGHDPAVVDRVIRLVDLAEYKRRQNPPGPKVTSKAFGRDRRLPITSRWREK 594


>gi|254251714|ref|ZP_04945032.1| NAD+ synthase [Burkholderia dolosa AUO158]
 gi|124894323|gb|EAY68203.1| NAD+ synthase [Burkholderia dolosa AUO158]
          Length = 607

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 225/580 (38%), Positives = 323/580 (55%), Gaps = 38/580 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  ++A+AQ+N  VGD AGN+ +   A   A+  G  L++  EL +SGYPPEDL+ + +
Sbjct: 43  MKT-RLALAQINVTVGDFAGNVERIVAAARAAHDDGAQLMVTPELALSGYPPEDLLLRPA 101

Query: 62  FIQACSSAIDTLKSDTHDG-GAGIVVGFPRQDQEG--------------------VLNSV 100
           F  A ++++  L        G  ++VG P +                          N+V
Sbjct: 102 FYAAAAASLHALADALKAFDGLAVLVGHPLRGDARAPAVDSNANGPIERGVPPVDTYNAV 161

Query: 101 VILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNIC 160
            ++  G I+    K +LPN   F EKR F +           ++ G++ICED W  S   
Sbjct: 162 SLIVGGEIVGTYRKQDLPNAEVFDEKRYFATDAEPLVFELNGVKFGVIICEDAWHASAAQ 221

Query: 161 KHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGAS 220
              K  GA+ L   N SPY+ NK   R +I+  +I    LP++YVN VGGQDEL+FDG S
Sbjct: 222 -IAKAAGAQVLLIPNGSPYHMNKEAVRIDILRARIRETGLPMVYVNLVGGQDELVFDGGS 280

Query: 221 FCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACV 280
           F  DGQ  L  Q+  F E + + E+   Q L             +   L  E   Y A V
Sbjct: 281 FVLDGQGALVAQLPQFDEAHAIVEFDGAQPLRG----------AIAPALSLEAQVYRALV 330

Query: 281 LSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAA 340
           L +RDY+ KN F   IIGLSGG+DSAL  A+A DALG E V+ +M+P ++T+  S  DAA
Sbjct: 331 LGVRDYIGKNGFPGAIIGLSGGVDSALVLALACDALGPERVRAVMMPSRFTADISTADAA 390

Query: 341 ACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKA 400
             A+ +G +YD + I  + + F + ++            ENIQ+RIRG +LMALSN   +
Sbjct: 391 EMARRVGVRYDEIAIAPMFDAFRAALADEFAGLAEDATEENIQARIRGTLLMALSNKFGS 450

Query: 401 MLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVI 460
           ++LTT NKSE++VGY TLYGDM+GGF  LKD+ KT V++L  +RN+         + +VI
Sbjct: 451 IVLTTGNKSEMAVGYCTLYGDMAGGFAVLKDIAKTLVYRLCRYRNATTDY----AVRDVI 506

Query: 461 PPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVE 519
           P  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E +          Y    V  V 
Sbjct: 507 PERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRPLAEIVAAGYAQADVERVT 566

Query: 520 HLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
            L+  +EYKRRQAPVG ++T ++FGRD  YPI+++F + +
Sbjct: 567 RLIKINEYKRRQAPVGIRVTHRAFGRDWRYPITSRFTERL 606


>gi|121604614|ref|YP_981943.1| NAD+ synthetase [Polaromonas naphthalenivorans CJ2]
 gi|120593583|gb|ABM37022.1| NAD+ synthetase [Polaromonas naphthalenivorans CJ2]
          Length = 565

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 228/577 (39%), Positives = 313/577 (54%), Gaps = 36/577 (6%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   LKI +AQLN  VGD+ GN  K   A   A ++G  L+L  E+ I GY  EDL  + 
Sbjct: 1   MS--LKICVAQLNYCVGDMPGNAQKIIAAARTAYQEGARLVLTPEMAICGYAAEDLFLRP 58

Query: 61  SFIQACSSAIDTLKSDTHDG-GAGIVVGFPRQDQEG------------VLNSVVILDAGN 107
           SFIQAC  A++ +  +     G  +VVG P     G              N+  +L  G 
Sbjct: 59  SFIQACDDAVNQVARELAGLKGLTVVVGTPVHGDSGKGLRTKSVAVQQRQNAARVLREGR 118

Query: 108 IIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRD-------IRLGILICEDIWKNSNIC 160
           +I    K  LPNY  F E+R F  G                 + +G+LICED W      
Sbjct: 119 VIETYAKRELPNYQVFDERRYFAPGQGTCVFQATGDEEGDEAVSIGLLICEDAWFEEP-A 177

Query: 161 KHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGAS 220
           +  ++ GAE L  +NASP++  K  +R  ++  +     LP++Y + VGGQDE++F+G S
Sbjct: 178 RLAQQAGAELLVVINASPFHVGKGSEREVMMRERCLATGLPLVYAHLVGGQDEIVFEGHS 237

Query: 221 FCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPL-QEEEADYNAC 279
           F       LA + + F E  F  +    Q   +             +PL   E   ++A 
Sbjct: 238 FALQADGALAGRAESFKENLFFAQAGRAQAAIELVAD--------AVPLRSAEADLWDAL 289

Query: 280 VLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDA 339
           VL +RDY+ KN F   IIGLSGGIDSAL  AIAVDALG + V+T+M+P  YT+  S  DA
Sbjct: 290 VLGVRDYLGKNGFPGAIIGLSGGIDSALVLAIAVDALGADKVRTVMMPSPYTADISWIDA 349

Query: 340 AACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSK 399
              A+ +  +YD + I      F + ++   +        ENIQ+RIRG  LMALSN   
Sbjct: 350 REMAERMKVRYDEISIVPEFEAFKASLAGEFKGRAEDTTEENIQARIRGVFLMALSNKFG 409

Query: 400 AMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEV 459
           +++LTT NKSE++ GY TLYGDM+GGF  +KDL KT VF+LA WRN +      G     
Sbjct: 410 SIVLTTGNKSEMATGYCTLYGDMAGGFAVIKDLLKTTVFRLARWRNENDPY---GTGGSP 466

Query: 460 IPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYV 518
           IP  I+ + PSAELR  QTDQ+SLPPY +LD I+KR +EN++S        +    V  V
Sbjct: 467 IPERIITRPPSAELRADQTDQDSLPPYEVLDAILKRYMENDQSVEAVVAAGFERAVVERV 526

Query: 519 EHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
             L+  +EYKRRQAPVG +++ +SFG+D  YPI++KF
Sbjct: 527 ARLIRINEYKRRQAPVGIRVSHRSFGKDWRYPITSKF 563


>gi|33601488|ref|NP_889048.1| NAD synthetase [Bordetella bronchiseptica RB50]
 gi|33575924|emb|CAE33003.1| putative NAD synthetase [Bordetella bronchiseptica RB50]
          Length = 544

 Score =  479 bits (1234), Expect = e-133,   Method: Composition-based stats.
 Identities = 228/558 (40%), Positives = 326/558 (58%), Gaps = 18/558 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +   ++ IAQ+N  VGD+AGN A+  +A  +A  QG D+++  EL ++GYPPEDL+ +  
Sbjct: 1   MSLARVGIAQINACVGDLAGNAARVLQAARQAAGQGADVLVTPELVLTGYPPEDLLLRPR 60

Query: 62  FIQACSSAIDTLKSDTHDG-GAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           FIQ   +  + L  D     G  +V+G     Q+ + N+  ++  G ++    K  LPNY
Sbjct: 61  FIQEQQAVFERLCQDLAGLAGLHVVIGHVLARQDRLYNAATVVCEGRVLGSYCKRELPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F E+R F +         + +R G+ ICEDIW            GA+ L   NASPY 
Sbjct: 121 SVFDEQRYFSAHGEAFGFTVKGVRFGLNICEDIWFERAPR-AAAADGAQVLLVPNASPYN 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K ++R  +    +      +IY N VGGQDEL+FDGASF  D Q +++ ++  F+E  
Sbjct: 180 TGKQEERLSVARRSVQDTGCALIYANLVGGQDELVFDGASFALDAQGRMSARLPDFTEGV 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + E            +   +      P   EE  +NA VL +RDY+ KN F   IIGLS
Sbjct: 240 NVLEVD------ARGTVRPVTEQAAVQPYGLEEQVWNALVLGVRDYLGKNGFPGAIIGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+  A+AVDA+G +NV+ +M+P +YT+  SL DAA  A+ LG +YDV+ I ++V+
Sbjct: 294 GGIDSAVVLAVAVDAVGADNVRAVMMPSRYTADISLTDAADMARRLGVQYDVIAIGEVVD 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + ++      P     ENIQ+R RG +LMALSN +  ++LTT NKSE++ GY TLYG
Sbjct: 354 RFEAALAPQFAGLPVDATEENIQARARGTLLMALSNKTGRLVLTTGNKSEMTTGYCTLYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  +KD+ KT V++LA+WRN             +IP  I+ + PSAELRP QTDQ
Sbjct: 414 DMAGGFAVIKDVPKTLVYRLANWRNRRQP---------IIPERIITRPPSAELRPDQTDQ 464

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD II+R +E+  S  +     +  E V  V  L+  +EYKRRQAP G +IT
Sbjct: 465 DSLPPYDILDGIIERYMEHNASAADIVAAGFPREAVGQVVRLIRINEYKRRQAPPGPRIT 524

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++FGRD  YP++N FR+
Sbjct: 525 PRAFGRDWRYPVTNGFRE 542


>gi|288817743|ref|YP_003432090.1| NH3-dependent NAD+ synthetase [Hydrogenobacter thermophilus TK-6]
 gi|288787142|dbj|BAI68889.1| NH3-dependent NAD+ synthetase [Hydrogenobacter thermophilus TK-6]
 gi|308751342|gb|ADO44825.1| NAD+ synthetase [Hydrogenobacter thermophilus TK-6]
          Length = 565

 Score =  479 bits (1234), Expect = e-133,   Method: Composition-based stats.
 Identities = 223/578 (38%), Positives = 317/578 (54%), Gaps = 38/578 (6%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  KL I IAQ++  VGD+ GN  K  +  EE +R    LI+F EL +SGYPPEDL+ + 
Sbjct: 1   MKSKLNITIAQMDITVGDVEGNAIKILKIWEEYHRV-SHLIVFPELALSGYPPEDLLLRM 59

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            FI+ C   +D ++  +    A  ++G P  + + + NS +++  G ++A   K  LPNY
Sbjct: 60  DFIKECQRWLDIIRDASAKFEAMALIGTPFYEGD-LYNSALLVGGGKLLAYYHKHFLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F EKR F  G     +   ++++GI +CED+W    + +     GA  L ++NASPYY
Sbjct: 119 SVFDEKRYFRKGTYGTMVELGEVKIGISVCEDLWHPDGLERTYAIMGAHALININASPYY 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + +   +  +       ++YVN VGGQDEL+FDG S   D    +  + K F E  
Sbjct: 179 FGKYEFKEAFLKARAEDNLCYVVYVNAVGGQDELVFDGRSLVIDPDGHICARAKAFEEDV 238

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTM-----------------YIP-----LQEEEADYNA 278
                  ++   +    +                        + P      ++EE  Y A
Sbjct: 239 LTVSLDVEKVKRRRLLDTRLREGKEKYHVISCGADTYRELEVFPPRVERNPKDEEEIYTA 298

Query: 279 CVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLED 338
               L  YV+KNNF KV++GLSGGIDS+L A +AVDALG + V  I +P ++TS +S ED
Sbjct: 299 LKTGLEAYVKKNNFSKVVLGLSGGIDSSLVACLAVDALGSDRVVGIFMPSEFTSKESKED 358

Query: 339 AAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHS 398
           A + AK LG +    PI  +   F   +         G+  EN+Q+RIR NIL  LSN  
Sbjct: 359 AVSLAKNLGIELYQFPIDVIFKSFRDTL----GFTDFGVADENLQARIRANILFYLSNRY 414

Query: 399 KAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTE 458
             ++L+TSNKSE SVGY T+YGDM+GGF PLKD+YKT V++LA +RNS         L  
Sbjct: 415 GWLVLSTSNKSEASVGYTTIYGDMAGGFAPLKDVYKTLVYRLARYRNS---------LRP 465

Query: 459 VIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINND-QEYNDETVRY 517
            IP  + +K PSAELRP Q DQ++LPPY +LD I+   +E   S      +  + ETV  
Sbjct: 466 DIPERVFQKPPSAELRPGQKDQDTLPPYQMLDQILTLYIEEGLSQEEIVQKGIDRETVEK 525

Query: 518 VEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           V  ++  +EYKRRQAPVG KIT ++FG+D   PI+N +
Sbjct: 526 VIRMIRLAEYKRRQAPVGIKITPRAFGKDWRMPITNMW 563


>gi|182439051|ref|YP_001826770.1| putative NH3-dependent NAD+ synthetase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326779702|ref|ZP_08238967.1| NAD+ synthetase [Streptomyces cf. griseus XylebKG-1]
 gi|178467567|dbj|BAG22087.1| putative NH3-dependent NAD+ synthetase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326660035|gb|EGE44881.1| NAD+ synthetase [Streptomyces cf. griseus XylebKG-1]
          Length = 584

 Score =  479 bits (1234), Expect = e-133,   Method: Composition-based stats.
 Identities = 211/591 (35%), Positives = 312/591 (52%), Gaps = 44/591 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+ Q++  VGD+AGN          A  QG  L+ F E+ ++GYP EDL  + S
Sbjct: 1   MPQLRLALNQIDSTVGDLAGNAEAIVHWTRHAAEQGAHLVAFPEMVLTGYPVEDLALRSS 60

Query: 62  FIQACSSAIDTLKSDTHDGG---AGIVVGFPRQDQ----------EGVLNSVVILDAGNI 108
           F++A   ++  L +     G     +VVG+  + +              N+  +L  G I
Sbjct: 61  FVEASRQSLRALAARLDAEGFGELPVVVGYLDRSEHAAARYGQPAGSPRNAAAVLHRGGI 120

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA 168
                K +LPNY  F E R F+ G S   +    I + + ICED+W++       +  GA
Sbjct: 121 ALNFAKHHLPNYGVFDEFRYFVPGDSMPVVRVHGIDVALAICEDLWQDGGRVPAARSAGA 180

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
             L S+NASPY  +K   R E+V  +         Y+  +GGQDEL+FDG S   D + +
Sbjct: 181 GLLLSINASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDKEGE 240

Query: 229 LAFQMKHFSEQNFMTEWHY------------DQQLSQWNYMSDDSASTMYIP-------- 268
           +  +   FSE + + +               D  L   + +  D     Y P        
Sbjct: 241 VIARAPQFSEGSVILDLELPAAGAEAPSGVVDDGLRIDHVVLSDRPVEAYEPELAGGYAE 300

Query: 269 -LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLP 327
            L +EE  Y+A V+ LR Y  KN F  V+IGLSGGIDSA+CAAIA DALG ++V  + +P
Sbjct: 301 RLGDEEEIYSALVVGLRAYAAKNGFSSVLIGLSGGIDSAICAAIACDALGAQHVYGVSMP 360

Query: 328 YKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIR 387
            KY+S  S  DAA  A+  G  +  +PI  + + +   +      E +G+  EN+Q+R+R
Sbjct: 361 SKYSSDHSKGDAAELARRTGLNFRTVPIEPMFDAYMESL------ELTGLAEENLQARLR 414

Query: 388 GNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSH 447
           G  LMA+SN    ++L   NKSE++VGY TLYGD  G + P+KD+YK+ VF+LA WRN  
Sbjct: 415 GTTLMAISNQEGQIVLAPGNKSELAVGYSTLYGDAVGAYGPIKDVYKSSVFRLAKWRNRA 474

Query: 448 GITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN- 506
               G  P    IP + + K PSAELRP Q D +SLP Y +LD I++  V+ ++      
Sbjct: 475 AEERGQTP---PIPEASITKPPSAELRPGQVDTDSLPDYEVLDAILELYVDRDQGLDAIV 531

Query: 507 DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
              ++ E V     ++  +EYKRRQ P GTKI+ K FG+DR  PI+N++R+
Sbjct: 532 AAGFDAELVAKTLRMVDAAEYKRRQYPPGTKISPKGFGKDRRLPITNRWRE 582


>gi|256788144|ref|ZP_05526575.1| NAD(+) synthase (glutamine-hydrolysing) [Streptomyces lividans
           TK24]
          Length = 589

 Score =  479 bits (1233), Expect = e-133,   Method: Composition-based stats.
 Identities = 206/596 (34%), Positives = 307/596 (51%), Gaps = 49/596 (8%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+ Q++  VGDI GN          +  +G  L+ F E+ ++GYP EDL  + S
Sbjct: 1   MPRLRLALNQIDSTVGDIDGNAESVLHWTRHSAERGAHLVAFPEMTLTGYPVEDLALRSS 60

Query: 62  FIQACSSAIDTLKSDTHDGG---AGIVVGFPRQD----------QEGVLNSVVILDAGNI 108
           F++A  +A+ +L +   D G     ++VG   +                N+  +L  G +
Sbjct: 61  FVEASRAALRSLAARLADEGLGTVPVIVGHLDRSATAQPRYGQPAGAPQNAAAVLYGGEV 120

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA 168
                K +LPNY  F E R F+ G +   +  R + + + ICED+W++       +   A
Sbjct: 121 ALSFAKHHLPNYGVFDEFRYFVPGDTLPVVRVRGVDVALAICEDLWQDGGRVPAARSARA 180

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
             L S+NASPY  +K   R E+V  +         Y+   GGQDEL+FDG S   D    
Sbjct: 181 GLLLSVNASPYERDKDDTRLELVRRRAQEAGCTTAYLAMTGGQDELVFDGDSIVVDRDGT 240

Query: 229 LAFQMKHFSEQNFMTEWHY------------------------DQQLSQWNYMSDDSAST 264
           +  +   F+E   + +                            +   +    + +   +
Sbjct: 241 VLARAPQFTEGCMVLDLDLPAADADPPTGVVDDGLRIDRVVLPGEAGREQPLPAGEPWLS 300

Query: 265 --MYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQ 322
                PL ++E  Y+A V  LR YV KN F  V+IGLSGGIDSAL A+IA DALG E+V 
Sbjct: 301 GGHAEPLDDDEEVYSALVTGLRAYVAKNGFRSVLIGLSGGIDSALVASIACDALGAEHVY 360

Query: 323 TIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENI 382
            + +P KY+S  S +DAA  A+  G  Y  + I  + + +   +      E +G+  EN+
Sbjct: 361 GVSMPSKYSSGHSRDDAAELARRTGLHYRTVSIEPMFDAYTGAL------ELTGLAEENL 414

Query: 383 QSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLAS 442
           QSR+RG +LMALSN    ++L   NKSE++VGY TLYGD  GG+ P+KD+YKT VF+LA 
Sbjct: 415 QSRLRGTLLMALSNQEGHLVLAPGNKSELAVGYSTLYGDSVGGYGPIKDVYKTSVFRLAE 474

Query: 443 WRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEES 502
           WRN      G  P    +P + + K PSAELRP Q D +SLP YP+LD I+   V+ +  
Sbjct: 475 WRNRAARDRGRTP---PVPENSITKPPSAELRPGQVDTDSLPDYPVLDAILALYVDRDRG 531

Query: 503 FINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
                   Y+ E V     ++  +EYKRRQ P GTKI+ K FG+DR  P++N++R+
Sbjct: 532 ADEIVAAGYDRELVTRTLRMVDTAEYKRRQYPPGTKISPKGFGKDRRLPVTNRWRE 587


>gi|241762372|ref|ZP_04760451.1| NAD+ synthetase [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241373059|gb|EER62708.1| NAD+ synthetase [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 558

 Score =  479 bits (1233), Expect = e-133,   Method: Composition-based stats.
 Identities = 244/557 (43%), Positives = 348/557 (62%), Gaps = 6/557 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M  +L I +AQ+   VG    N     + R+EA    +DLILF EL + GYPPEDLV K 
Sbjct: 3   MTDQLTILLAQIPQTVGHCRRNADAMLKIRQEA--GKVDLILFPELQLIGYPPEDLVLKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S +Q     ++ L   T DGGA ++VG   Q++  + N+V +LD G I A+R K +LPNY
Sbjct: 61  SLLQNAKEELERLALATSDGGAAMLVGTAWQEKGRIFNAVALLDQGKIAAIRYKHDLPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F EKR F +G   +P++FRD+ LGI +CEDIW       HLK++GAE L   N SP+ 
Sbjct: 121 GTFDEKRIFSAGPLPEPVLFRDVSLGIPVCEDIWTEKLC-DHLKERGAEILLVPNGSPFE 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R ++V  ++    LP +Y+N+VGGQDE++FDG SF  +    +   +  +    
Sbjct: 180 SGKYPVRRKVVADRVKETGLPCLYLNRVGGQDEVVFDGGSFVVNRDGAVPVSLPRWQADC 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
           ++T WH  ++   W+      +             Y A ++ L DYV++N F  V++GLS
Sbjct: 240 YVTRWHKTEE--GWSCDEGLQSKISEGEDGRLSDIYQAMMMGLGDYVRQNGFSGVLLGLS 297

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL AA+AVDALG + V  +MLP +YTS +SL+DA ACA+ LGC+ D +PI+  V 
Sbjct: 298 GGIDSALSAAVAVDALGADKVWCVMLPSRYTSQESLDDARACAEMLGCRLDSVPINPAVE 357

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
               +++     +   I  ENIQSR+RG +LMA+SN    M+LTT NKSE++VGY TLYG
Sbjct: 358 AIDGMLAPLFSGKKPDITEENIQSRLRGVVLMAISNKFSPMVLTTGNKSEMAVGYATLYG 417

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG++ LKDLYK+ VF+++ WRNSH     LGP   V+P  ++ K PSAELR  Q D 
Sbjct: 418 DMNGGYSVLKDLYKSDVFKVSRWRNSHKPAHALGPDGYVMPDRVITKPPSAELREDQKDS 477

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD ++  ++E + S  +   + Y+ + V  +E+LL+ +EYKRRQAP G K+ 
Sbjct: 478 DSLPPYDILDAVLHGLIEEDLSCSDLVKRGYDPDLVTRIENLLHRAEYKRRQAPPGVKLG 537

Query: 540 AKSFGRDRLYPISNKFR 556
           +++FGRDR YP+S++FR
Sbjct: 538 SRNFGRDRRYPLSHQFR 554


>gi|295839307|ref|ZP_06826240.1| glutamine-dependent NAD+ synthetase [Streptomyces sp. SPB74]
 gi|197696920|gb|EDY43853.1| glutamine-dependent NAD+ synthetase [Streptomyces sp. SPB74]
          Length = 586

 Score =  479 bits (1233), Expect = e-133,   Method: Composition-based stats.
 Identities = 208/592 (35%), Positives = 309/592 (52%), Gaps = 44/592 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+ Q++ VVGD+AGN          A  +G  L+ F E+ ++GYP EDL  + +
Sbjct: 1   MPQLRLAMNQIDAVVGDLAGNADAVLHWTRHAAERGAHLVAFPEMVLTGYPVEDLALRST 60

Query: 62  FIQACSSAIDTLKSDTHD---GGAGIVVGFPRQDQ----------EGVLNSVVILDAGNI 108
           F++A  +A+  L +   +   GG  +V+G+  + +              N+  +L  G +
Sbjct: 61  FVEASRAALHALATRLVEAGLGGLPVVLGYLDRSETDQHRYGMPAGSPRNAAAVLHGGRV 120

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA 168
                K +LPNY  F E R F+ G +   +    + + + ICED+W++       +  GA
Sbjct: 121 ALRFAKHHLPNYGVFDEFRYFVPGDTLPVVRVHGVDVALAICEDLWQDGGRVPATRAAGA 180

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
             L S+NASPY   K   R E+V  +         Y+   GGQDEL+FDG S   D    
Sbjct: 181 GLLLSINASPYEREKDDTRLELVRKRAREAGCTTAYLAMSGGQDELVFDGDSIVVDKDGS 240

Query: 229 LAFQMKHFSEQNFMTEWHYDQ------------QLSQWNYMSDDSASTMYIP-------- 268
           +  +   F+E  F+ +                  L   +     +    Y P        
Sbjct: 241 VITRAPQFTEGCFLLDLDLPPAPPEEPAGTVHDGLRIEHVTLSPTPLPAYEPEYTGQYAE 300

Query: 269 -LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLP 327
            L++ E  Y A V  LR YV+KN F  V+IGLSGGIDSALCAAIA DA+G E+V  + +P
Sbjct: 301 RLEDAEEVYGALVTGLRAYVRKNGFRTVLIGLSGGIDSALCAAIACDAIGAEHVHGVSMP 360

Query: 328 YKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIR 387
            KY+S  S +DAA  A   G  Y  +PI  + + +   +        +G+  EN+Q+R+R
Sbjct: 361 SKYSSEHSKDDAADLAARTGLHYRTVPIAPMFDAYMDALG------FTGLAEENLQARLR 414

Query: 388 GNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSH 447
           G  LM +SN    ++L   NKSE++VGY TLYGD  G + P+KD+YK+QVF LA WRN  
Sbjct: 415 GTTLMGISNQEGQIVLAPGNKSELAVGYSTLYGDAVGAYGPIKDVYKSQVFALARWRNQA 474

Query: 448 GITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN- 506
               G  P    IP + + K PSAELRP Q D +SLP Y +LD ++   V+ ++      
Sbjct: 475 AEQRGETP---PIPENTIAKPPSAELRPGQVDTDSLPDYDVLDRVLAMYVDQDQGADAIV 531

Query: 507 DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
              ++ E V  V  ++ G+EYKRRQ P GTKI+ K FG+DR  PI+N++R+ 
Sbjct: 532 AAGFDPEVVARVLRMVDGAEYKRRQYPPGTKISPKGFGKDRRMPITNRWRER 583


>gi|71064847|ref|YP_263574.1| putative NH3-dependent (glutamine-hydrolyzing) NAD(+) synthetase
           [Psychrobacter arcticus 273-4]
 gi|71037832|gb|AAZ18140.1| putative NH3-dependent (glutamine-hydrolyzing) NAD(+) synthetase
           [Psychrobacter arcticus 273-4]
          Length = 567

 Score =  479 bits (1233), Expect = e-133,   Method: Composition-based stats.
 Identities = 231/555 (41%), Positives = 322/555 (58%), Gaps = 19/555 (3%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
             +  A+AQ + +VGDI  N  K R    +A  QG D+I+F EL + GYPP+DL+ + S 
Sbjct: 28  DSVTFALAQSHFLVGDIKANAEKMRTLALQAREQGADVIIFPELALLGYPPQDLLLRPSL 87

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
                SA+ TL          ++VG+P  D  G  NS  IL  G+      K  LPNY  
Sbjct: 88  SGRIKSALSTLSDI---DDIVMIVGYPHVDHHGTFNSAAILHNGHQKGFYHKQILPNYGV 144

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F E+R F  G +     ++ I +G+LICED+W    I + LKKQGA+ + SLNASP+   
Sbjct: 145 FDERRYFDKGRNQVLFDYKGITIGLLICEDLWGKGPIAE-LKKQGADLIVSLNASPFEIE 203

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K   R  ++T +    +LPI+Y+N VGGQD+L+FDG S        +A +   F  Q  +
Sbjct: 204 KQDARKTMLTKRSRENNLPIVYLNAVGGQDDLVFDGGSMAIQADGSVAHEASRFMNQLLL 263

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
             +              D  +   + L  E   Y A V+ LRDYV  + F  +I+GLSGG
Sbjct: 264 ASFDVKT-------AKFDIQAKAPLSLSRESEMYQALVVGLRDYVNLSGFTGIIVGLSGG 316

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL   IAVDALG + V  +M+PY+YTS  SLEDA A A+ L   Y V PI D V   
Sbjct: 317 IDSALTLCIAVDALGADKVYAVMMPYEYTSQISLEDAQAQARRLNVSYTVCPIFDAVEGI 376

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
              ++    + P+    ENIQ+R RG +LMALSN    +++TT NKSE++VGY TLYGDM
Sbjct: 377 RHTLAPLFNKSPADTTEENIQARARGVVLMALSNKFGHLVITTGNKSELAVGYSTLYGDM 436

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF+ LKD+YK+QV++LAS+RN           T VIP  ++ + PSAELRP Q DQ+S
Sbjct: 437 AGGFDVLKDVYKSQVYKLASYRNRL-------EDTPVIPERVITRPPSAELRPDQKDQDS 489

Query: 483 LPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LP Y +LD I+   ++ +  + +  D+ ++ + V  V  ++  SEYKR QAP+GTKI+ K
Sbjct: 490 LPDYDVLDGILMSYIDEDMGYQDIVDKGFDADLVAKVIQMVDNSEYKRSQAPIGTKISHK 549

Query: 542 SFGRDRLYPISNKFR 556
           +FGR+R YP+ NK+ 
Sbjct: 550 AFGRERRYPLVNKWS 564


>gi|218245153|ref|YP_002370524.1| NAD synthetase [Cyanothece sp. PCC 8801]
 gi|218165631|gb|ACK64368.1| NAD+ synthetase [Cyanothece sp. PCC 8801]
          Length = 561

 Score =  479 bits (1233), Expect = e-133,   Method: Composition-based stats.
 Identities = 216/576 (37%), Positives = 325/576 (56%), Gaps = 41/576 (7%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQLNP++GD+A N  K   A + A  Q   L+L  EL + GYPP DL+   SF++
Sbjct: 1   MKIAIAQLNPIIGDLANNAQKINDAAQFAASQNARLLLTPELSLCGYPPRDLLLNPSFVK 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFP-------RQDQEGVLNSVVILDAGNIIAVRDKINL 117
           + S  ++ L          ++VG          + ++ + NSV  L+ G I  +  K  L
Sbjct: 61  SLSLELEQLSKKIP-PQLAVLVGTVTANTDAYIKGEKPLFNSVAWLENGQIKQIFHKRLL 119

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDI------RLGILICEDIWKNSNIC----------K 161
           PNY  F E R F  G  ++     D       ++G+ ICED+W +               
Sbjct: 120 PNYDVFDEARYFEPGRQSNYFQLTDFESSEILKIGVTICEDLWNDQEFWGQKYYEHNPLA 179

Query: 162 HLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASF 221
            L   G + + +L+ASPY   K K R +++        +PI+Y NQ+GG D+LIFDG SF
Sbjct: 180 DLIDFGVDLIVNLSASPYTVGKQKIREKMIKYSSQRYQIPIVYTNQIGGNDDLIFDGNSF 239

Query: 222 CFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVL 281
             + Q ++A ++K F E   + ++    +    + ++D +         EEE  + A VL
Sbjct: 240 VVNRQGKIALRLKGFEENIQVVDFDLKAKDFCSSSLNDHTTI-------EEEEIWLALVL 292

Query: 282 SLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAA 341
            L+DY +K  F K ++GLSGGIDS+L AAIA +ALGK+NV  +++P  ++S  S+ DA A
Sbjct: 293 GLKDYAKKCGFSKAVLGLSGGIDSSLVAAIATEALGKDNVLGLLMPSPFSSEHSITDAEA 352

Query: 342 CAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAM 401
             K LG      PI D++N + +L+         GI  EN+QSRIRGN+LMA++N    +
Sbjct: 353 LVKNLGINSYKFPIEDVMNSYDTLLHPLFLGTEFGIAEENLQSRIRGNLLMAIANKFGYL 412

Query: 402 LLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIP 461
           LL+T NKSE++VGY TLYGDM+GG   + D+ KT+VF L  W N H         TEVIP
Sbjct: 413 LLSTGNKSEMAVGYCTLYGDMNGGLAVISDVPKTRVFSLCQWLNRH---------TEVIP 463

Query: 462 PSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEH 520
            ++L K PSAEL+P+Q DQ+SLPPY ILD+I+ R++   +S     D  ++   +  +  
Sbjct: 464 HNVLIKPPSAELKPNQVDQDSLPPYDILDEILDRLIHRHQSVSQIHDAGFDLAVINKILK 523

Query: 521 LLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           L+  +E+KR+QAP G K+T ++FG     PI+++++
Sbjct: 524 LVIRAEFKRKQAPPGLKVTDRAFGTGWRMPIASRWK 559


>gi|222100295|ref|YP_002534863.1| glutamine-dependent NAD(+) synthetase [Thermotoga neapolitana DSM
           4359]
 gi|221572685|gb|ACM23497.1| glutamine-dependent NAD(+) synthetase [Thermotoga neapolitana DSM
           4359]
          Length = 555

 Score =  479 bits (1232), Expect = e-133,   Method: Composition-based stats.
 Identities = 215/562 (38%), Positives = 311/562 (55%), Gaps = 34/562 (6%)

Query: 24  AKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSSAIDTLKSDTHDGGAG 83
            KA  A + A  +G DL++F ELF+ GYPPEDL+ + SF++     +  L S T      
Sbjct: 2   KKAIEALKTAEERGSDLLIFPELFLPGYPPEDLMLRLSFLRENRRYLLELASHTKSCEVT 61

Query: 84  IVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDI 143
           ++VGF   D++   N+  +L  G ++ V  K+ LPNY  F E+R F  G     +   D+
Sbjct: 62  VLVGFIDSDEDA-YNAAAVLKRGEVLGVYRKMFLPNYGVFDERRYFKPGEELLVLKMGDV 120

Query: 144 RLGILICEDIWKNSNICKHLKKQG-AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPI 202
           ++G+ ICEDIW        L        + +L+ASPY+  K + R E ++ +    H  I
Sbjct: 121 KIGVTICEDIWNPVEPSASLSLGEGVHLVANLSASPYHVGKPRLRKEYLSMKAYDYHTAI 180

Query: 203 IYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLS---------- 252
            Y N VGGQDEL+FDG S   D   ++    K F E+    +   D+ L           
Sbjct: 181 AYCNMVGGQDELVFDGGSIVVDASGEVISYGKLFEEEIITVDLDLDENLRVSLLDPRRRY 240

Query: 253 --------------QWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
                              S      ++   + EE  + A V  +RDYV+KN F KV+IG
Sbjct: 241 MRSQNYPVKIVDVGGLRRKSSHFDPLIHPIPKREEEMFRALVTGVRDYVRKNGFEKVVIG 300

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGG+DS+L A IA +ALGKENV+ +++P  YTS  SLEDA   A+ LG +  ++PI D+
Sbjct: 301 LSGGMDSSLVAVIATEALGKENVKGVLMPSMYTSKSSLEDAQKLAENLGIETFIIPITDV 360

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
              +   + +    +   I  ENIQ+RIRGN LMALSN    ++LTT NKSE++ GY TL
Sbjct: 361 FRSYLDALKEVFAGKEPDITEENIQARIRGNYLMALSNKFGWLVLTTGNKSEMATGYATL 420

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM+GGF  +KD+YKT V+++  W N            E+IP ++  K PSAELRP QT
Sbjct: 421 YGDMAGGFAVIKDVYKTDVYRIGRWYNEWKGR-------EIIPENVFVKPPSAELRPGQT 473

Query: 479 DQESLPPYPILDDIIKRIVENEESFINND-QEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQE LPPY ILD+I+K  +E          + ++ + V  V  ++  +EYKR+QA +GTK
Sbjct: 474 DQEKLPPYEILDEILKLYIEEGLDPEEIALKGFDKKMVVEVTEMVRKNEYKRKQAAIGTK 533

Query: 538 ITAKSFGRDRLYPISNKFRDHI 559
           I+ ++FG+D   PI+N+FR+ +
Sbjct: 534 ISTRAFGKDWRMPITNRFREPL 555


>gi|304316376|ref|YP_003851521.1| NAD+ synthetase [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
 gi|302777878|gb|ADL68437.1| NAD+ synthetase [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
          Length = 545

 Score =  479 bits (1232), Expect = e-133,   Method: Composition-based stats.
 Identities = 227/566 (40%), Positives = 322/566 (56%), Gaps = 36/566 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQLNP VGDI  N  K     +EA +  MDLI+F EL I GYPP+DL++   F++
Sbjct: 1   MKIALAQLNPTVGDIKNNCEKIIMYIKEAKKANMDLIVFPELSIIGYPPKDLLYNPDFLE 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG---VLNSVVILDAGNIIAVRDKINLPNYS 121
           +  SA++ L         G++VG   +D+E    + NS ++L  G II   DK  LPNY 
Sbjct: 61  SSYSALNELI-LPETNDIGVIVGIATKDKEKDYMLHNSALLLYNGKIIGQADKTLLPNYD 119

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNIC----------KHLKKQGAEFL 171
            F E+R F    S     F+ +RL + ICEDIW + +            +   K   +  
Sbjct: 120 VFDEQRYFEPAKSRTCFDFKGMRLAVNICEDIWNDKDFWERPRYDIDVLEEQYKLNPDIF 179

Query: 172 FSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAF 231
            +++ASPY   K + R ++V        LP+IYVNQVGG DELIFDG SF  +       
Sbjct: 180 INISASPYNLGKQELRTKMVKQISKKYKLPLIYVNQVGGNDELIFDGNSFAINSNGDRVV 239

Query: 232 QMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNN 291
            ++ FSE     +     +L     +            ++    ++A +L LRDY +K  
Sbjct: 240 NLRSFSEDIAFVDTENLDELKPLQEIK-----------EDISWVHDALILGLRDYFRKTG 288

Query: 292 FHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYD 351
           F K ++GLSGGIDSA+  A+AV ALG+ENV  + +P +Y+S  S +DA   A+ LG +Y 
Sbjct: 289 FKKAVVGLSGGIDSAVTCALAVKALGRENVLGVSMPSRYSSEGSKDDARDLAQNLGIQYR 348

Query: 352 VLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEI 411
           V+PI D+   + S+ ++        +  EN+Q+RIRGN LM +SN    M+LTT NKSEI
Sbjct: 349 VIPIEDVFKSYISIFNK-DGNVLGDLAEENLQARIRGNYLMFISNREGYMVLTTGNKSEI 407

Query: 412 SVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSA 471
           +VGY TLYGDMSGG   + D+ KT V++LA + N   I         +IP S +EK+PSA
Sbjct: 408 AVGYCTLYGDMSGGLAVISDVPKTMVYELAKYINRDKI---------IIPLSTIEKAPSA 458

Query: 472 ELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRR 530
           ELRP+Q D +SLPPY ILDDI+K  +E+++S        Y+ + VR V   +  +EYKR+
Sbjct: 459 ELRPNQKDTDSLPPYEILDDILKSYIEDDKSISEIIADGYDKDLVRDVIRKVNNAEYKRK 518

Query: 531 QAPVGTKITAKSFGRDRLYPISNKFR 556
           QA  G K+T K+FG  R  PI+ +FR
Sbjct: 519 QAAPGLKVTTKAFGVGRRMPIAQRFR 544


>gi|302342587|ref|YP_003807116.1| NAD+ synthetase [Desulfarculus baarsii DSM 2075]
 gi|301639200|gb|ADK84522.1| NAD+ synthetase [Desulfarculus baarsii DSM 2075]
          Length = 565

 Score =  479 bits (1232), Expect = e-133,   Method: Composition-based stats.
 Identities = 219/568 (38%), Positives = 306/568 (53%), Gaps = 25/568 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IA AQ+NP VGD+A N A       +A +    ++ F EL + GYPPEDL+ K  F+ 
Sbjct: 1   MRIAQAQINPTVGDLAANTAMILDYMAQARQAQAGVVCFPELAVCGYPPEDLLLKPRFLA 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
              +A++ L       G   VVGFP  +   V N+  +L  G + AV  KI LPNY  F 
Sbjct: 61  DARAAVERLALAAR--GVTAVVGFPLAEGGVVRNAAAVLAEGRVAAVYRKIELPNYGVFD 118

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNIC-KHLKKQGAEFLFSLNASPYYHNK 183
           E+R F +G     +      + + ICED+W   N   +   + G     +++ SP++  K
Sbjct: 119 ERRYFAAGDECLILDMGGTGVLVSICEDVWLAGNQVERVAAQAGVGLTINISGSPFHAGK 178

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
           L +R EI+ G        + Y N VGGQDEL+FDG S   D   QL+     F++  ++ 
Sbjct: 179 LGQRLEILGGFARRSGAAMCYANLVGGQDELVFDGGSMIIDPDGQLSACAPRFTQGLYIH 238

Query: 244 EWHYDQQLSQWNYMSDDSA-------------STMYIPLQEEEADYNACVLSLRDYVQKN 290
           +     +  +    +                  T    L  E+    A  L L DYV+KN
Sbjct: 239 DLELPTRPPRPTPGATIVHVAAPAAPSGKIAAQTRAPELNTEDEVLAALGLGLADYVRKN 298

Query: 291 NFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKY 350
            F KV +GLSGGIDSAL AA+AV ALG +NV  + +P +YTS ++L DA   A  LG + 
Sbjct: 299 GFGKVTLGLSGGIDSALTAAVAVSALGAQNVVGVTMPSQYTSGETLSDAQLLAANLGVEL 358

Query: 351 DVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSE 410
             +P+  + + F   M   L   P G+ AEN+Q+RIRG ILM LSN    ++LTT NKSE
Sbjct: 359 LTVPLKGVYDVFIDQMRPALGPGPLGVEAENLQARIRGAILMTLSNRFGWLVLTTGNKSE 418

Query: 411 ISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPS 470
            +VGY TLYGDM+GGF  +KD+ KT V++LA   N            E+IP S +E+ PS
Sbjct: 419 TAVGYCTLYGDMAGGFALIKDVPKTLVYRLARRVNQRAGR-------ELIPASTIERPPS 471

Query: 471 AELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EY-NDETVRYVEHLLYGSEYK 528
           AELRP Q D +SLP Y +LD I++  VE +            + + V  V  ++  +EYK
Sbjct: 472 AELRPDQKDTDSLPEYDVLDPILQAYVEQDMVLDEIAALGLADKDVVAKVVRMVDLNEYK 531

Query: 529 RRQAPVGTKITAKSFGRDRLYPISNKFR 556
           RRQAP G KIT K+FGRDR  PI+N++R
Sbjct: 532 RRQAPPGVKITPKAFGRDRRLPITNRYR 559


>gi|166366233|ref|YP_001658506.1| NAD synthetase [Microcystis aeruginosa NIES-843]
 gi|166088606|dbj|BAG03314.1| glutamine-dependent NAD(+) synthetase [Microcystis aeruginosa
           NIES-843]
          Length = 552

 Score =  478 bits (1231), Expect = e-133,   Method: Composition-based stats.
 Identities = 221/571 (38%), Positives = 325/571 (56%), Gaps = 40/571 (7%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IAIAQLNP+VGDI GN  +   A + A  QG +L+L  EL + GYPP DL+    F++
Sbjct: 1   MRIAIAQLNPIVGDIEGNAQRILEAAQTAFNQGAELLLTPELSLCGYPPRDLLLNLGFVE 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-------VLNSVVILDAGNIIAVRDKINL 117
             S  +  L     +    ++VGF  ++          + NS+ +L +  I  +  K  L
Sbjct: 61  KMSRQLQLLSQQLPEK-LAVLVGFVEKNPSATVRGEKPLFNSIALLKSQEIKQIFTKRLL 119

Query: 118 PNYSEFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNIC----------KHLKK 165
           P Y  F E R F SG  +        ++++G+ ICED+W +                L  
Sbjct: 120 PTYDVFDEDRYFASGKESQYFQLTENNVKIGVTICEDVWNDEQFWGQRQYAVNPIADLAN 179

Query: 166 QGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDG 225
            G + + +L+ASPY   K K R  +++   +  +LPI+YVNQVGG D+LIFDG S  F+ 
Sbjct: 180 LGVDLIVNLSASPYSVGKQKLRESLLSHSATRYNLPIVYVNQVGGNDDLIFDGDSVAFNR 239

Query: 226 QQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRD 285
           Q ++ ++ + F+    + E++ D             A    +P+ E+E  Y A VL +RD
Sbjct: 240 QGEVIYRAQAFTSSLELIEFNQDLL----------PAVIHPLPVDEDEEIYRALVLGVRD 289

Query: 286 YVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKA 345
           YVQK  F +VI GLSGGIDS+L AAIA DALGKENV  +M+P  Y+S  S+ DA A    
Sbjct: 290 YVQKCGFKRVIFGLSGGIDSSLVAAIASDALGKENVLAVMMPSPYSSDHSISDAVALVNN 349

Query: 346 LGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTT 405
           LG K + L I +++  +  L+         GI  EN+QSRIRGN+LMALSN    +LL+T
Sbjct: 350 LGIKSEKLAIQEIMTAYDQLLEPVFAGTDFGIAEENLQSRIRGNLLMALSNKFGHLLLST 409

Query: 406 SNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSIL 465
            NKSE++VGY TLYGDM+GG   + D+ KT+V+ L  W N H          E+IP +++
Sbjct: 410 GNKSEMAVGYCTLYGDMNGGLAVIADVPKTRVYSLCRWLNRH---------GEIIPLNVI 460

Query: 466 EKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYG 524
            K+PSAEL+P+Q DQ+SLPPY ILD I+  +++  +S        +  E V+ V  L+  
Sbjct: 461 NKAPSAELKPNQKDQDSLPPYEILDAILALLIDRHQSAEQIIAAGFEPEIVQKVIKLVKN 520

Query: 525 SEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           +E+KR+QAP G KI+ ++FG     PI++++
Sbjct: 521 AEFKRKQAPPGLKISDRAFGTGWRMPIASRW 551


>gi|297544156|ref|YP_003676458.1| NAD+ synthetase [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
 gi|296841931|gb|ADH60447.1| NAD+ synthetase [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
          Length = 543

 Score =  478 bits (1231), Expect = e-133,   Method: Composition-based stats.
 Identities = 223/564 (39%), Positives = 320/564 (56%), Gaps = 34/564 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQ+NPVVGDI GN  K       A  Q  DL++F EL   GYPP+D +F + F++
Sbjct: 1   MKIALAQINPVVGDIKGNFEKIVEFINRAKYQKADLVVFPELATVGYPPKDFLFMQDFLK 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQD-QEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           A    I+ +         G+++G  RQD +  + NS   +  G I+ V DK  LPNY  F
Sbjct: 61  ANEKYINEIV-LPATYQIGVILGTVRQDTEGNLYNSAFFIYDGKIVEVFDKTLLPNYDVF 119

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNI----------CKHLKKQGAEFLFS 173
            EKR F          F+ I+LG+ ICEDIWK+              +   K   +   +
Sbjct: 120 DEKRYFKPAQLRKVASFKGIKLGVNICEDIWKDYVFEPNVDYSVDVLEEQYKLKPDIFIN 179

Query: 174 LNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQM 233
           ++ASPYY  K   R E++  +I    +P IYVNQVG  DELIFDG+SF  + + +   Q+
Sbjct: 180 ISASPYYLGKQNMRVEMIEKKIKKYAIPFIYVNQVGANDELIFDGSSFVVNEEGKRVVQL 239

Query: 234 KHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFH 293
           K F E   + +    +   +   M            ++    YNA VL +RDY +K+ F 
Sbjct: 240 KAFEEDIKIVDIDELKNFKELPEMK-----------EDISWVYNALVLGVRDYCKKSGFK 288

Query: 294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVL 353
           K ++GLSGGIDSA+  AIAV+ALGKENV  + +P +Y+S  S  DA   A+ LG ++ V+
Sbjct: 289 KAVVGLSGGIDSAVVCAIAVEALGKENVLAVSMPSRYSSEGSKSDARILAENLGIEFRVI 348

Query: 354 PIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISV 413
           PI  +   + S+ +         +  ENIQ+RIRGN LM +SN    ++LTT NKSE+++
Sbjct: 349 PIEPVFESYLSVFN-GDNSAIGDLAEENIQARIRGNYLMFISNREGHIVLTTGNKSELAM 407

Query: 414 GYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAEL 473
           GY TLYGDMSG   P+ D+ KT V++LA + N            E+IP SI+EK+PSAEL
Sbjct: 408 GYCTLYGDMSGSLAPIADVPKTMVYELAKYINRK---------KEIIPISIIEKAPSAEL 458

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQA 532
           RP+Q D++SLPPY ILD+I+K  +E   S     ++ Y+++ V+ V + +   EYKR+QA
Sbjct: 459 RPNQKDEDSLPPYKILDEILKMYIEENRSVKEIVEKGYDEKLVKDVINKVNRVEYKRKQA 518

Query: 533 PVGTKITAKSFGRDRLYPISNKFR 556
               K+T K+FG  R  PI + F+
Sbjct: 519 APVLKVTTKAFGIGRRMPIVHNFK 542


>gi|300703412|ref|YP_003745014.1| nh3-dependent nad+ synthetase (nade) [Ralstonia solanacearum
           CFBP2957]
 gi|299071075|emb|CBJ42384.1| putative nh3-dependent nad+ synthetase (nadE) [Ralstonia
           solanacearum CFBP2957]
          Length = 546

 Score =  478 bits (1231), Expect = e-133,   Method: Composition-based stats.
 Identities = 220/562 (39%), Positives = 319/562 (56%), Gaps = 31/562 (5%)

Query: 7   IAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQAC 66
           +A+AQ+N  VGD+AGN+ +   A  EA++ G  +++  EL ++GYPPEDL+ + +F+ A 
Sbjct: 5   VALAQINCTVGDLAGNVVRIVAAAREAHQAGARILVTPELSLTGYPPEDLLLRPAFLNAT 64

Query: 67  SSAIDTLK-SDTHDGGAGIVVGFPRQDQE---------GVLNSVVILDAGNIIAVRDKIN 116
           S A+D L        G  +++G P+   E            N+  +   G ++    K+ 
Sbjct: 65  SRALDALVVELAAFPGLHVLIGHPQLSFEAPAPGSALPKPTNTATVAVDGRMLGQYHKLE 124

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LPN   F EKR F +G           R G++ICED W            GAE +   NA
Sbjct: 125 LPNNEVFDEKRYFQAGCEPFVFEVEGTRFGVIICEDAWYPQATAWAKTA-GAEVVLIPNA 183

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY+ +K   R +I+  ++    LP +YVN VGGQDEL+FDG SF  D   +   +M  F
Sbjct: 184 SPYHLDKEDLREQIIGARVKESGLPHVYVNLVGGQDELVFDGGSFVLDAHGKPVARMAQF 243

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
           +E      +            +      +      E   Y A  L +RDY+ KN F   I
Sbjct: 244 AEGVGYVRFD----------GARPQPGEIAQEATLEAQVYEALKLGVRDYIGKNGFPGAI 293

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           IGLSGG+DSAL  AIAVDALG + V+ +M+P +YT+  S  DA   A  LG +YD +PI 
Sbjct: 294 IGLSGGVDSALVLAIAVDALGADRVRAVMMPSRYTADISWVDARDMAVRLGVRYDEIPIM 353

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            + + F   ++   +  P     ENIQ+RIRG +LMALSN S  ++LTT NKSE++VGY 
Sbjct: 354 PMFDAFRGALADEFRNLPEDATEENIQARIRGTLLMALSNKSGRIVLTTGNKSEMAVGYC 413

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPH 476
           TLYGDM+GGF  +KD++KT V++L  +RN+         L+EVIP  IL ++PSAELR +
Sbjct: 414 TLYGDMAGGFAVIKDIFKTLVYRLCRYRNA---------LSEVIPERILTRAPSAELREN 464

Query: 477 QTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVG 535
           QTDQ+SLP Y  LD I++R +E  +   +     + +  V+ +  LL  +EYKRRQAPVG
Sbjct: 465 QTDQDSLPEYAALDAIVQRYMEQNQPVADIIAAGFAEADVQKIVRLLKINEYKRRQAPVG 524

Query: 536 TKITAKSFGRDRLYPISNKFRD 557
            ++T ++FGRD  YPI+++F++
Sbjct: 525 IRVTQRAFGRDWRYPITSRFKE 546


>gi|257058179|ref|YP_003136067.1| NAD synthetase [Cyanothece sp. PCC 8802]
 gi|256588345|gb|ACU99231.1| NAD+ synthetase [Cyanothece sp. PCC 8802]
          Length = 561

 Score =  478 bits (1231), Expect = e-133,   Method: Composition-based stats.
 Identities = 216/576 (37%), Positives = 325/576 (56%), Gaps = 41/576 (7%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQLNP++GD+A N  K   A + A  Q   L+L  EL + GYPP DL+   SF++
Sbjct: 1   MKIAIAQLNPIIGDLANNAQKINDAAQFAASQNARLLLTPELSLCGYPPRDLLLNPSFVK 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFP-------RQDQEGVLNSVVILDAGNIIAVRDKINL 117
           + S  ++ L          ++VG          + ++ + NSV  L+ G I  +  K  L
Sbjct: 61  SLSLELEQLSKKIP-PQLAVLVGTVTANTDAYIKGEKPLFNSVAWLENGQIKQIFHKRLL 119

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDI------RLGILICEDIWKNSNIC----------K 161
           PNY  F E R F  G  ++     D       ++G+ ICED+W +               
Sbjct: 120 PNYDVFDEARYFEPGRQSNYFQLTDFESSEILKIGVTICEDLWNDQEFWGQKYYEHNPLA 179

Query: 162 HLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASF 221
            L   G + + +L+ASPY   K K R +++        +PI+Y NQ+GG D+LIFDG SF
Sbjct: 180 DLIDFGVDLIVNLSASPYTVGKQKIREKMIKYSSQRYQIPIVYTNQIGGNDDLIFDGNSF 239

Query: 222 CFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVL 281
             + Q ++A ++K F E   + ++    +    + ++D +         EEE  + A VL
Sbjct: 240 VVNRQGKIALRLKGFEENIQVVDFDLKAKDFCSSSLNDHTTI-------EEEEIWLALVL 292

Query: 282 SLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAA 341
            L+DY +K  F K ++GLSGGIDS+L AAIA +ALGK+NV  +++P  ++S  S+ DA A
Sbjct: 293 GLKDYGKKCGFSKAVLGLSGGIDSSLVAAIATEALGKDNVLGLLMPSPFSSEHSITDAEA 352

Query: 342 CAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAM 401
             K LG      PI D++N + +L+         GI  EN+QSRIRGN+LMA++N    +
Sbjct: 353 LVKNLGINSYKFPIEDVMNSYDTLLHPLFLGTEFGIAEENLQSRIRGNLLMAIANKFGYL 412

Query: 402 LLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIP 461
           LL+T NKSE++VGY TLYGDM+GG   + D+ KT+VF L  W N H         TEVIP
Sbjct: 413 LLSTGNKSEMAVGYCTLYGDMNGGLAVISDVPKTRVFSLCQWLNRH---------TEVIP 463

Query: 462 PSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEH 520
            ++L K PSAEL+P+Q DQ+SLPPY ILD+I+ R++   +S     D  ++   +  +  
Sbjct: 464 HNVLIKPPSAELKPNQVDQDSLPPYDILDEILDRLIHRHQSVSQIHDAGFDLAVINKILK 523

Query: 521 LLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           L+  +E+KR+QAP G K+T ++FG     PI+++++
Sbjct: 524 LVIRAEFKRKQAPPGLKVTDRAFGTGWRMPIASRWK 559


>gi|291444194|ref|ZP_06583584.1| NH(3)-dependent NAD(+) synthetase [Streptomyces roseosporus NRRL
           15998]
 gi|291347141|gb|EFE74045.1| NH(3)-dependent NAD(+) synthetase [Streptomyces roseosporus NRRL
           15998]
          Length = 601

 Score =  478 bits (1231), Expect = e-132,   Method: Composition-based stats.
 Identities = 212/590 (35%), Positives = 313/590 (53%), Gaps = 44/590 (7%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
            +L++A+ Q++  VGD+AGN          A  QG  L+ F E+ ++GYP EDL  + SF
Sbjct: 19  PQLRLALNQIDSTVGDLAGNSEAIVHWTRHAAEQGAHLVAFPEMVLTGYPVEDLALRSSF 78

Query: 63  IQACSSAIDTLKSDTHDGG---AGIVVGFPRQDQ----------EGVLNSVVILDAGNII 109
           ++A   A+  L +     G     +VVG+  + +              N+  +L  G I 
Sbjct: 79  VEASRQALRALAARLDTEGFGELPVVVGYLDRSEHAAARYGQPAGSPRNAAAVLHRGGIA 138

Query: 110 AVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAE 169
               K +LPNY  F E R F+ G S   +    I + + ICED+W++       +  GA 
Sbjct: 139 LNFAKHHLPNYGVFDEFRYFVPGDSMPVVRVHGIDVALAICEDLWQDGGRVPAARSAGAG 198

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            L S+NASPY  +K   R E+V  +         Y+  +GGQDEL+FDG S   D + ++
Sbjct: 199 LLLSINASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDKEGEV 258

Query: 230 AFQMKHFSEQNFMTEWHY------------DQQLSQWNYMSDDSASTMYIP--------- 268
             +   FSE + + +               D  L   + +  D     Y P         
Sbjct: 259 IARAPQFSEGSVILDLELPAAAAVAPSGVVDDGLRIDHVVISDEPVAAYEPELAGGYAER 318

Query: 269 LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPY 328
           L++EE  Y+A V+ LR Y  KN F  V+IGLSGGIDSA+CAAIA DALG +NV  + +P 
Sbjct: 319 LEDEEEIYSALVVGLRAYAAKNGFSSVLIGLSGGIDSAICAAIACDALGAQNVYGVSMPS 378

Query: 329 KYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRG 388
           KY+S  S +DAA  A+  G  +  +PI  + + +   +      + +G+  EN+Q+R+RG
Sbjct: 379 KYSSGHSKDDAAELARRTGLNFRTVPIAPMFDAYMESL------QLTGLAEENLQARLRG 432

Query: 389 NILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHG 448
             LMA+SN    ++L   NKSE++VGY TLYGD  G + P+KD+YK+ VF+LA WRN   
Sbjct: 433 TTLMAISNQEGQIVLAPGNKSELAVGYSTLYGDAVGAYGPIKDVYKSSVFRLAKWRNRAA 492

Query: 449 ITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-D 507
              G  P    IP + + K PSAELRP Q D +SLP Y +LD I++  V+ ++       
Sbjct: 493 EERGQTP---PIPEASITKPPSAELRPGQVDTDSLPDYEVLDAILELYVDRDQGMDAIVA 549

Query: 508 QEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
             ++ E V     ++  +EYKRRQ P GTKI+ K FG+DR  PI+N++R+
Sbjct: 550 AGFDAELVAKTLRMVDTAEYKRRQYPPGTKISPKGFGKDRRLPITNRWRE 599


>gi|89070087|ref|ZP_01157417.1| NAD(+) synthase [Oceanicola granulosus HTCC2516]
 gi|89044308|gb|EAR50451.1| NAD(+) synthase [Oceanicola granulosus HTCC2516]
          Length = 552

 Score =  478 bits (1230), Expect = e-132,   Method: Composition-based stats.
 Identities = 233/558 (41%), Positives = 333/558 (59%), Gaps = 9/558 (1%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M ++ ++ IAQ NP VGD+AGN A+AR A E     G  +++  E+F++GY  +DLV K 
Sbjct: 1   MSERFRLTIAQANPTVGDLAGNAARARAAWEAGRAAGAQMVVLPEMFLAGYQTQDLVQKP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           +F+  C   ++TL     D G  + +G P  +   + N   IL  G + A   K +LPNY
Sbjct: 61  AFVADCQRHLETLAEACAD-GPALGIGAPVIEGTALYNGYFILCNGRVHAAMRKFHLPNY 119

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           + F E+R +  G  + P     +R+G  ICED W      + + + GAE L   N SPY+
Sbjct: 120 TVFDEERLYEHGSFSGPYEVAGVRIGTPICEDAWYPDV-AETMVESGAEILVVPNGSPYF 178

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R   +  ++    +P++Y+N VG QD+ +FDGASF  +    LA ++  F E  
Sbjct: 179 REKFDVRLNRMVARVVENDVPLVYLNLVGAQDDQVFDGASFVLNRHGALALRLPAFEEA- 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +    + +  + W     + A          E DY+A VLSL DY++K  F KV++GLS
Sbjct: 238 -VAHVDFARTDAGWRAEPGEIAPLP----DSLEQDYHAMVLSLSDYMRKTGFGKVLLGLS 292

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+ A +A DALG ENV+ +MLP +YTS  SLEDA A A  LGC+YD +PI  + +
Sbjct: 293 GGIDSAIVATVAADALGPENVRCVMLPSEYTSETSLEDARAVAANLGCRYDFVPITRVRD 352

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++   +     +  EN+QSRIRG +LMA SN    MLLTT NKSE++VGY T+YG
Sbjct: 353 AVTETLAPLFEGLAEDLTEENVQSRIRGLLLMAQSNKFGEMLLTTGNKSEVAVGYATIYG 412

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GG+NP+KDLYKT+VF L  WRN++       P  EVIP  +++K PSAELR  Q D+
Sbjct: 413 DMAGGYNPIKDLYKTRVFALCRWRNANHRPWMAAPAGEVIPVRVIDKPPSAELRADQKDE 472

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I+K +V+ + S  +     Y  ETV+ VE L+Y SEYKR Q+  GT+++
Sbjct: 473 DSLPPYDVLDGILKLLVDEDSSVADCVAAGYERETVKRVEQLIYISEYKRFQSAPGTRLS 532

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++F  DR YPI N++RD
Sbjct: 533 MRAFWLDRRYPIVNRWRD 550


>gi|93005127|ref|YP_579564.1| NAD+ synthetase [Psychrobacter cryohalolentis K5]
 gi|92392805|gb|ABE74080.1| NAD+ synthetase [Psychrobacter cryohalolentis K5]
          Length = 567

 Score =  478 bits (1230), Expect = e-132,   Method: Composition-based stats.
 Identities = 229/555 (41%), Positives = 323/555 (58%), Gaps = 19/555 (3%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
             +  A+AQ + +VGDI  N  K R    +A  QG D+I+F EL + GYPP+DL+ + S 
Sbjct: 28  DSVTFALAQSHFLVGDIKANAEKMRTLALQAREQGADVIIFPELALLGYPPQDLLLRPSL 87

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
                SA+ TL          ++VG+P  D  G  NS  IL  G+      K  LPNY  
Sbjct: 88  SGRIKSALSTLSDI---DDIVMIVGYPHVDHHGTFNSAAILHNGHQKGFYHKQILPNYGV 144

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F E+R F  G +     ++ I +G+LICED+W+   I + LKKQGA+ + SLNASP+   
Sbjct: 145 FDERRYFDKGRNQVLFDYKGITIGLLICEDLWEKGPIAE-LKKQGADLIVSLNASPFEIE 203

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K   R  ++  +    +LPI+Y+N VGGQD+L+FDG S        +A +   F  Q  +
Sbjct: 204 KQDTRKTMLAKRSRENNLPIVYLNAVGGQDDLVFDGGSMAIQADGSVAHEASRFMNQLLL 263

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
             +              D+ +   + L  E   Y A V+ LRDYV  + F  +I+GLSGG
Sbjct: 264 ASFDAKT-------AKFDTQAKAPLSLSRESEMYQALVVGLRDYVNLSGFTGIIVGLSGG 316

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL   IAVDALG + V  +M+PY+YTS  SLEDA A A+ L   Y V PI D V   
Sbjct: 317 IDSALTLCIAVDALGADKVYAVMMPYEYTSQISLEDAQAQARRLNVSYTVCPIFDAVEGI 376

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
              ++    + P+    ENIQ+R RG +LMALSN    +++TT NKSE++VGY TLYGDM
Sbjct: 377 RHTLAPLFNKSPADTTEENIQARARGVVLMALSNKFGHLVITTGNKSELAVGYSTLYGDM 436

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF+ LKD+YK+QV++LAS+RN           T VIP  ++ + PSAELRP Q DQ+S
Sbjct: 437 AGGFDVLKDVYKSQVYKLASYRNRL-------EDTPVIPERVITRPPSAELRPDQKDQDS 489

Query: 483 LPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LP Y +LD I+   ++ +  + +  ++ ++ + V  V  ++  SEYKR QAP+GTKI+ K
Sbjct: 490 LPDYDVLDGILMSYIDEDMGYQDIINKGFDADLVAKVIQMVDNSEYKRSQAPIGTKISHK 549

Query: 542 SFGRDRLYPISNKFR 556
           +FGR+R YP+ NK+ 
Sbjct: 550 AFGRERRYPLVNKWS 564


>gi|170691912|ref|ZP_02883076.1| NAD+ synthetase [Burkholderia graminis C4D1M]
 gi|170143196|gb|EDT11360.1| NAD+ synthetase [Burkholderia graminis C4D1M]
          Length = 591

 Score =  478 bits (1230), Expect = e-132,   Method: Composition-based stats.
 Identities = 227/597 (38%), Positives = 327/597 (54%), Gaps = 44/597 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +K  +IA+AQ+N  VGD AGN+AK   A  +A+  G  L++  EL +SGYPPEDL+ + +
Sbjct: 1   MKT-RIALAQINVTVGDFAGNVAKIVAAARDAHSAGAKLLVAPELALSGYPPEDLLLRPA 59

Query: 62  FIQACSSAIDTLKSDTHD-GGAGIVVGFPRQDQE-------------------------G 95
           F  A ++A+  L        G  ++VG P +D                            
Sbjct: 60  FYTASAAALADLAQQLKQFAGLHVIVGHPLRDAADSVANSAASGHGNANAPIQRGVPPVD 119

Query: 96  VLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWK 155
             N+  ++  G I     K +LPN   F EKR F S           ++ G++ICED W 
Sbjct: 120 TFNAASLVVDGRIAGTYRKQDLPNTEVFDEKRYFASDAQPFVFELDGVKYGVVICEDAWH 179

Query: 156 NSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELI 215
            S      K  GA+ L   N SP++ NK   R +I+  +I    LP++YVN VG QDEL+
Sbjct: 180 ASAAQ-MAKAAGAQVLLIPNGSPFHLNKEAVRFDILRARIRETGLPMVYVNMVGAQDELV 238

Query: 216 FDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMY--------- 266
           FDG SF  D Q +L  +M  F E     E+     L      +  + + ++         
Sbjct: 239 FDGGSFVLDAQGELVAKMPQFEEATAFVEFENAVPLRGHGGEAKANDAQLFSGATGANPA 298

Query: 267 --IPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTI 324
               L  E   Y A V+ +RDYV KN F   +IGLSGG+DSAL  A+A DALG + V+ +
Sbjct: 299 IAPELSLEAQVYAALVMGVRDYVNKNGFPGALIGLSGGVDSALVLAVACDALGADRVRAV 358

Query: 325 MLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQS 384
           M+P +YT+  S  DAA  A+ +G +YD + I  + + F S ++Q  +  P     ENIQ+
Sbjct: 359 MMPSRYTADISTTDAAEMARRVGVRYDEIAIAPMFDAFRSSLAQEFEGRPEDATEENIQA 418

Query: 385 RIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWR 444
           RIRG +LMALSN   +++LTT NKSE++VGY TLYGDM+GGF  +KD+ KT V++L  +R
Sbjct: 419 RIRGTLLMALSNKFGSIVLTTGNKSEMAVGYCTLYGDMAGGFAVIKDIAKTLVYRLCHYR 478

Query: 445 NSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFI 504
           N             VIP  IL ++PSAELR +QTDQ+SLPPY +LD I++  +E + S  
Sbjct: 479 NQATAFGT----QNVIPERILTRAPSAELRENQTDQDSLPPYDVLDAIMRMYMEEDRSLA 534

Query: 505 N-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHIS 560
                 Y  E V+ V  L+  +EYKRRQAP+G ++T ++FGRD  YPI++++ + + 
Sbjct: 535 EIIAAGYAVEDVKRVTRLIKINEYKRRQAPIGIRVTHRAFGRDWRYPITSRYTEPVE 591


>gi|91776238|ref|YP_545994.1| NH(3)-dependent NAD(+) synthetase [Methylobacillus flagellatus KT]
 gi|91710225|gb|ABE50153.1| NH(3)-dependent NAD(+) synthetase [Methylobacillus flagellatus KT]
          Length = 535

 Score =  478 bits (1230), Expect = e-132,   Method: Composition-based stats.
 Identities = 235/553 (42%), Positives = 314/553 (56%), Gaps = 24/553 (4%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQ+N   GD+ GN AK       A   G  L+L  EL +SGY PEDL+ +  F  
Sbjct: 1   MKIAIAQINATAGDLTGNAAKIVEQARRAEAAGATLLLCPELALSGYSPEDLLLRDDFYH 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFH 124
           AC  A+  L  +       +VVG PR+      N+  +L+AG I     K  LPN S F 
Sbjct: 61  ACERALYALAQELPAT-LTVVVGHPRKYLGNRYNAASVLEAGRICHTYHKALLPNDSVFD 119

Query: 125 EKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKL 184
           E R F  G     I     +LGI+IC D+W      +  +  GA  L  LNASPY+  K 
Sbjct: 120 EVRYFSEGSEALVINHLGCKLGIVICADVW-APEPARRARDAGATVLLVLNASPYHIGKQ 178

Query: 185 KKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTE 244
           ++R+ +V  +I    LP++Y N VGGQDEL+FDGASF  + +  L  Q+  F E   +  
Sbjct: 179 QERYAVVRDRIKETGLPVVYANLVGGQDELVFDGASFVMNDEGALTQQLPSFDEALGIVS 238

Query: 245 WHYDQQLSQWNYMSDDSASTMYIPLQEEE-ADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
           +                      PL   E A Y A  L  RDYV KNNF  V++GLSGGI
Sbjct: 239 F-----------SDGAPEPAEIHPLPGLEPAVYQALSLGFRDYVLKNNFPGVLLGLSGGI 287

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL  AIAVDALG   VQ +M+P  +T+  SLEDA A A  L  +Y  + I  +   F 
Sbjct: 288 DSALTLAIAVDALGAGKVQAVMMPSAFTASISLEDAQAMAAGLNVRYSEIAIGPVFESFC 347

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           + ++      P     EN+Q+RIRG +LMALSN   +M++TT NKSE +VGY TLYGDM+
Sbjct: 348 AALAPEFAGRPFDTAEENLQARIRGTLLMALSNKFGSMVVTTGNKSETAVGYSTLYGDMA 407

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF  LKD+ KT V+QLA +RN+         +++VIP  I+ + PSAELR  QTDQ+SL
Sbjct: 408 GGFALLKDVSKTLVYQLAKYRNT---------ISQVIPERIILRPPSAELRHGQTDQDSL 458

Query: 484 PPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           P Y +LD I++  VEN+ S+       Y ++ V  V  L+  +EYKRRQAP+G ++T + 
Sbjct: 459 PDYAVLDGIMEAYVENDYSWEEILALGYREQDVLRVTRLVDRNEYKRRQAPIGVRVTKRG 518

Query: 543 FGRDRLYPISNKF 555
           FG+DR YP++NKF
Sbjct: 519 FGKDRRYPLTNKF 531


>gi|289577867|ref|YP_003476494.1| NAD+ synthetase [Thermoanaerobacter italicus Ab9]
 gi|289527580|gb|ADD01932.1| NAD+ synthetase [Thermoanaerobacter italicus Ab9]
          Length = 543

 Score =  478 bits (1229), Expect = e-132,   Method: Composition-based stats.
 Identities = 221/564 (39%), Positives = 319/564 (56%), Gaps = 34/564 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQ+NPVVGDI GN  K       A  Q  DL++F EL   GYPP+D +F + F++
Sbjct: 1   MKIALAQINPVVGDIKGNFEKIVEFINRAKYQKADLVVFPELATVGYPPKDFLFMQDFLK 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQD-QEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           A    ++ +         G+++G  RQD +  + NS   +  G I+ V DK  LPNY  F
Sbjct: 61  ANEKYVNEIV-LPATYQIGVILGTVRQDTEGNLYNSAFFIYDGKIVEVFDKTLLPNYDVF 119

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNI----------CKHLKKQGAEFLFS 173
            EKR F          F+ I+LG+ ICEDIWK+              +   K   +   +
Sbjct: 120 DEKRYFKPAQLRKVASFKGIKLGVNICEDIWKDYVFEPNVDYSVDVLEEQHKLKPDIFIN 179

Query: 174 LNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQM 233
           ++ASPYY  K   R E++  +I    +P IYVNQVG  DELIFDG+SF  + + +   Q+
Sbjct: 180 ISASPYYLGKQNMRVEMIEKKIKKYAIPFIYVNQVGANDELIFDGSSFVVNEEGKRVVQL 239

Query: 234 KHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFH 293
           K F E   + +    +   +   M            ++    YNA VL +RDY +K+ F 
Sbjct: 240 KAFEEDIKIVDIDELKNFKELPEMK-----------EDISWVYNALVLGVRDYCKKSGFK 288

Query: 294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVL 353
           K ++GLSGGIDSA+  AIAV+ALGKENV  + +P +Y+S  S  DA   A  LG ++ V+
Sbjct: 289 KAVVGLSGGIDSAVVCAIAVEALGKENVFAVSMPSRYSSEGSKSDARILADNLGIEFRVI 348

Query: 354 PIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISV 413
           PI  +   + S+ +         +  ENIQ+RIRGN LM +SN    ++LTT NKSE+++
Sbjct: 349 PIEPVFESYLSVFN-GDNSAIGDLAEENIQARIRGNYLMFISNREGHIVLTTGNKSELAM 407

Query: 414 GYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAEL 473
           GY TLYGDMSG   P+ D+ KT V++LA + N            E+IP SI+EK+PSAEL
Sbjct: 408 GYCTLYGDMSGSLAPIADVPKTMVYELAKYINRK---------KEIIPISIIEKAPSAEL 458

Query: 474 RPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQA 532
           RP+Q D++SLPPY +LD+I+K  +E   S     ++ Y+++ V+ V + +   EYKR+QA
Sbjct: 459 RPNQKDEDSLPPYKVLDEILKMYIEENRSVKEIVEKGYDEKLVKDVINKVNRVEYKRKQA 518

Query: 533 PVGTKITAKSFGRDRLYPISNKFR 556
               K+T K+FG  R  PI + F+
Sbjct: 519 APVLKVTTKAFGIGRRMPIVHNFK 542


>gi|116754039|ref|YP_843157.1| NAD+ synthetase [Methanosaeta thermophila PT]
 gi|116665490|gb|ABK14517.1| NH(3)-dependent NAD(+) synthetase [Methanosaeta thermophila PT]
          Length = 567

 Score =  478 bits (1229), Expect = e-132,   Method: Composition-based stats.
 Identities = 202/562 (35%), Positives = 300/562 (53%), Gaps = 38/562 (6%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFI 63
            +++A+ Q+N  VGD+ GN +  R+A E       DL +  E+ + GYPP DL+    F+
Sbjct: 28  TMRVALLQINTTVGDLEGNASLIRKAVE---SLDADLAVTPEMALVGYPPRDLLLMPGFV 84

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPR----QDQEGVLNSVVILDAGNIIAVRDKINLPN 119
           +     +  L  D  D    ++VG P     +    + NS  +L  G++  +  K  LP 
Sbjct: 85  KNAWDVLTRLALDLED-SPPMLVGIPEPNRSETGRPLFNSAALLADGSVKQIFRKTLLPT 143

Query: 120 YSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA--------EFL 171
           Y  F E R F        +  +    GI ICEDIW + +I +  +            +  
Sbjct: 144 YDVFDEDRYFEPASGPQMLNLKGRTFGISICEDIWNDRDIFRRRRYHRDPLEDLRGADCF 203

Query: 172 FSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAF 231
            +++ASP+   K  KR  +++       +P+IYVNQVGG D+L+FDG S  F    +L  
Sbjct: 204 INMSASPFTAGKHLKREMMLSSIARKYGVPLIYVNQVGGNDDLVFDGRSCAFSPSGELIA 263

Query: 232 QMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNN 291
           +   F E   + +                S S        E   + A VL  RDYV+K  
Sbjct: 264 RAAAFEEDVLIVDID------------SCSGSVSRDDFSPESEIWRALVLGTRDYVRKCG 311

Query: 292 FHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYD 351
           F   +IGLSGG+DS+L AAIA +ALG ENV  +++P  YTS +S+EDA   A+ L  +  
Sbjct: 312 FRSAVIGLSGGVDSSLTAAIAAEALGPENVIGVLMPSPYTSRESMEDALELARNLSIQTI 371

Query: 352 VLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEI 411
            +PI +++  +   +    +     +  ENIQ+RIRGN+LMALSN    ++L+T NKSE+
Sbjct: 372 TIPISEIMAAYERTLEPIFRGVEKDVTEENIQARIRGNLLMALSNKFGHIVLSTGNKSEL 431

Query: 412 SVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSA 471
           +VGY T+YGDMSGGF  L D+ KT V+++A W N  G          VIP S+LEK+PSA
Sbjct: 432 AVGYCTIYGDMSGGFAVLSDVPKTMVYRMARWINMRGP---------VIPQSVLEKAPSA 482

Query: 472 ELRPHQTDQESLPPYPILDDIIKRIVENEESFINND-QEYNDETVRYVEHLLYGSEYKRR 530
           ELRP Q DQ++LPPY  LD+I+ R +E  +S        ++ + VRYV  ++  +E+KR+
Sbjct: 483 ELRPGQRDQDTLPPYETLDEILHRHIEQRQSEEEIVSAGFDQKMVRYVLKMVKTAEFKRK 542

Query: 531 QAPVGTKITAKSFGRDRLYPIS 552
           QAP G K+T ++FG     PI+
Sbjct: 543 QAPPGIKVTDRAFGSGWRMPIA 564


>gi|329934914|ref|ZP_08284955.1| carbon-nitrogen ligase [Streptomyces griseoaurantiacus M045]
 gi|329305736|gb|EGG49592.1| carbon-nitrogen ligase [Streptomyces griseoaurantiacus M045]
          Length = 586

 Score =  478 bits (1229), Expect = e-132,   Method: Composition-based stats.
 Identities = 209/594 (35%), Positives = 311/594 (52%), Gaps = 46/594 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+ Q++  VGD++GN+    R   E   +G  L+ F E+ ++GYP EDL  + S
Sbjct: 1   MPQLRLALNQIDSTVGDLSGNVEAVLRRTRECAERGAHLVAFPEMVLTGYPVEDLALRSS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAG---IVVGFPRQDQ----------EGVLNSVVILDAGNI 108
           F++A  +A+  L       G G   ++VG+  + +              N+  +L  G I
Sbjct: 61  FVEASRAAVRELAVRLAAEGLGELPVLVGYLDRSESAQPKYGQPAGTPRNAAAVLYRGRI 120

Query: 109 IAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGA 168
                K +LPNY  F E R F+ G +   +    + + + ICED+W++       +   A
Sbjct: 121 ALRFAKHHLPNYGVFDEFRYFVPGDTMPVLRLHGVDIALAICEDLWQDGGRVPAARSSRA 180

Query: 169 EFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQ 228
             L S+NASPY  +K   R E+V  +         Y+   GGQDEL+FDG +   D + +
Sbjct: 181 GLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMTGGQDELVFDGDTIVVDREGE 240

Query: 229 LAFQMKHFSEQNFMTEWH--------------YDQQLSQWNYMSDDSASTMYIP------ 268
           +  +   F E   + +                 D  L     +  +     Y P      
Sbjct: 241 VVSRAPQFQECAVLLDLDLPGVSAEAPDDGAVLDDGLRVERLVVSEEPLPAYEPELTGGY 300

Query: 269 ---LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIM 325
              L+++E  Y+A V  LR Y +KN F  V+IGLSGGIDSAL AAIA DA+G ENV  + 
Sbjct: 301 ADRLEDDEEIYSALVTGLRAYARKNGFRSVLIGLSGGIDSALVAAIACDAVGPENVYGVS 360

Query: 326 LPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSR 385
           +P KY+S  S  DAA  A+  G  +  + I  + + + +        E +G+  EN+QSR
Sbjct: 361 MPSKYSSEHSRGDAAELARRTGLNFRTISIAPMFDAYMAST------ELTGLAEENLQSR 414

Query: 386 IRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRN 445
           +RG +LMA+SN    ++L   NKSE++VGY TLYGD  G + P+KD+YKT VF+LA WRN
Sbjct: 415 LRGTLLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTTVFELARWRN 474

Query: 446 SHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN 505
                 G  P    IP + + K PSAELRP Q D +SLP YP+LD I+ R V+ ++    
Sbjct: 475 RAAAERGETP---PIPENSISKPPSAELRPGQVDTDSLPDYPVLDAILARYVDRDQGADE 531

Query: 506 N-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
             +  +  E V     ++  +EYKRRQ P GTKI+AK FG+DR  PI+N +R+ 
Sbjct: 532 IVEAGFERELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNAWRER 585


>gi|330469435|ref|YP_004407178.1| NAD+ synthetase [Verrucosispora maris AB-18-032]
 gi|328812406|gb|AEB46578.1| NAD+ synthetase [Verrucosispora maris AB-18-032]
          Length = 588

 Score =  477 bits (1228), Expect = e-132,   Method: Composition-based stats.
 Identities = 221/595 (37%), Positives = 313/595 (52%), Gaps = 48/595 (8%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  L++A+ Q+NP VGD+ GN    R     A   G  L+LF E+ ++GYP EDLVF++S
Sbjct: 1   MPTLRLALCQVNPSVGDLTGNADIVRAWSRRAADAGAQLVLFPEMVLTGYPVEDLVFRRS 60

Query: 62  FIQACSSAIDTLKSDTHDGG---AGIVVGFPRQD-----------QEGVLNSVVILDAGN 107
           F+ A  +A+D L +D    G     IVVG+   D             G  N+  +L  G 
Sbjct: 61  FVAASKAALDRLATDLAADGLGAVPIVVGYLDADGPPQVSGDAEPGRGARNAAALLHRGE 120

Query: 108 IIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG 167
           +     K +LPNY  F E R F+ G +   +    + + + ICED+W+        ++  
Sbjct: 121 VRITYFKHHLPNYGVFDEDRYFVPGDTLTVVRLGGVDVALTICEDLWQAGGPFAAARQAD 180

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
              + S+N SPY  NK   R  +V  + +     I YVN VGGQDEL+F+G S       
Sbjct: 181 VGLVVSINGSPYELNKDDLRLPVVRRRAAESQATIAYVNMVGGQDELVFEGDSMIVAPDG 240

Query: 228 QLAFQMKHFSEQNFMTEW------------HYDQQLSQWNYMSDDSASTMYIPL------ 269
            L  +   F E   + +               D+       +          P       
Sbjct: 241 TLLARAPQFVEHLLVHDVQVPPAVDASEVADGDRVGDGLRLVRRTVEGLPPTPDGPAALG 300

Query: 270 ------QEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQT 323
                  +E   + A VL LRDYV KN F  V++GLSGGIDSA+ AAIAVDALG + V  
Sbjct: 301 GVIEPVADEAEVWQALVLGLRDYVNKNRFPSVVLGLSGGIDSAVVAAIAVDALGPDRVVG 360

Query: 324 IMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQ 383
           + LP +++S  S EDAA  AK  G  Y + PI  +V+ F + +S       SG+  EN+Q
Sbjct: 361 VSLPSQHSSEHSREDAADLAKRTGLDYRIEPIQPMVDTFLANLS------LSGVAVENLQ 414

Query: 384 SRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASW 443
           +R+RG ILMALSN    ++LTT NKSE++VGY TLYGD  GGFNP+KD++KT V++LA W
Sbjct: 415 ARVRGVILMALSNQEGHLVLTTGNKSELAVGYSTLYGDSVGGFNPIKDVWKTLVWRLAKW 474

Query: 444 RNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESF 503
           RN+     G  P    IP + + K PSAEL P Q D ++LP Y +LD I+   V+ +   
Sbjct: 475 RNAEAARLGGTP---PIPENSIGKPPSAELSPGQLDSDTLPDYDVLDPILIGYVDGDLGR 531

Query: 504 INNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
                  ++   V  V  ++  +EYKRRQ+  GTKI+ K+FGRDR  PI+N++R+
Sbjct: 532 DGLVASGHDAAVVDKVLRMVDTAEYKRRQSAPGTKISMKAFGRDRRLPITNRWRE 586


>gi|294790940|ref|ZP_06756098.1| NAD+ synthetase [Scardovia inopinata F0304]
 gi|294458837|gb|EFG27190.1| NAD+ synthetase [Scardovia inopinata F0304]
          Length = 560

 Score =  477 bits (1228), Expect = e-132,   Method: Composition-based stats.
 Identities = 224/555 (40%), Positives = 313/555 (56%), Gaps = 26/555 (4%)

Query: 8   AIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACS 67
           A+AQ++  VGDI GN  K       A++QG D++LF E+ ++GYP EDL F+ +F +A  
Sbjct: 27  ALAQIDTCVGDIEGNARKIIDFSRMAHQQGADIVLFPEMTLTGYPIEDLAFRATFRKAAY 86

Query: 68  SAIDTLKSDTHDGG---AGIVVGFPRQD-QEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
              D +     D G     +V+G    D      N ++IL  G + A  DK  LPNY  F
Sbjct: 87  RTADQVAVQLQDQGLGSLYVVIGTVGADVDGLPRNRLLILHNGRVEASYDKHFLPNYGVF 146

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E R F +G     +  +  R+G  ICEDIW+       L +   + L ++N SPY   K
Sbjct: 147 DEFRIFSAGQETLTLDIKGKRIGFAICEDIWQEGGTVAALAQDHIDVLATINGSPYEEGK 206

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
              R ++   +   VH P+IY+NQVGGQD+L+FDG SF      Q+  Q   F E   + 
Sbjct: 207 YHTRVDLCRKRAGQVHAPVIYLNQVGGQDDLVFDGGSFVVGTDGQILAQAGKFQESLLLW 266

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
                          + S + +  PL  +E  Y ACV  LRDY++KN+F  V++GLSGGI
Sbjct: 267 SL------------GNTSPTDLVSPLDPDEEVYQACVAGLRDYMRKNHFSGVVLGLSGGI 314

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL A+IA DA G +NV  I +P +Y+S  S +DAA  A+ LG  YD+ PI  L   F 
Sbjct: 315 DSALVASIAADACGGDNVWGISMPSRYSSDGSRDDAADLARRLGAHYDIQPIEPLFQSFQ 374

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
             +S        GI AEN+Q+RIRG I+MA SN    + L T NKSE++ GY T+YGD  
Sbjct: 375 QELS------LEGIAAENLQARIRGVIVMAYSNSHGLLALATGNKSELACGYSTIYGDAV 428

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF P+KDL KT+V+QLA WRN     +G  P    IP + + K+PSAELRP Q D +SL
Sbjct: 429 GGFAPIKDLLKTRVWQLARWRNRAAQEAGEVP---PIPENSINKAPSAELRPGQKDSDSL 485

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           P Y +LD ++   +E      +  +  ++ +TV  V  L+  +E+KRRQ P+G K+TA +
Sbjct: 486 PEYAVLDQVLAAYIEKAHGRQDLLNDGFDPKTVDTVMRLVDKAEWKRRQYPLGPKVTALA 545

Query: 543 FGRDRLYPISNKFRD 557
           FGRDR  P+++ FR+
Sbjct: 546 FGRDRRLPVTSAFRE 560


>gi|254521078|ref|ZP_05133133.1| NAD(+) synthase [Stenotrophomonas sp. SKA14]
 gi|219718669|gb|EED37194.1| NAD(+) synthase [Stenotrophomonas sp. SKA14]
          Length = 544

 Score =  477 bits (1228), Expect = e-132,   Method: Composition-based stats.
 Identities = 212/559 (37%), Positives = 309/559 (55%), Gaps = 20/559 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKK 60
           +  ++IA+AQ +  VGD+AGN  +      +A  + G +L++F EL +SGYPPEDL+ + 
Sbjct: 1   MASIRIAMAQFDFPVGDVAGNTERIIEMIGQARDEYGAELVMFPELAVSGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F+  C  A+  + +     G   VVG+P+     V N+  +L  G +     K  LPNY
Sbjct: 61  GFLYECEQAMGRIAAACR--GITAVVGWPQAAGAVVYNAASVLRDGLVEQTYRKRELPNY 118

Query: 121 SEFHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           + F E+R F       +       + +G+LICED+W    +     + GA+ +   NASP
Sbjct: 119 AVFDERRYFDVDPDGGSCVFEVNGVPVGLLICEDLWFAEPLADT-VRAGAQLVVVPNASP 177

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      F +
Sbjct: 178 YERGKHAQRDAVLAARTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAAFVD 237

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
           Q  + ++    +    +   DD   +M      +   + A    ++DY +KN F KV +G
Sbjct: 238 QWLVVDYDGQSRRFLPHVWMDDGDESM------DALAWRAVTRGIQDYCRKNGFKKVWLG 291

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL  A+AVDA+G ENV  + LP +YT+  S + AA   +ALG K D + I   
Sbjct: 292 LSGGIDSALVLAMAVDAMGAENVTAVRLPSRYTAGLSNDLAAEQCQALGVKLDAVSIEPA 351

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
                  ++   +     +  EN+QSR RG ILMAL+N    +LLTT NKSE +VGY T+
Sbjct: 352 FKGLMESLAPMFEGTTPDVTEENLQSRSRGVILMALANKFGGLLLTTGNKSEYAVGYATI 411

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM GG+ PLKDLYKT+VF L+ WRN+ G          VIPP+++ + PSAELR +Q 
Sbjct: 412 YGDMCGGYAPLKDLYKTEVFGLSKWRNTVGGA-------PVIPPAVISRPPSAELRENQL 464

Query: 479 DQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLP Y +LD I+ R ++ E+S        Y+   V  V  L+  SE+KR QA  G K
Sbjct: 465 DQDSLPAYDVLDGILYRYIDQEQSRGEIVAAGYDAAVVDRVLRLVRISEWKRHQAAPGPK 524

Query: 538 ITAKSFGRDRLYPISNKFR 556
           ++ ++FGR+R YPISN ++
Sbjct: 525 VSRRAFGRERRYPISNGYK 543


>gi|311742909|ref|ZP_07716717.1| NAD synthetase [Aeromicrobium marinum DSM 15272]
 gi|311313589|gb|EFQ83498.1| NAD synthetase [Aeromicrobium marinum DSM 15272]
          Length = 623

 Score =  477 bits (1227), Expect = e-132,   Method: Composition-based stats.
 Identities = 204/597 (34%), Positives = 294/597 (49%), Gaps = 50/597 (8%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
            +L++A+AQ+N VVG I  N+         A+  G  L++  E+ ++GYP ED+ ++ +F
Sbjct: 37  PQLRLALAQINAVVGAIDTNVELVLEQCRRAHAAGAHLVVTPEMVLTGYPIEDMAYRATF 96

Query: 63  IQACSSAIDTLKSDTHDGGA---GIVVGF------------PRQDQ---EGVLNSVVILD 104
           I A   A+  L +     G     +VVG             P +         NS  ++ 
Sbjct: 97  ITASQRAVAELAARLEADGLGELVVVVGHLDSAKPPTLEAVPDRLGVPKNAPTNSASVIT 156

Query: 105 AGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLK 164
            G I+   DK +LPNY  F E R F++G     +    + + I ICEDIW         +
Sbjct: 157 GGRIVTRYDKHHLPNYGVFDEFRHFVAGDETQVVQVGGVDVAIAICEDIW-QDGPSAAAR 215

Query: 165 KQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFD 224
              A  L  LN SPY   K   R E+   +       + YVN VGGQDEL+FDG +   D
Sbjct: 216 AAEAGLLVVLNGSPYEAAKDDVRLELCARRAREGECAVAYVNLVGGQDELVFDGDTLVVD 275

Query: 225 GQQQLAFQMKHFSEQNFMTEWHYD---------QQLSQWNYMSDDSASTMYIPL------ 269
              +L  +   F     + +             +       +     ++  +P       
Sbjct: 276 AGGELLARAPQFETDLLVVDLDLPAATAPMPDPETRFHGLRVERHVVTSEPVPAFDPRPS 335

Query: 270 ------QEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQT 323
                  +    Y A VL LRDYV KN F  V++GLSGGIDS L  AIAVDALG + V  
Sbjct: 336 AIADRWDDLGERYQAVVLGLRDYVAKNGFTSVLMGLSGGIDSTLVGAIAVDALGADRVFG 395

Query: 324 IMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQ 383
           +  P  ++S  S  DAA  A+  G   D +PI  + +   + +S        G+  EN+Q
Sbjct: 396 VSNPSDWSSEHSRSDAAELARRTGLHLDTVPISPVFDALQAQLS------LDGLAEENLQ 449

Query: 384 SRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASW 443
           +RIR  I M LSN    ++L   NKSE++ GY T+YGD  GG+ P+KDL KT V+ LA W
Sbjct: 450 ARIRAVIWMGLSNQHGHLVLACGNKSELATGYSTIYGDAVGGYAPIKDLPKTLVWDLARW 509

Query: 444 RNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESF 503
           RN+     G  P    IP   + K PSAELRP Q D +SLPPY +LD I+   VE +   
Sbjct: 510 RNAWSTERGETP---PIPEDTITKPPSAELRPGQLDTDSLPPYELLDAILDAYVERDLGA 566

Query: 504 IN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHI 559
               ++ ++ E V+ V  L+  +EYKRRQ P G K++ ++FGRDR  PI+N++R+ +
Sbjct: 567 TEVIEEGFDPELVQRVVTLVDRAEYKRRQYPPGPKVSRRNFGRDRRVPITNRWRESL 623


>gi|307327840|ref|ZP_07607023.1| NAD+ synthetase [Streptomyces violaceusniger Tu 4113]
 gi|306886552|gb|EFN17555.1| NAD+ synthetase [Streptomyces violaceusniger Tu 4113]
          Length = 584

 Score =  477 bits (1227), Expect = e-132,   Method: Composition-based stats.
 Identities = 204/592 (34%), Positives = 307/592 (51%), Gaps = 44/592 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L++A+ Q++  VGD+ GN          +  QG  L+ F E+ ++GYP EDL  + S
Sbjct: 1   MPQLRLALNQIDSTVGDLDGNTESILHWTRHSAEQGAHLVAFPEMVLTGYPVEDLALRSS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAG---IVVGFPRQDQE-GVL--------NSVVILDAGNII 109
           F++A  +A+ +L    +  G G   +VVG+  + +             N+  +L  G + 
Sbjct: 61  FVEASRAALHSLAERLNAEGLGELPVVVGYLDRSERARRYGQPAGSPQNAGAVLHRGTVA 120

Query: 110 AVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAE 169
               K +LPNY  F E R F+ G +   +    I + + ICED+W++          GA 
Sbjct: 121 LTFAKHHLPNYGVFDEFRYFVPGDTLPMVRVHGIDIALAICEDLWQDGGRVPASCSAGAG 180

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            L S+NASPY   K   R ++V  +         Y+  +GGQDEL+FDG S   D   ++
Sbjct: 181 LLLSINASPYEREKDDTRLDLVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEV 240

Query: 230 AFQMKHFSEQNFMTEWHY-------------DQQLSQWNYMSDDSASTMYIP-------- 268
             +   F+E   + +                D  L   +          Y P        
Sbjct: 241 IARAPQFAEGCVLLDLELPAADPDSVPEGVVDDGLRIDHVTLSADPLPGYEPELAGGEAE 300

Query: 269 -LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLP 327
            L ++E  Y A V+ LR Y  KN F  V+IGLSGGIDSAL AA+A DA+G +NV  + +P
Sbjct: 301 RLGDDEEVYTALVVGLRAYAAKNGFRSVLIGLSGGIDSALVAALACDAVGAQNVYGVAMP 360

Query: 328 YKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIR 387
            +Y+S  S+ DA   A+  G  +  + I  + + +   +      + +G+  EN+QSR+R
Sbjct: 361 SRYSSEHSVADATELARRTGLNFRTVSIAPMFDAYMDSL------QLTGLAEENLQSRLR 414

Query: 388 GNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSH 447
           G  LMA+SN    ++L   NKSE++ GY TLYGD  G + P+KD+YKT VF+LA WRN  
Sbjct: 415 GTTLMAISNQEGHIVLAPGNKSELACGYSTLYGDSVGAYGPIKDVYKTSVFRLAKWRNRA 474

Query: 448 GITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN- 506
               G  P    IP + + K PSAELRP Q D +SLP Y +LD I++  V+ ++   +  
Sbjct: 475 AEERGQTP---PIPENSISKPPSAELRPGQVDTDSLPDYEVLDRILELYVDRDQGRKDIV 531

Query: 507 DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDH 558
              Y+D  V  +  L+  +EYKRRQ P GTKI+AK FG+DR  PI+N++R+ 
Sbjct: 532 AAGYDDPLVTRILRLVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWRER 583


>gi|53804666|ref|YP_113448.1| NAD(+) synthetase [Methylococcus capsulatus str. Bath]
 gi|53758427|gb|AAU92718.1| NAD(+) synthetase [Methylococcus capsulatus str. Bath]
          Length = 539

 Score =  477 bits (1227), Expect = e-132,   Method: Composition-based stats.
 Identities = 228/554 (41%), Positives = 325/554 (58%), Gaps = 20/554 (3%)

Query: 4   KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSF 62
            L+IAIAQL+ +VGD+ GN  +   A   A  + G   ++F EL ++GYPP+DL+ +  F
Sbjct: 2   NLRIAIAQLDFLVGDVGGNADRVLAAAVRARDELGAHAVVFPELALAGYPPDDLILRPDF 61

Query: 63  IQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSE 122
           + A  +A+  L       G  ++VGFP +      NS  +L  G I  V  K  LPNY  
Sbjct: 62  LTAVETALKVLAERVR--GIDVIVGFPERHDGLPFNSAAVLRDGGIHKVYRKQILPNYGV 119

Query: 123 FHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHN 182
           F EKR F+ G +      R + +G+ ICED+W      +     GA  + +LNASP++  
Sbjct: 120 FDEKRHFLPGSAPCVFDLRGVPVGLTICEDVWFPGP-VEQAAAAGARLVLNLNASPFHVG 178

Query: 183 KLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFM 242
           K  +R  +V  +I+   +P++Y N VGGQDEL+FDG SF  D    L ++   F E    
Sbjct: 179 KSVEREHVVRERIAAARVPLVYTNLVGGQDELVFDGGSFVMDAAGGLVYRAPQFGETLDA 238

Query: 243 TEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGG 302
             +  D+         +  ++ +  P+ E E+ Y A V  +RDYV KN F   ++GLSGG
Sbjct: 239 VGFTVDED------GVNPLSARLVEPMGEVESVYAALVTGIRDYVGKNGFRGAVLGLSGG 292

Query: 303 IDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHF 362
           IDSAL  A+AVDALG + V+ +++P +YT+  S+EDA   A+ L   + ++PI  +   F
Sbjct: 293 IDSALTLALAVDALGADRVEAVLMPSRYTADISIEDARQEAETLAVAWHLIPIEPVFRSF 352

Query: 363 FSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDM 422
             L++      P+ +  ENIQ+R RG ILMALSN    +LLTT NKSE+SVGY TLYGDM
Sbjct: 353 LDLLAGPFAGAPADVTEENIQARCRGVILMALSNKQGRILLTTGNKSEMSVGYATLYGDM 412

Query: 423 SGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQES 482
           +GGF PLKD+ K  V++LA +RN+         ++ VIPP ++E+ PSAELRP Q D++S
Sbjct: 413 AGGFAPLKDVSKLLVYRLAEYRNA---------VSAVIPPRVIERPPSAELRPDQKDEDS 463

Query: 483 LPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAK 541
           LPPY +LD I+   VE + S        Y ++ VR V  L+  +EYKRRQAP G KIT +
Sbjct: 464 LPPYAVLDPILALYVEQDRSIAEIVAAGYPEDVVRRVVRLVDRNEYKRRQAPPGIKITRR 523

Query: 542 SFGRDRLYPISNKF 555
           +FGR+R YPI+  F
Sbjct: 524 AFGRERRYPITCGF 537


>gi|88707054|ref|ZP_01104750.1| glutamine-dependent NAD+ synthetase [Congregibacter litoralis KT71]
 gi|88698704|gb|EAQ95827.1| glutamine-dependent NAD+ synthetase [Congregibacter litoralis KT71]
          Length = 540

 Score =  476 bits (1226), Expect = e-132,   Method: Composition-based stats.
 Identities = 214/554 (38%), Positives = 316/554 (57%), Gaps = 19/554 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEA-NRQGMDLILFTELFISGYPPEDLVFKKSFI 63
           + I +AQ+N  VGD  GN  +      +A   Q   +++F EL +SGYPPEDL+ + +  
Sbjct: 1   MHILMAQINTQVGDFTGNADQVIEVATQACEEQDSPVVVFPELTLSGYPPEDLLLRPALC 60

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
           +  + AI  L  +     A ++VG+P + +  + N   +   G + A   K  LPNY  F
Sbjct: 61  KRVNDAIIRLHRELP-PQAWVIVGYPIRREGLLYNCAGVFHDGELKAEYRKNELPNYQVF 119

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            EKR F +G     +  +  R+G+ ICEDIW +          GAE L +LNASP++  K
Sbjct: 120 DEKRYFTAGSEPCVLEIQGTRVGLSICEDIWVSGP-SAAAATAGAELLINLNASPFHRGK 178

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
            ++R +++  +    +L  +YVNQVGGQDEL+FDG SF  +   +L  Q   F   +   
Sbjct: 179 QQERLDLLARRCRDNNLAAVYVNQVGGQDELVFDGGSFAMNSDGKLVAQSPRFETASNWC 238

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
           EW      S +          +   L +  A + A VL +RDYV KN F  V++GLSGG+
Sbjct: 239 EWTDSGSASGFR------EGVLSEALDDMAAVWQALVLGMRDYVNKNGFPSVVLGLSGGV 292

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSAL  A+AVDALG   V+ +M+P++YTS  S+ DAA  +  LG ++ V+ I  +   F 
Sbjct: 293 DSALTLAVAVDALGASRVEAVMMPFRYTSDISIADAAEQSATLGVRHSVISIEPIYESFL 352

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           + +        +    EN+Q+R RG +LM++SN  ++++LTT NKSE++VGY TLYGDM+
Sbjct: 353 AALKDEFAGLDADTTEENLQARCRGVLLMSISNKKRSLVLTTGNKSELAVGYSTLYGDMA 412

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD+ KT V+ L  +RNS         L+  IP  ++E+ PSAEL P Q D++SL
Sbjct: 413 GGFDVLKDVPKTLVYALCRYRNS---------LSPCIPERVIERPPSAELAPDQKDEDSL 463

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           PPY +LD I++  VE + S      +    E V     L+  +EYKRRQAP+G +IT + 
Sbjct: 464 PPYDVLDRILELYVEQDFSAEAIIAEGIPREDVERAVRLVDLNEYKRRQAPIGVRITQRG 523

Query: 543 FGRDRLYPISNKFR 556
           FGRDR YPI++ +R
Sbjct: 524 FGRDRRYPITSAWR 537


>gi|194366934|ref|YP_002029544.1| NAD synthetase [Stenotrophomonas maltophilia R551-3]
 gi|194349738|gb|ACF52861.1| NAD+ synthetase [Stenotrophomonas maltophilia R551-3]
          Length = 544

 Score =  476 bits (1226), Expect = e-132,   Method: Composition-based stats.
 Identities = 212/559 (37%), Positives = 312/559 (55%), Gaps = 20/559 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKK 60
           +  ++IA+AQ +  VGD+AGN  +      +A  + G +L++F EL +SGYPPEDL+ + 
Sbjct: 1   MASIRIAMAQFDFPVGDVAGNTERIIEMIGQARDEYGAELVMFPELAVSGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F+  C  A+  + +     G   VVG+P+     V N+  +L  G +     K  LPNY
Sbjct: 61  GFLYECEQAMTRIATACR--GITAVVGWPQAAGAVVYNAASVLRDGLVEQTYRKRELPNY 118

Query: 121 SEFHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           + F E+R F       +       I +G+LICED+W    +   +++ GA+ +   NASP
Sbjct: 119 AVFDERRYFDVDPDGGSCVFEVNGIPVGLLICEDLWFAEPLADTVRE-GAQLVVVPNASP 177

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      F +
Sbjct: 178 YERGKHAQRDAVLAARTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAAFVD 237

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
           Q  + E+  + +    +   DD   +M      +   + A    ++DY +KN F KV +G
Sbjct: 238 QWLVVEYDGETRRFLPHVWMDDGDESM------DALAWRAVTRGIQDYCRKNGFKKVWLG 291

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSA+  A+AVDA+G ENV  + LP +YT+  S + AA   +ALG K + + I   
Sbjct: 292 LSGGIDSAIVLAMAVDAMGAENVTAVRLPSRYTAGLSNDLAAEQCQALGVKLEAVSIEPA 351

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
                  ++   +     +  EN+QSR RG ILMAL+N    +LLTT NKSE +VGY T+
Sbjct: 352 FKGLMESLAPMFEGTTPDVTEENLQSRSRGVILMALANKFGGLLLTTGNKSEYAVGYATI 411

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM GG+ PLKDLYKT+VF L+ WRN+ G          VIPP+++ + PSAELR +Q 
Sbjct: 412 YGDMCGGYAPLKDLYKTEVFGLSKWRNTVGGA-------PVIPPAVISRPPSAELRENQL 464

Query: 479 DQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLP Y +LD I+ R ++ E+S        Y+   V  V  L+  SE+KR QA  G K
Sbjct: 465 DQDSLPAYDVLDGILYRYIDQEQSRTEIVAAGYDAAVVDRVLRLVRISEWKRHQAAPGPK 524

Query: 538 ITAKSFGRDRLYPISNKFR 556
           ++ ++FGR+R YPISN ++
Sbjct: 525 VSRRAFGRERRYPISNGYK 543


>gi|294786968|ref|ZP_06752222.1| glutamine-dependent NAD(+) synthetase [Parascardovia denticolens
           F0305]
 gi|315226607|ref|ZP_07868395.1| NAD synthetase [Parascardovia denticolens DSM 10105]
 gi|294485801|gb|EFG33435.1| glutamine-dependent NAD(+) synthetase [Parascardovia denticolens
           F0305]
 gi|315120739|gb|EFT83871.1| NAD synthetase [Parascardovia denticolens DSM 10105]
          Length = 560

 Score =  476 bits (1226), Expect = e-132,   Method: Composition-based stats.
 Identities = 218/558 (39%), Positives = 311/558 (55%), Gaps = 18/558 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           + IA+AQ++  VGD+ GN AK       A  QG D++LF E+ ++GYP EDL F+ +F Q
Sbjct: 16  VTIALAQIDTCVGDLDGNAAKVLSYSRRAAGQGADVVLFPEMTLTGYPIEDLAFRATFRQ 75

Query: 65  ACSSAIDTLKSDTHDGG---AGIVVGFPRQDQEGV-LNSVVILDAGNIIAVRDKINLPNY 120
           A      TL  D    G     +VVG    D  G+  N +++L  G + A  DK  LPNY
Sbjct: 76  AAWDKASTLAEDLGKEGLGDLYVVVGTVAADAHGLPRNRLIVLHQGVVEASYDKHFLPNY 135

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F  G     +  +  ++G  ICEDIW+       L ++G + L ++N SPY 
Sbjct: 136 GVFDEFRIFSPGDLPLVMTIKGRKIGFAICEDIWQEGGPVAQLAQKGIDLLATINGSPYE 195

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R ++   +   V  P+IY+NQVGGQD+L+FDGASF  +    +  +   F E  
Sbjct: 196 EGKGHIRTDLCARRAREVTAPVIYLNQVGGQDDLVFDGASFVVNPDGGVEERSPQFVEDL 255

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
                                 ST+   +  +E  Y ACVL L+DY+ KN F  V++GLS
Sbjct: 256 SFWTL----PAVAGTDSDQAGRSTLIPLMDSDEEVYRACVLGLKDYMAKNGFKGVVLGLS 311

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL A +A DA+G  NV  + +P  Y+S  S +DAA  A  +G  Y++ PI  L  
Sbjct: 312 GGIDSALVATMAADAIGGSNVWGLSMPSMYSSSGSKDDAADLAANMGAHYEIQPIEPLFQ 371

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   +      +  GI AEN+Q+R+RG ++MA SN    + L T NKSE++ GY T+YG
Sbjct: 372 AFQKQL------DLQGIAAENLQARMRGVLVMAYSNSHGLLALATGNKSELACGYSTIYG 425

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           D  GG+ P+KD+ KT+V+QLA WRNS+ +  G  P    IP + + K PSAELRP Q D 
Sbjct: 426 DAVGGYAPIKDVLKTKVWQLAKWRNSYALGKGQVP---PIPVNSILKPPSAELRPGQKDS 482

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLP Y +LD ++   +E      +  +  ++ ETV  V  L+  +E+KRRQ P+G K+T
Sbjct: 483 DSLPEYELLDQVLASYIEKAHGRADLLKDGFDPETVDTVMRLVDKAEWKRRQYPLGPKVT 542

Query: 540 AKSFGRDRLYPISNKFRD 557
           A +FGRDR  P+++ FR+
Sbjct: 543 ALAFGRDRRLPVTSAFRE 560


>gi|254429711|ref|ZP_05043418.1| NAD synthase family [Alcanivorax sp. DG881]
 gi|196195880|gb|EDX90839.1| NAD synthase family [Alcanivorax sp. DG881]
          Length = 537

 Score =  476 bits (1226), Expect = e-132,   Method: Composition-based stats.
 Identities = 230/553 (41%), Positives = 310/553 (56%), Gaps = 24/553 (4%)

Query: 9   IAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSFIQACS 67
           +AQ N +VGDI GN  +   A +EA R  G DL+LF EL ++GYPPEDL+ + S      
Sbjct: 1   MAQQNALVGDIEGNAQRVIAAADEARRLLGADLVLFPELMLTGYPPEDLLLRPSLNSRVD 60

Query: 68  SAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGN--IIAVRDKINLPNYSEFHE 125
           +A+  + +        +V+G+P        N+  ++  G         K +LPNY  F E
Sbjct: 61  AALADIGAAI---SVPVVLGYPAVRNGHRRNAAGVVFPGESGPRHEYFKQHLPNYRVFDE 117

Query: 126 KRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLK 185
           KR F  G            LGI ICEDIW +      L++ GA+ + +LNASPY  NK  
Sbjct: 118 KRYFQPGTDICTFDIEGWTLGITICEDIWHDGP-AAQLQQAGADLVLNLNASPYRANKAD 176

Query: 186 KRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEW 245
           +R   V  +     LP++Y N VGGQDEL+FDGASF  D Q     Q   F+E     + 
Sbjct: 177 ERFAQVQARSRETGLPVLYCNLVGGQDELVFDGASFVCDSQGNRCVQAASFTEALVPVDL 236

Query: 246 HYDQQLSQWNYMSDDSASTMYIPLQ-EEEADYNACVLSLRDYVQKNNFHKVIIGLSGGID 304
                  +             +PL   EE  Y A VL+ RDYV KN F   ++GLSGGID
Sbjct: 237 QCQGGHCEPRG--------EELPLPGPEEGMYQALVLATRDYVNKNGFKGALLGLSGGID 288

Query: 305 SALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS 364
           SAL  A+AVDALG E V+ +M+P++YTS  SLEDA   A+ L   Y VLPI    N F  
Sbjct: 289 SALTLAVAVDALGPERVEAVMMPFQYTSAMSLEDAEKQARTLRVHYRVLPIEAAFNGFMD 348

Query: 365 LMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSG 424
           ++S+           EN+Q+R RG +LMALSN + +++LTT NKSE++VGY TLYGDM+G
Sbjct: 349 ILSESFSGTARDTTEENLQARCRGVLLMALSNKNGSVVLTTGNKSEMAVGYATLYGDMAG 408

Query: 425 GFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLP 484
           GF+ LKD++KT VF L  WRN            E+IP  ++ + PSAEL P Q D +SLP
Sbjct: 409 GFSVLKDVFKTSVFNLCRWRNQQAG-------AEIIPDRVITRPPSAELAPDQVDSDSLP 461

Query: 485 PYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSF 543
            Y  LD I++R VE + S        ++ ETV  V  L   +EYKRRQA VG +++ ++F
Sbjct: 462 DYDELDAILERYVEQDMSAEAVIRDGFDRETVYRVVKLTDRNEYKRRQAAVGPRVSRRAF 521

Query: 544 GRDRLYPISNKFR 556
           G+DR YPI+N +R
Sbjct: 522 GKDRRYPITNGWR 534


>gi|323705926|ref|ZP_08117497.1| NAD+ synthetase [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534724|gb|EGB24504.1| NAD+ synthetase [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 545

 Score =  476 bits (1226), Expect = e-132,   Method: Composition-based stats.
 Identities = 221/566 (39%), Positives = 321/566 (56%), Gaps = 36/566 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIA+AQLNP VGDI  N  K     +EA +  MDLI+F EL I GYPP+DL++   F++
Sbjct: 1   MKIALAQLNPTVGDIKNNCEKIIMNIKEAKKAQMDLIVFPELSIIGYPPKDLLYNPDFLE 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG---VLNSVVILDAGNIIAVRDKINLPNYS 121
                ++ +       G G++VG   +D+E    + NS ++L  G I+   DK  LPNY 
Sbjct: 61  TADRMLNDIL-LPETEGIGVIVGTVTRDEEKDYLLHNSALLLYNGKIVGQADKTLLPNYD 119

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNIC----------KHLKKQGAEFL 171
            F E+R F        I F+ +RL I ICEDIW + +            +       +  
Sbjct: 120 VFDEQRYFEPAKKRACIDFKGVRLAINICEDIWNDKDFWERPRYDIDVLEEQYSLNPDIF 179

Query: 172 FSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAF 231
            +++ASPY   K + + ++V        LP+IYVNQVGG DELIFDG SF  +   +   
Sbjct: 180 INISASPYNLGKHELKVKMVKQISKKYKLPLIYVNQVGGNDELIFDGNSFVINSNGERVV 239

Query: 232 QMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNN 291
            +K F E     +    + L+    ++++ +             ++A +L LRDY +K  
Sbjct: 240 NLKAFCEDLAFIDTDELEYLAPLKDINENIS-----------WVHDALILGLRDYFRKTG 288

Query: 292 FHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYD 351
           F K ++GLSGGIDSA+  A+AV ALG+ENV  + +P +Y+S  S +DA   A+ L  +Y 
Sbjct: 289 FKKAVVGLSGGIDSAVTCALAVKALGRENVLGVSMPSRYSSEGSKDDARDLAQNLNIEYR 348

Query: 352 VLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEI 411
           V+PI D+   + S+ ++        +  EN+Q+RIRGN LM +SN    M+LTT NKSEI
Sbjct: 349 VIPIEDVFKSYISIFNK-DGNIVGDLAEENLQARIRGNYLMFISNREGHMVLTTGNKSEI 407

Query: 412 SVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSA 471
           +VGY TLYGDMSGG   + D+ KT V++LA + N   I         +IP S +EK+PSA
Sbjct: 408 AVGYCTLYGDMSGGLAVISDVPKTMVYELAKYINRENI---------IIPISTIEKAPSA 458

Query: 472 ELRPHQTDQESLPPYPILDDIIKRIVENEESFINND-QEYNDETVRYVEHLLYGSEYKRR 530
           ELRP+Q D +SLPPY ILDDI+K  +E ++S      + Y++  V+ V   +  +EYKR+
Sbjct: 459 ELRPNQKDTDSLPPYEILDDILKLYIEEDKSISEIVSRGYDEALVKDVIRKVNSAEYKRK 518

Query: 531 QAPVGTKITAKSFGRDRLYPISNKFR 556
           QA  G K+T K+FG  R  PI+ +FR
Sbjct: 519 QAAPGLKVTTKAFGVGRRMPIAQRFR 544


>gi|254284409|ref|ZP_04959377.1| NAD+ synthetase [gamma proteobacterium NOR51-B]
 gi|219680612|gb|EED36961.1| NAD+ synthetase [gamma proteobacterium NOR51-B]
          Length = 537

 Score =  476 bits (1225), Expect = e-132,   Method: Composition-based stats.
 Identities = 221/554 (39%), Positives = 322/554 (58%), Gaps = 19/554 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMD-LILFTELFISGYPPEDLVFKKSFI 63
           +K+ +AQ+N +VGD  GN  +      EA     + +++F EL + GYPPEDL+ + S  
Sbjct: 1   MKLCMAQINTMVGDYRGNTEQVLATCAEAVAIDPEAIVVFPELTLCGYPPEDLLLRPSVE 60

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEF 123
              +  ++ L  +       +++GFPR  +  + N+  +++ G IIA  DK  LPNY+ F
Sbjct: 61  DHVNECLERLCRELPA-SLWVILGFPRHREGRLFNTAAVINRGAIIAEYDKQRLPNYAVF 119

Query: 124 HEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNK 183
            E R F +G     +    + +G+ ICEDIW +       ++ GA  L +LN+SPY+  K
Sbjct: 120 DEVRYFSAGNDPCVVEVAGMPVGLSICEDIW-SPVPAASARQAGARLLVNLNSSPYHRGK 178

Query: 184 LKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMT 243
             +R  ++  +    H PI+YVNQVGGQDEL+FDG SF  D   ++      F    +  
Sbjct: 179 RDQRWSLLADRARENHFPIVYVNQVGGQDELVFDGGSFAVDAAGEVVCAAPDFDAGLWWL 238

Query: 244 EWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGI 303
           E  Y       +     +  T+  PLQE EA + A VL LRDYV KN F  V++GLSGGI
Sbjct: 239 ELGYQ------DATVAITPDTVATPLQEIEAVWRALVLGLRDYVDKNGFPGVVLGLSGGI 292

Query: 304 DSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFF 363
           DSA+  A+AVDALG + V  +M+P++YT+  S+EDA A A  LG  Y  + I  +   F 
Sbjct: 293 DSAVTLALAVDALGADRVHAVMMPFRYTASISIEDAEAEALTLGVDYRSISIEPIYEAFM 352

Query: 364 SLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMS 423
           + +S+        I  EN+Q+R RG +LM++SN    ++LTT NKSE++VGY TLYGDM+
Sbjct: 353 ASLSEEFAGLLPNITEENLQARCRGVLLMSISNKKNLLVLTTGNKSELAVGYSTLYGDMA 412

Query: 424 GGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESL 483
           GGF+ LKD  K  V+ LA +RNS         +  VIP  ++ + PSAEL P Q D++SL
Sbjct: 413 GGFDVLKDCPKMLVYALARFRNS---------VGPVIPERVITRPPSAELAPDQKDEDSL 463

Query: 484 PPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKS 542
           P Y +LD II+  VE + + I    + + +  VR V  L+  +EYKRRQAPVG +I+ ++
Sbjct: 464 PAYEVLDQIIELYVEQDLTAIEIISRGFEEPDVRRVIRLVDLNEYKRRQAPVGVRISQRA 523

Query: 543 FGRDRLYPISNKFR 556
           FGRDR YPI+  +R
Sbjct: 524 FGRDRRYPITWAWR 537


>gi|159029185|emb|CAO87545.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 552

 Score =  476 bits (1224), Expect = e-132,   Method: Composition-based stats.
 Identities = 221/571 (38%), Positives = 325/571 (56%), Gaps = 40/571 (7%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           ++IAIAQLNP+VGDI GN  +   A + A  QG +L+L  EL + GYPP DL+    F++
Sbjct: 1   MRIAIAQLNPIVGDIEGNAQRILEAAQTAFNQGAELLLTPELSLCGYPPRDLLLNLGFVE 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-------VLNSVVILDAGNIIAVRDKINL 117
             S  +  L     +    ++VGF  ++          + NS+ +L +  I  +  K  L
Sbjct: 61  KMSQQLQLLSQQLPEK-LAVLVGFVEKNPSATVRGEKPLFNSIALLKSQEIKQIFTKRLL 119

Query: 118 PNYSEFHEKRTFISGYSNDPIVF--RDIRLGILICEDIWKNSNIC----------KHLKK 165
           P Y  F E R F SG  +        ++++G+ ICED+W +                L  
Sbjct: 120 PTYDVFDEDRYFASGKESQYFQLTENNVKIGVTICEDVWNDEQFWGQRQYAVNPIADLAN 179

Query: 166 QGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDG 225
            G + + +L+ASPY   K K R  +++   +  +LPI+YVNQVGG D+LIFDG S  F+ 
Sbjct: 180 LGVDLIVNLSASPYSVGKQKLRESLLSHSATRYNLPIVYVNQVGGNDDLIFDGDSVAFNR 239

Query: 226 QQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRD 285
           Q ++ ++ K F+    + E++ D             A    +P+ E+E  Y A VL ++D
Sbjct: 240 QGEVIYRAKAFTSSLELIEFNQDLL----------PAIIHPLPVDEDEEIYQALVLGVQD 289

Query: 286 YVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKA 345
           YVQK  F +VI GLSGGIDS+L AAIA DALGKENV  +M+P  Y+S  S+ DA A    
Sbjct: 290 YVQKCGFKRVIFGLSGGIDSSLVAAIASDALGKENVLAVMMPSPYSSDHSISDAVALVNN 349

Query: 346 LGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTT 405
           LG K + L I +++  +  L+         GI  EN+QSRIRGN+LMALSN    +LL+T
Sbjct: 350 LGIKSEKLAIKEIMTAYDQLLESLFAGTDFGIAEENLQSRIRGNLLMALSNKFGHLLLST 409

Query: 406 SNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSIL 465
            NKSE++VGY TLYGDM+GG   + D+ KT+V+ L  W N H          E+IP +++
Sbjct: 410 GNKSEMAVGYCTLYGDMNGGLAVIADVPKTRVYSLCRWLNRH---------GEIIPLNVI 460

Query: 466 EKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYG 524
            K+PSAEL+P+Q DQ+SLPPY ILD I+  +++  +S        +  E V+ V  L+  
Sbjct: 461 NKAPSAELKPNQKDQDSLPPYEILDAILALLIDRHQSAEQIIAAGFEPEIVQKVIKLVKN 520

Query: 525 SEYKRRQAPVGTKITAKSFGRDRLYPISNKF 555
           +E+KR+QAP G KI+ ++FG     PI++++
Sbjct: 521 AEFKRKQAPPGLKISDRAFGTGWRMPIASRW 551


>gi|289772035|ref|ZP_06531413.1| NAD(+) synthase [Streptomyces lividans TK24]
 gi|289702234|gb|EFD69663.1| NAD(+) synthase [Streptomyces lividans TK24]
          Length = 596

 Score =  476 bits (1224), Expect = e-132,   Method: Composition-based stats.
 Identities = 206/595 (34%), Positives = 306/595 (51%), Gaps = 49/595 (8%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
            +L++A+ Q++  VGDI GN          +  +G  L+ F E+ ++GYP EDL  + SF
Sbjct: 9   PRLRLALNQIDSTVGDIDGNAESVLHWTRHSAERGAHLVAFPEMTLTGYPVEDLALRSSF 68

Query: 63  IQACSSAIDTLKSDTHDGG---AGIVVGFPRQD----------QEGVLNSVVILDAGNII 109
           ++A  +A+ +L +   D G     ++VG   +                N+  +L  G + 
Sbjct: 69  VEASRAALRSLAARLADEGLGTVPVIVGHLDRSATAQPRYGQPAGAPQNAAAVLYGGEVA 128

Query: 110 AVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAE 169
               K +LPNY  F E R F+ G +   +  R + + + ICED+W++       +   A 
Sbjct: 129 LSFAKHHLPNYGVFDEFRYFVPGDTLPVVRVRGVDVALAICEDLWQDGGRVPAARSARAG 188

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            L S+NASPY  +K   R E+V  +         Y+   GGQDEL+FDG S   D    +
Sbjct: 189 LLLSVNASPYERDKDDTRLELVRRRAQEAGCTTAYLAMTGGQDELVFDGDSIVVDRDGTV 248

Query: 230 AFQMKHFSEQNFMTEWHY------------------------DQQLSQWNYMSDDSAST- 264
             +   F+E   + +                            +   +    + +   + 
Sbjct: 249 LARAPQFTEGCMVLDLDLPAADADPPTGVVDDGLRIDRVVLPGEAGREQPLPAGEPWLSG 308

Query: 265 -MYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQT 323
               PL ++E  Y+A V  LR YV KN F  V+IGLSGGIDSAL A+IA DALG E+V  
Sbjct: 309 GHAEPLDDDEEVYSALVTGLRAYVAKNGFRSVLIGLSGGIDSALVASIACDALGAEHVYG 368

Query: 324 IMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQ 383
           + +P KY+S  S +DAA  A+  G  Y  + I  + + +   +      E +G+  EN+Q
Sbjct: 369 VSMPSKYSSGHSRDDAAELARRTGLHYRTVSIEPMFDAYTGAL------ELTGLAEENLQ 422

Query: 384 SRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASW 443
           SR+RG +LMALSN    ++L   NKSE++VGY TLYGD  GG+ P+KD+YKT VF+LA W
Sbjct: 423 SRLRGTLLMALSNQEGHLVLAPGNKSELAVGYSTLYGDSVGGYGPIKDVYKTSVFRLAEW 482

Query: 444 RNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESF 503
           RN      G  P    +P + + K PSAELRP Q D +SLP YP+LD I+   V+ +   
Sbjct: 483 RNRAARDRGRTP---PVPENSITKPPSAELRPGQVDTDSLPDYPVLDAILALYVDRDRGA 539

Query: 504 INN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
                  Y+ E V     ++  +EYKRRQ P GTKI+ K FG+DR  P++N++R+
Sbjct: 540 DEIVAAGYDRELVTRTLRMVDTAEYKRRQYPPGTKISPKGFGKDRRLPVTNRWRE 594


>gi|21220709|ref|NP_626488.1| NAD(+) synthase (glutamine-hydrolysing) [Streptomyces coelicolor
           A3(2)]
 gi|13751883|emb|CAC37264.1| NAD(+) synthase (glutamine-hydrolysing) [Streptomyces coelicolor
           A3(2)]
          Length = 613

 Score =  476 bits (1224), Expect = e-132,   Method: Composition-based stats.
 Identities = 206/595 (34%), Positives = 306/595 (51%), Gaps = 49/595 (8%)

Query: 3   KKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSF 62
            +L++A+ Q++  VGDI GN          +  +G  L+ F E+ ++GYP EDL  + SF
Sbjct: 26  PRLRLALNQIDSTVGDIDGNAESVLHWTRHSAERGAHLVAFPEMTLTGYPVEDLALRSSF 85

Query: 63  IQACSSAIDTLKSDTHDGG---AGIVVGFPRQD----------QEGVLNSVVILDAGNII 109
           ++A  +A+ +L +   D G     ++VG   +                N+  +L  G + 
Sbjct: 86  VEASRAALRSLAARLADEGLGTVPVIVGHLDRSATAQPRYGQPAGAPQNAAAVLYGGEVA 145

Query: 110 AVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAE 169
               K +LPNY  F E R F+ G +   +  R + + + ICED+W++       +   A 
Sbjct: 146 LSFAKHHLPNYGVFDEFRYFVPGDTLPVVRVRGVDVALAICEDLWQDGGRVPAARSARAG 205

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            L S+NASPY  +K   R E+V  +         Y+   GGQDEL+FDG S   D    +
Sbjct: 206 LLLSVNASPYERDKDDTRLELVRRRAQEAGCTTAYLAMTGGQDELVFDGDSIVVDRDGTV 265

Query: 230 AFQMKHFSEQNFMTEWHY------------------------DQQLSQWNYMSDDSAST- 264
             +   F+E   + +                            +   +    + +   + 
Sbjct: 266 LARAPQFTEGCMVLDLDLPAADADPPTGVVDDGLRIDRVVLPGEAGREQPLPAGEPWLSG 325

Query: 265 -MYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQT 323
               PL ++E  Y+A V  LR YV KN F  V+IGLSGGIDSAL A+IA DALG E+V  
Sbjct: 326 GHAEPLDDDEEVYSALVTGLRAYVAKNGFRSVLIGLSGGIDSALVASIACDALGAEHVYG 385

Query: 324 IMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQ 383
           + +P KY+S  S +DAA  A+  G  Y  + I  + + +   +      E +G+  EN+Q
Sbjct: 386 VSMPSKYSSGHSRDDAAELARRTGLHYRTVSIEPMFDAYTGAL------ELTGLAEENLQ 439

Query: 384 SRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASW 443
           SR+RG +LMALSN    ++L   NKSE++VGY TLYGD  GG+ P+KD+YKT VF+LA W
Sbjct: 440 SRLRGTLLMALSNQEGHLVLAPGNKSELAVGYSTLYGDSVGGYGPIKDVYKTSVFRLAEW 499

Query: 444 RNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESF 503
           RN      G  P    +P + + K PSAELRP Q D +SLP YP+LD I+   V+ +   
Sbjct: 500 RNRAARDRGRTP---PVPENSITKPPSAELRPGQVDTDSLPDYPVLDAILALYVDRDRGA 556

Query: 504 INN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
                  Y+ E V     ++  +EYKRRQ P GTKI+ K FG+DR  P++N++R+
Sbjct: 557 DEIVAAGYDRELVTRTLRMVDTAEYKRRQYPPGTKISPKGFGKDRRLPVTNRWRE 611


>gi|298491871|ref|YP_003722048.1| NAD+ synthetase ['Nostoc azollae' 0708]
 gi|298233789|gb|ADI64925.1| NAD+ synthetase ['Nostoc azollae' 0708]
          Length = 557

 Score =  476 bits (1224), Expect = e-132,   Method: Composition-based stats.
 Identities = 222/570 (38%), Positives = 315/570 (55%), Gaps = 33/570 (5%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KI I QLNP++GD+ GN  K     ++A      L+L  EL + GYPP DL+   SF++
Sbjct: 1   MKITIVQLNPIIGDLPGNAQKILETAQQAVSANARLLLTPELSLCGYPPRDLLLNPSFVE 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQD-------QEGVLNSVVILDAGNIIAVRDKINL 117
           A ++ +  L  D       ++VG   ++        + + NS+  L+AG I     K  L
Sbjct: 61  AMNTTLQKLAKDLP-PNLAVLVGTVVKNTEAYINGGKTLFNSIAWLEAGKIKQYFHKRLL 119

Query: 118 PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNIC----------KHLKKQG 167
           P Y  F EKR F  G   +     DI +G+ ICED+W +                L   G
Sbjct: 120 PTYDVFDEKRYFEPGLQANYFSLDDINIGVTICEDLWNDEEFWGKRSYAVNPIADLSILG 179

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
            + + +L+ASPY   K K R  ++     +   P+IY NQVGG D+LIFDG SF  + Q 
Sbjct: 180 VDLIVNLSASPYTVGKQKLREAMLQHSAVNFQEPVIYTNQVGGNDDLIFDGRSFALNLQG 239

Query: 228 QLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYV 287
           ++  + K F     + E+   Q+  Q   +S        +   E+E  ++A VL +RDYV
Sbjct: 240 EIICRAKGFETDLLVVEFDETQRDLQLGSISP-------VYESEDEEIWHALVLGVRDYV 292

Query: 288 QKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALG 347
            K  F +V++GLSGG+DSAL AAIA  ALGKENV  I++P  Y+S  SL DA A A  L 
Sbjct: 293 NKCRFSEVVLGLSGGVDSALVAAIATAALGKENVLGILMPSPYSSEHSLTDALALAVNLE 352

Query: 348 CKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSN 407
            K  +LPI +L+  F + + +       GI  ENIQSRIRGN+LMA++N    +LL+T N
Sbjct: 353 IKTHILPIGELMQGFNNSLVELFAGTEFGIAEENIQSRIRGNLLMAIANKFGYLLLSTGN 412

Query: 408 KSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEK 467
           KSE++VGY TLYGDM+GG   + D+ KT+V+ L +W N H          E+IP +IL K
Sbjct: 413 KSEMAVGYCTLYGDMNGGLAVIADVPKTRVYSLCNWLNFHSNR-------EIIPQNILTK 465

Query: 468 SPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSE 526
            PSAEL+P Q DQ+SLP Y ILDDI++ +V + +S        ++   V  V  ++  +E
Sbjct: 466 PPSAELKPGQVDQDSLPAYEILDDILQHLVHDHQSGEQIVASGHDSAIVNRVLQMVARAE 525

Query: 527 YKRRQAPVGTKITAKSFGRDRLYPISNKFR 556
           +KRRQAP G KIT ++FG     PI+  F 
Sbjct: 526 FKRRQAPPGLKITDRAFGTGWRMPIARVFS 555


>gi|289662938|ref|ZP_06484519.1| NAD synthetase [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 538

 Score =  476 bits (1224), Expect = e-132,   Method: Composition-based stats.
 Identities = 218/552 (39%), Positives = 307/552 (55%), Gaps = 20/552 (3%)

Query: 9   IAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSFIQACS 67
           +AQ +  VG +A N  +       A  +   D++LF EL ISGYPPEDL+ +  F+  C 
Sbjct: 1   MAQFDFPVGAVAQNTDRIIEYIAAARDEFEADIVLFPELAISGYPPEDLLLRPGFLAHCE 60

Query: 68  SAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKR 127
            A+  + + T   G   VVG+P+     V N+  +L  G I A   K  LPNY+ F E+R
Sbjct: 61  EALGRIAAATR--GIVAVVGWPQSAGSVVYNAASVLRDGRIEATYRKRELPNYAVFDERR 118

Query: 128 TFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLK 185
            F       N     + +++G++ICED+W    +     K  AE +   NASPY   K  
Sbjct: 119 YFDVDPDGDNCVFTVKGVQVGVVICEDLWFAEPLANT-VKARAELVLVPNASPYERGKHA 177

Query: 186 KRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEW 245
           +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      F +Q  + ++
Sbjct: 178 QRDALLAERTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAAFVDQWLVVDY 237

Query: 246 HYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDS 305
              ++        DD   +M      +   + A V  L+DY +KN F KV +GLSGGIDS
Sbjct: 238 AAGERSFTPVVWVDDGDESM------DALAWRAVVRGLQDYCRKNGFSKVWLGLSGGIDS 291

Query: 306 ALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSL 365
           AL  AIAVDALG +NV  + LP +YT+  S + A    +ALG K + + I          
Sbjct: 292 ALVLAIAVDALGGDNVTAVRLPSRYTANLSNDLADEQCRALGVKLETIAIEPAFEGLLGA 351

Query: 366 MSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGG 425
           +    +     I  EN+QSR RG ILMALSN    ++LTT NKSE +VGY T+YGDM GG
Sbjct: 352 LGPMFEGTQPDITEENLQSRSRGVILMALSNKFGGLVLTTGNKSEYAVGYATIYGDMCGG 411

Query: 426 FNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPP 485
           + PLKDLYKT+VF LA WRN+ G          VIPP+++ + PSAELR +QTDQ+SLPP
Sbjct: 412 YAPLKDLYKTEVFGLAKWRNTVGG-------APVIPPAVISRPPSAELRDNQTDQDSLPP 464

Query: 486 YPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFG 544
           Y +LD I+ R V+ E+S  +     Y  +TV +V  L+  +E+KR Q+  G K++ ++FG
Sbjct: 465 YDVLDGILYRYVDQEQSRDDIVAAGYAADTVEHVLRLVRLNEWKRHQSAPGPKVSRRAFG 524

Query: 545 RDRLYPISNKFR 556
           R+R YPI+N +R
Sbjct: 525 RERRYPITNGYR 536


>gi|225352292|ref|ZP_03743315.1| hypothetical protein BIFPSEUDO_03908 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157539|gb|EEG70878.1| hypothetical protein BIFPSEUDO_03908 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 565

 Score =  476 bits (1224), Expect = e-132,   Method: Composition-based stats.
 Identities = 210/579 (36%), Positives = 315/579 (54%), Gaps = 37/579 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  ++ A+AQ++  VGD+  N  K  R    A +QG  +++F E+ ++GYP EDL  + +
Sbjct: 1   MTDIRFALAQIDTCVGDLDSNAGKIMRYVRRAAQQGAQVVVFPEMTLTGYPIEDLALRAT 60

Query: 62  FIQACSSAIDTLKSDTHDGGAG---IVVGFP--RQDQEGVLNSVVILDAGNIIAVRDKIN 116
           F +A  +  + L ++    G G   +VVG     ++     N +V+L  G +    DK  
Sbjct: 61  FRKAAWNKANWLATELAADGLGDLFVVVGTVGTDRETSKPRNRLVVLHDGVVWDGYDKHF 120

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LPNY  F E R F  G  +  +     R+G+ ICEDIW++      L +Q  + L ++N 
Sbjct: 121 LPNYGVFDEFRIFSPGNKSMVLDVNGARIGVAICEDIWQDGGPVAELAEQHIDLLLTMNG 180

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY   K   R ++   + + V+ P++Y+NQVGGQD+L+FDG SF  D    L  +   F
Sbjct: 181 SPYEEGKTDTRLDLAVRRAAEVNAPMVYLNQVGGQDDLVFDGGSFVVDADGTLLERSPMF 240

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E     +     +  +          ++      +E  Y ACVL L+DY+ KN+F  V 
Sbjct: 241 MEDLSFFDLDTTAERQKA--------GSIAAKPDPDEEVYTACVLGLKDYMAKNHFKGVC 292

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL AA+A DA+G  NV  I +P  Y+S  S +DAA  AK +G  YD+ PI 
Sbjct: 293 LGLSGGIDSALVAAMAADAVGGANVYGISMPSMYSSDGSKDDAADLAKNIGAHYDIQPIE 352

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            L   F   +      +  G+ AEN+Q+RIRG I+MA SN    + + T NKSE++ GY 
Sbjct: 353 PLFVSFQKQL------DLEGVAAENLQARIRGVIVMAYSNSKGLLAVATGNKSELACGYS 406

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLG-----------------PLTEV 459
           T+YGD  GG+ P+KDL KT+V++++ WRN                          P   +
Sbjct: 407 TIYGDAVGGYAPIKDLLKTRVWEISRWRNKAAAAGMGIGGLHVVGNEQGLAGTPLPDGVM 466

Query: 460 IPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYV 518
           IP + +EK+PSAELRP Q D +SLP Y +LD ++   +E+     +     +++ TV  V
Sbjct: 467 IPVNSIEKAPSAELRPGQKDSDSLPEYELLDQVLAMYIEHAHGREDLLADGFDETTVDTV 526

Query: 519 EHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
             L+  +E+KRRQ P+G K+TA +FGRDR  PI+N FR+
Sbjct: 527 MRLVDRAEWKRRQYPLGPKVTALAFGRDRRLPITNAFRE 565


>gi|171912399|ref|ZP_02927869.1| NAD+ synthetase [Verrucomicrobium spinosum DSM 4136]
          Length = 543

 Score =  475 bits (1223), Expect = e-132,   Method: Composition-based stats.
 Identities = 211/566 (37%), Positives = 309/566 (54%), Gaps = 36/566 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KI +AQ+N  VGD +GN A   +A  EA  QG  L++  EL ++GYPP DLV +  F+ 
Sbjct: 1   MKIGLAQINTTVGDFSGNSALILKAYREAVAQGAQLVITPELAMTGYPPRDLVHRSRFVP 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG---VLNSVVILDAGNIIAVRDKINLPNYS 121
               A+  L      G   ++VGF   ++       N+  +L AG I  V  K  LP Y 
Sbjct: 61  GNIEALRQLAGAV--GAVPLIVGFVDVNEGAGKPFRNAAAVLQAGRIHQVVAKTLLPTYD 118

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICK---------HLKKQGAEFLF 172
            F E R F    +  P+V   IR+G+ ICEDIW +  + +          L KQG + L 
Sbjct: 119 VFDEDRYFEPEENLVPVVIEGIRVGVTICEDIWTDDYLPRRLYDVEPPIELAKQGVDLLV 178

Query: 173 SLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQ 232
           +L+ASP+   K   R +++    +   +P++Y N VGG D+L+FDG S       ++  +
Sbjct: 179 NLSASPFSLGKPTIREKMLGELAAETGVPVVYCNAVGGNDQLVFDGNSLVIGKDGEVLAR 238

Query: 233 MKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNF 292
           +  F+E+  + +                + +    P+   E  Y A VL LRDYV K  F
Sbjct: 239 LASFAEEVAVVDV------------LSGAGARAAEPMVVAEELYQALVLGLRDYVTKCGF 286

Query: 293 HKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDV 352
              ++GLSGGIDSAL A +A +ALG  NV  + LP  Y+S  S +DA   A+ LG +Y+ 
Sbjct: 287 KSCVLGLSGGIDSALVAVLAAEALGPANVLGVSLPSVYSSEGSKDDARELAEKLGIQYET 346

Query: 353 LPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEIS 412
           +PI  +         +    +P  +  EN+QSRIRG ILM+LSN    +LLTT NKSE++
Sbjct: 347 IPIQSVFEALKGQTREVFAGKPEDVTEENMQSRIRGLILMSLSNKFGHLLLTTGNKSEMA 406

Query: 413 VGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAE 472
           VGY T+YGDM GG + + DL KT+V++++ W N            E+IP + +EK PSAE
Sbjct: 407 VGYCTIYGDMCGGLSVISDLPKTKVYEVSRWINRE---------REIIPWASIEKPPSAE 457

Query: 473 LRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQ 531
           LRP Q DQ++LP Y +LD I++  VE  +S      + Y++E VR+V   +  +E+KR Q
Sbjct: 458 LRPDQKDQDTLPEYDVLDGILELFVEQGQSIAEIVARGYDEELVRWVLRRVDLNEWKRHQ 517

Query: 532 APVGTKITAKSFGRDRLYPISNKFRD 557
           A  G K+T+K+FG  R  PI  +FR+
Sbjct: 518 AAPGLKVTSKAFGMGRRIPIVQRFRE 543


>gi|154488718|ref|ZP_02029567.1| hypothetical protein BIFADO_02025 [Bifidobacterium adolescentis
           L2-32]
 gi|154082855|gb|EDN81900.1| hypothetical protein BIFADO_02025 [Bifidobacterium adolescentis
           L2-32]
          Length = 565

 Score =  475 bits (1223), Expect = e-132,   Method: Composition-based stats.
 Identities = 212/579 (36%), Positives = 314/579 (54%), Gaps = 37/579 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  ++ A+AQ++  VGD+  N  K  R    A +QG  +++F E+ ++GYP EDL  + +
Sbjct: 1   MTDIRFALAQIDTCVGDLDSNADKVMRYAHLAAQQGAQVVVFPEMTLTGYPIEDLALRAT 60

Query: 62  FIQACSSAIDTLKSDTHD---GGAGIVVGFP--RQDQEGVLNSVVILDAGNIIAVRDKIN 116
           F +A     + L ++      G   +VVG     ++     N +V+L  G + A  DK  
Sbjct: 61  FRKAAWDKANWLATELASDSLGELYVVVGTVGTDRETSKPRNRLVVLHDGVVWAGYDKHF 120

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LPNY  F E R F  G  +  +     R+G+ ICEDIW++      L K+  + L ++N 
Sbjct: 121 LPNYGVFDEFRIFSPGNKSMVLDVNGARIGVAICEDIWQDGGPVAELAKENIDLLLTMNG 180

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY   K   R ++   + + V+ P+IY+NQVGGQD+L+FDG SF  D    L  +   F
Sbjct: 181 SPYEEGKTDTRLDLAVRRAAEVNAPMIYLNQVGGQDDLVFDGGSFVVDTDGSLLERSPMF 240

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E     +                   T+      +E  Y ACVL L+DY+ KN+F  V 
Sbjct: 241 MEDLSFFDLD--------TSAEHQKVGTIAAKPDPDEEVYTACVLGLKDYMAKNHFKGVC 292

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL AA+A DA+G ENV  I +P  Y+S  S +DAA  A+ +G  YD+ PI 
Sbjct: 293 LGLSGGIDSALVAAMAADAVGGENVYGISMPSMYSSDGSKDDAADLARNIGAHYDIQPIE 352

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            L   F + +      E  G+ AEN+Q+RIRG I+MA SN    + + T NKSE++ GY 
Sbjct: 353 PLFVSFQNQL------ELEGVAAENLQARIRGVIVMAYSNSKGLLAVATGNKSELACGYS 406

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLG-----------------PLTEV 459
           T+YGD  GG+ P+KDL KT+V++++ WRN                          P   +
Sbjct: 407 TIYGDAVGGYAPIKDLLKTRVWEISRWRNKAAAAGMGIGGLHVVGNEQGSAGTPLPDGVM 466

Query: 460 IPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYV 518
           IP + +EK+PSAELRP Q D +SLP Y +LD ++   +E+     +     +++ TV  V
Sbjct: 467 IPVNSIEKAPSAELRPGQKDSDSLPEYALLDQVLAMYIEHAHGRADLLADGFDEATVDTV 526

Query: 519 EHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
             L+  +E+KRRQ P+G K+TA +FGRDR  P++N FR+
Sbjct: 527 MRLVDRAEWKRRQYPLGPKVTALAFGRDRRLPVTNAFRE 565


>gi|190575604|ref|YP_001973449.1| NAD synthetase [Stenotrophomonas maltophilia K279a]
 gi|190013526|emb|CAQ47161.1| putative glutamine-dependent NAD synthase [Stenotrophomonas
           maltophilia K279a]
          Length = 544

 Score =  475 bits (1223), Expect = e-132,   Method: Composition-based stats.
 Identities = 214/559 (38%), Positives = 309/559 (55%), Gaps = 20/559 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKK 60
           +  ++IA+AQ +  VGD+AGN  +      +A  + G +L++F EL +SGYPPEDL+ + 
Sbjct: 1   MASIRIAMAQFDFPVGDVAGNTERIIEMIGQARDEYGAELVMFPELAVSGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F+  C  A+  + +     G   VVG+P+     V N+  +L  G +     K  LPNY
Sbjct: 61  GFLYECEQAMARIATACR--GITAVVGWPQAAGAVVYNAASVLRDGLVEQTYRKRELPNY 118

Query: 121 SEFHEKRTFI--SGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASP 178
           + F E+R F       +       I +G+LICED+W    +     + GA+ +   NASP
Sbjct: 119 AVFDERRYFDVDPDGGSCVFEVNGIPVGLLICEDLWFAEPLADT-VRAGAQLVVVPNASP 177

Query: 179 YYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
           Y   K  +R  ++  +       I Y+N VGGQD L+FDGAS   DG   +      F +
Sbjct: 178 YERGKHAQRDAVLAARTRESGAAIAYLNVVGGQDALVFDGASVVADGDGTVHPAAAAFVD 237

Query: 239 QNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIG 298
           Q  + E+    +    +   DD   +M      +   + A    ++DY +KN F KV +G
Sbjct: 238 QWLLVEYDGQTRRFMPHVWMDDGDESM------DALAWRAVTRGIQDYCRKNGFKKVWLG 291

Query: 299 LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDL 358
           LSGGIDSAL  A+AVDALG ENV  + LP +YT+  S + AA   +ALG K + + I   
Sbjct: 292 LSGGIDSALVLALAVDALGAENVTAVRLPSRYTAGMSNDLAAEQCQALGVKLEAVSIEPA 351

Query: 359 VNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTL 418
                  ++   +     +  EN+QSR RG ILMAL+N    +LLTT NKSE +VGY T+
Sbjct: 352 FKGLMESLAPMFEGTAPDVTEENLQSRSRGVILMALANKFGGLLLTTGNKSEYAVGYATI 411

Query: 419 YGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQT 478
           YGDM GG+ PLKDLYKT+VF L+ WRN+ G          VIPP+++ + PSAELR +Q 
Sbjct: 412 YGDMCGGYAPLKDLYKTEVFGLSKWRNTVGGA-------PVIPPAVISRPPSAELRENQL 464

Query: 479 DQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTK 537
           DQ+SLP Y +LD I+ R ++ E+S        Y+   V  V  L+  SE+KR QA  G K
Sbjct: 465 DQDSLPAYDVLDGILYRYIDQEQSRTEIVAAGYDAAVVDRVLRLVRISEWKRHQAAPGPK 524

Query: 538 ITAKSFGRDRLYPISNKFR 556
           ++ ++FGR+R YPISN ++
Sbjct: 525 VSRRAFGRERRYPISNGYK 543


>gi|33596092|ref|NP_883735.1| NAD synthetase [Bordetella parapertussis 12822]
 gi|33573095|emb|CAE36737.1| putative NAD synthetase [Bordetella parapertussis]
          Length = 544

 Score =  475 bits (1222), Expect = e-132,   Method: Composition-based stats.
 Identities = 228/558 (40%), Positives = 327/558 (58%), Gaps = 18/558 (3%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +   ++ IAQ+N  VGD+AGN A+  +A  +A  QG D+++  EL ++GYPPEDL+ +  
Sbjct: 1   MSLARVGIAQINACVGDLAGNAARVLQAARQAAGQGADVLVTPELVLTGYPPEDLLLRPR 60

Query: 62  FIQACSSAIDTLKSDTHDG-GAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           FIQ   +  + L  D     G  +V+G     Q+ + N+  ++  G ++    K  LPNY
Sbjct: 61  FIQEQQAVFERLCQDLAGLAGLHVVIGHVLARQDRLYNAATVVCEGRVLGSYCKRELPNY 120

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F E+R F +         + +R G+ ICEDIW      +     GA+ L   NASPY 
Sbjct: 121 SVFDEQRYFSAHGEAFGFTVKGVRFGLNICEDIW-LERAPRAAAADGAQVLLVSNASPYN 179

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K ++R  +    +      +IY N VGGQDEL+FDGASF  D Q +++ ++  F+E  
Sbjct: 180 TGKQEERLSVARRSVQDTGCALIYANLVGGQDELVFDGASFALDAQGRMSARLPDFTEGV 239

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            + E            +   +      P   EE  +NA VL +RDY+ KN F   IIGLS
Sbjct: 240 NVLEVD------ARGTVRPVTEQAAVQPYGLEEQVWNALVLGVRDYLGKNGFPGAIIGLS 293

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSA+  A+AVDA+G +NV+ +M+P +YT+  SL DAA  A+ LG +YDV+ I ++V+
Sbjct: 294 GGIDSAVVLAVAVDAVGADNVRAVMMPSRYTADISLTDAADMARRLGVQYDVIAIGEVVD 353

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F + ++      P     ENIQ+R RG +LMALSN +  ++LTT NKSE++ GY TLYG
Sbjct: 354 RFEAALAPQFAGLPVDATEENIQARARGTLLMALSNKTGRLVLTTGNKSEMTTGYCTLYG 413

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF  +KD+ KT V++LA+WRN             +IP  I+ + PSAELRP QTDQ
Sbjct: 414 DMAGGFAVIKDVPKTLVYRLANWRNQRQP---------IIPERIITRPPSAELRPDQTDQ 464

Query: 481 ESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY ILD II+R +E+  S  +     +  E V  V  L+  +EYKRRQAP G +IT
Sbjct: 465 DSLPPYDILDGIIERYMEHNASAADIVAAGFPREAVGQVVRLIRINEYKRRQAPPGPRIT 524

Query: 540 AKSFGRDRLYPISNKFRD 557
            ++FGRD  YP++N FR+
Sbjct: 525 PRAFGRDWRYPVTNGFRE 542


>gi|110833335|ref|YP_692194.1| NAD+ synthase [Alcanivorax borkumensis SK2]
 gi|110646446|emb|CAL15922.1| NAD+ synthase (glutamine-hydrolysing) [Alcanivorax borkumensis SK2]
          Length = 541

 Score =  475 bits (1222), Expect = e-132,   Method: Composition-based stats.
 Identities = 227/556 (40%), Positives = 309/556 (55%), Gaps = 22/556 (3%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQ-GMDLILFTELFISGYPPEDLVFKKSFI 63
           ++I +AQ N +VGDI GN  +   A +EA R  G DL+LF EL ++GYPPEDL+ + S  
Sbjct: 1   MRIIMAQQNALVGDIEGNAQRVIAASDEARRLLGADLVLFPELMLTGYPPEDLLLRPSLN 60

Query: 64  QACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNI--IAVRDKINLPNYS 121
               +A+  + +        +V+G+P        N+  ++  G         K +LPNY 
Sbjct: 61  SRVDAALADIGAAI---SVPVVLGYPAVRNGHRRNAAGVMFPGETGPRHEYFKQHLPNYR 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYH 181
            F EKR F  G            LGI ICEDIW        L+K G + + +LNASPY  
Sbjct: 118 VFDEKRYFQPGKDACTFDIDGWTLGITICEDIWHAGP-AAQLQKAGTDLILNLNASPYRI 176

Query: 182 NKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQNF 241
           NK  +R + V  +     LP++Y N VGGQDEL+FDGASF  D Q     Q   F+E   
Sbjct: 177 NKADERFDQVQARCRETGLPVLYCNLVGGQDELVFDGASFVCDSQGNRCVQAASFTEALV 236

Query: 242 MTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSG 301
             +        Q      +    +      +   Y A VL+ RDYV KN F   ++GLSG
Sbjct: 237 PVDV-------QCQGGHCEPRGEVLPLPGPQAGMYQALVLATRDYVNKNGFKGALLGLSG 289

Query: 302 GIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNH 361
           GIDSAL  A+AVDALG E V+ +M+P++YTS  SLEDA   A+ L   Y VLPI    N 
Sbjct: 290 GIDSALTLAVAVDALGPERVEAVMMPFQYTSAMSLEDAEKQARTLRVHYRVLPIEAAFNG 349

Query: 362 FFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGD 421
           F  ++ +           EN+Q+R RG +LMALSN + +++LTT NKSE++VGY TLYGD
Sbjct: 350 FMDILREPFAGTSRDTTEENLQARCRGVLLMALSNKNGSVVLTTGNKSEMAVGYATLYGD 409

Query: 422 MSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQE 481
           M+GGF+ LKD++KT VF L  WRN            E+IP  ++ + PSAEL P Q D +
Sbjct: 410 MAGGFSVLKDVFKTSVFNLCRWRNQQAGA-------EIIPDRVITRPPSAELAPDQVDSD 462

Query: 482 SLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITA 540
           SLP Y  LD I++R VE + S        ++ ETV  V  L   +EYKRRQA VG +++ 
Sbjct: 463 SLPDYDELDAILERYVEQDMSAEAVIRDGFDRETVYRVVKLTDRNEYKRRQAAVGPRVSR 522

Query: 541 KSFGRDRLYPISNKFR 556
           ++FG+DR YPI+N +R
Sbjct: 523 RAFGKDRRYPITNGWR 538


>gi|297182590|gb|ADI18749.1| NAD synthase [uncultured gamma proteobacterium HF4000_36I10]
          Length = 538

 Score =  475 bits (1222), Expect = e-132,   Method: Composition-based stats.
 Identities = 230/557 (41%), Positives = 320/557 (57%), Gaps = 23/557 (4%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M   + IA+AQ+NPVVGDI GN  K ++A  EA  +G  L +F EL ++GYPPEDL+ + 
Sbjct: 1   MGADVTIAMAQINPVVGDIVGNTEKIQQAAREAAAKGAQLAMFPELALTGYPPEDLLLRP 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
           S       A+  L +++ D    ++VG P      + N   +L  G + A+  K  LPNY
Sbjct: 61  SLRIRVDEALRQLAAESTD--IALLVGLPLHADGKLYNGAALLRGGKVEALYRKHRLPNY 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
             F E R F +G          +  GI ICEDIW +          GA+ + +LNASPY+
Sbjct: 119 RVFDEMRYFAAGSEASVFELDGVSFGITICEDIW-SPEPAAKAVAAGADLILNLNASPYH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K ++R  +V  +    ++P++YVNQVG QDEL+FDG SF       L  +    SE  
Sbjct: 178 VGKQREREAVVAERCRENNVPVLYVNQVGAQDELVFDGGSFALSSDGSLKARAHAVSETL 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +      + L+                  E    Y+A V+ +RDY+ KN F  V++GLS
Sbjct: 238 SLITLRDGEPLAGEVQPLG----------DELATIYDALVVGVRDYINKNGFKGVVLGLS 287

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDALG E V+ +M+P+KYTS  SLEDA A A  LG  Y V+ I  +  
Sbjct: 288 GGIDSALTLAIAVDALGAERVEAVMMPFKYTSGMSLEDAEAEANTLGVSYKVISIEPMYE 347

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
            F   + +     P     ENIQSRIRG +LMA+SN   +++LTT NKSE++VGY TLYG
Sbjct: 348 AFSEALREEFAGLPVDKTEENIQSRIRGGLLMAISNKKGSLVLTTGNKSEMAVGYATLYG 407

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM GGF  LKD+ K +VF L+ +RNS         L+ VIP  ++++ PSAEL P Q D+
Sbjct: 408 DMCGGFAVLKDVSKQRVFALSEYRNS---------LSPVIPQRVIDRPPSAELAPDQKDE 458

Query: 481 ESLPPYPILDDIIKRIVENEESFINNDQ-EYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           +SLPPY +LD I++  +E+++S        +  E V  V  L+  +EYKRRQA +GT+IT
Sbjct: 459 DSLPPYEVLDQILEHYIEHDQSAEAIIAMGFEREAVGQVVRLVDINEYKRRQAAIGTRIT 518

Query: 540 AKSFGRDRLYPISNKFR 556
            + FGRDR YPI+N+++
Sbjct: 519 ERGFGRDRRYPITNRWQ 535


>gi|171742677|ref|ZP_02918484.1| hypothetical protein BIFDEN_01791 [Bifidobacterium dentium ATCC
           27678]
 gi|171278291|gb|EDT45952.1| hypothetical protein BIFDEN_01791 [Bifidobacterium dentium ATCC
           27678]
          Length = 565

 Score =  475 bits (1222), Expect = e-131,   Method: Composition-based stats.
 Identities = 210/579 (36%), Positives = 310/579 (53%), Gaps = 37/579 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  ++ A+AQ++  VGD+  N  K       A  Q   +++F E+ ++GYP EDL  + +
Sbjct: 1   MTDIRFALAQIDTCVGDLDANADKVMHYAHLAAAQHAKVVVFPEMTLTGYPIEDLALRGT 60

Query: 62  FIQACSSAIDTLK-SDTHDG--GAGIVVGFP--RQDQEGVLNSVVILDAGNIIAVRDKIN 116
           F +A     + L      DG     +VVG     ++     N +V+L  G + A  DK  
Sbjct: 61  FRKAAWDKANWLATELAADGLDDLFVVVGTVGTDRENSKPRNRLVVLHDGVVWAGYDKHF 120

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LPNY  F E R F  G  +  +     R+G+ ICEDIW++      L KQ  + L ++N 
Sbjct: 121 LPNYGVFDEFRIFSPGNKSMVLDVDGARIGVAICEDIWQDGGPVAELAKQDIDLLLTMNG 180

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY   K   R ++   + + V+ P+IY+NQVGGQD+L+FDG SF  D    L  +   F
Sbjct: 181 SPYEEGKTDTRFDLAVRRAAEVNAPMIYLNQVGGQDDLVFDGGSFTVDADGTLLQRSPMF 240

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E   + +     +      ++D            +E  Y ACVL L+DY+ KN+F  V 
Sbjct: 241 MEDLALFDLDTTAERQSVGVIADKP--------DPDEEVYTACVLGLKDYMAKNHFKGVC 292

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL AA+A DA+G  NV  I +P  Y+S  S +DAA  A  +G  YD+ PI 
Sbjct: 293 LGLSGGIDSALVAAMAADAVGGNNVYGISMPSMYSSDGSKDDAADLANNIGAHYDIQPIE 352

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            L   +   +      +  G+ AEN+Q+RIRG I+MA SN    + + T NKSE++ GY 
Sbjct: 353 PLFVAYQKQL------DLEGVAAENLQARIRGVIVMAYSNSKGLLAVATGNKSELACGYS 406

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLG-----------------PLTEV 459
           T+YGD  GG+ P+KDL KT+V++++ WRN                          P   +
Sbjct: 407 TIYGDAVGGYAPIKDLLKTRVWEISRWRNKAAAAGMGIGGLHVVGNESGSAGVPLPDGVM 466

Query: 460 IPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYV 518
           IP + +EK+PSAELRP Q D +SLP Y +LD ++   +E+     +     +++ TV  V
Sbjct: 467 IPVNSIEKAPSAELRPGQKDSDSLPEYALLDQVLAMYIEHAHGRADLLADGFDEATVDTV 526

Query: 519 EHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
             L+  +E+KRRQ P+G K+TA +FGRDR  PI+N FR+
Sbjct: 527 MRLVDRAEWKRRQYPLGPKVTALAFGRDRRLPITNAFRE 565


>gi|251770857|gb|EES51444.1| NAD+ synthetase [Leptospirillum ferrodiazotrophum]
          Length = 593

 Score =  474 bits (1221), Expect = e-131,   Method: Composition-based stats.
 Identities = 222/602 (36%), Positives = 321/602 (53%), Gaps = 58/602 (9%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           ++ LK+ + Q+N VVGD+ GN A+ RR  E    + +D+  F EL I+GYPPEDL+ K +
Sbjct: 1   MRSLKVGLFQMNSVVGDLEGNAARIRRHLESPVAKSLDIAAFPELAITGYPPEDLLLKPT 60

Query: 62  FIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYS 121
           F++     + TL     +    ++VGF  Q  + + N+  I+  G ++ V+ K  LPNY 
Sbjct: 61  FLEKNRQVLATLFDMAPEL--LVIVGFVEQADD-IYNAAAIIYRGRLVGVQRKQYLPNYG 117

Query: 122 EFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQ-GAEFLFSLNASPYY 180
            F E R F SG SN  + +R+  +G+ ICEDIW       H      AE + +L+ASP++
Sbjct: 118 VFDENRYFQSGSSNTLVRYRNTTIGVNICEDIWYPKGPLYHQALDGDAEVIVNLSASPFH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K + R  ++  + +     I+Y N VGGQDEL+FDG S     + ++  + + F+E  
Sbjct: 178 AGKREVRESMLKTRAADNGTYIVYTNLVGGQDELVFDGQSLVISPEGEIECRGRAFAEDV 237

Query: 241 FMTEWHYDQ--------------------------------QLSQWNYMSDDSASTMY-- 266
            +TE   D+                                 L   N             
Sbjct: 238 VVTEIDVDRVFGVRLHDPRRRKEKLSRVYGADWGSFPMTMVDLDAMNGTPSPPPQKPRRL 297

Query: 267 ------IPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKEN 320
                  PL + E  Y A  + +RDYV KN    V++G+SGG+DSAL AAIA DALG   
Sbjct: 298 ERGPLNTPLSDVEEVYEALTMGVRDYVAKNRLTDVLVGISGGVDSALVAAIACDALGPAR 357

Query: 321 VQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEE-----PS 375
           V  + +P  YTS +S EDA A + ALG + + +PI +L + F S ++    +        
Sbjct: 358 VHGVFMPSVYTSAESREDATALSAALGFRLETIPIKELCDSFASALAPSFGDRHAKDPEG 417

Query: 376 GIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKT 435
               EN+Q RIRG +LMALSN    ++LTT NKSE+ VGY TLYGDM+GGF  LKD+ KT
Sbjct: 418 DTTDENLQPRIRGMLLMALSNKFGHLVLTTGNKSEMGVGYMTLYGDMAGGFAVLKDVPKT 477

Query: 436 QVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKR 495
           +V+ L   RNS G  +        IP  ILEK+P+AELRP Q D +SLP Y ILD I+  
Sbjct: 478 EVYALCRLRNSRGPGA--------IPERILEKAPTAELRPDQRDTDSLPSYDILDPIMAA 529

Query: 496 IVENEESFINND-QEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNK 554
            VE +  +     + ++   V  V  L+  SEYKRRQ+P G KI+ ++FG+D   P++N+
Sbjct: 530 YVEEDLGYEEIVGRGFDPADVARVIRLVDRSEYKRRQSPPGVKISLRAFGKDWRLPMTNR 589

Query: 555 FR 556
           F+
Sbjct: 590 FK 591


>gi|283456252|ref|YP_003360816.1| glutamine-dependent NAD(+) synthetase [Bifidobacterium dentium Bd1]
 gi|283102886|gb|ADB09992.1| nadE Glutamine-dependent NAD(+) synthetase [Bifidobacterium dentium
           Bd1]
          Length = 565

 Score =  474 bits (1220), Expect = e-131,   Method: Composition-based stats.
 Identities = 209/579 (36%), Positives = 310/579 (53%), Gaps = 37/579 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  ++ A+AQ++  VGD+  N  K       A  Q   +++F E+ ++GYP EDL  + +
Sbjct: 1   MTDIRFALAQIDTCVGDLDANADKVMHYAHLAAAQHAKVVVFPEMTLTGYPIEDLALRGT 60

Query: 62  FIQACSSAIDTLK-SDTHDG--GAGIVVGFP--RQDQEGVLNSVVILDAGNIIAVRDKIN 116
           F +A     + L      DG     +VVG     ++     N +V+L  G + A  DK  
Sbjct: 61  FRKAAWDKANWLATELAADGLDDLFVVVGTVGTDRENSKPRNRLVVLHDGVVWAGYDKHF 120

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LPNY  F E R F  G  +  +     R+G+ ICEDIW++      L KQ  + L ++N 
Sbjct: 121 LPNYGVFDEFRIFSPGNKSMVLDVDGARIGVAICEDIWQDGGPVAELAKQDIDLLLTMNG 180

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY   K   R ++   + + V+ P+IY+NQVGGQD+L+FDG SF  D    L  +   F
Sbjct: 181 SPYEEGKTDTRFDLAVRRAAEVNAPMIYLNQVGGQDDLVFDGGSFTVDADGTLLQRSPMF 240

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E   + +     +      ++D            +E  Y ACVL L+DY+ KN+F  V 
Sbjct: 241 MEDLALFDLDTTAERQSVGVIADKP--------DPDEEVYTACVLGLKDYMAKNHFKGVC 292

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL AA+A DA+G  NV  I +P  Y+S  S +DAA  A  +G  YD+ PI 
Sbjct: 293 LGLSGGIDSALVAAMAADAVGGNNVYGISMPSMYSSDGSKDDAADLANNIGAHYDIQPIE 352

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            L   +   +      +  G+ AEN+Q+RIRG I+MA SN    + + T NKSE++ GY 
Sbjct: 353 PLFVAYQKQL------DLEGVAAENLQARIRGVIVMAYSNSKGLLAVATGNKSELACGYS 406

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLG-----------------PLTEV 459
           T+YGD  GG+ P+KDL KT+V++++ WRN                          P   +
Sbjct: 407 TIYGDAVGGYAPIKDLLKTRVWEISRWRNKAAAAGMGIGGLHVVGNESGSAGVPLPDGVM 466

Query: 460 IPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYV 518
           IP + +EK+PSAELRP Q D +SLP Y +LD ++   +E+     +     +++ T+  V
Sbjct: 467 IPVNSIEKAPSAELRPGQKDSDSLPEYALLDQVLAMYIEHAHGRADLLADGFDEATIDTV 526

Query: 519 EHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
             L+  +E+KRRQ P+G K+TA +FGRDR  PI+N FR+
Sbjct: 527 MRLVDRAEWKRRQYPLGPKVTALAFGRDRRLPITNAFRE 565


>gi|284991820|ref|YP_003410374.1| NAD+ synthetase [Geodermatophilus obscurus DSM 43160]
 gi|284065065|gb|ADB76003.1| NAD+ synthetase [Geodermatophilus obscurus DSM 43160]
          Length = 611

 Score =  474 bits (1220), Expect = e-131,   Method: Composition-based stats.
 Identities = 222/609 (36%), Positives = 321/609 (52%), Gaps = 59/609 (9%)

Query: 1   MLK--KLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVF 58
           M +  +L++A+AQ++  VGDIAGN A        A   G  +++F E+ ++GYPPEDLV 
Sbjct: 1   MSEPVQLRVALAQVDTRVGDIAGNAALVTTWTAIAAEDGAHVVVFPEMTLTGYPPEDLVL 60

Query: 59  KKSFIQACSSAIDTLKSDTHDGGA---GIVVG---------------FPRQDQ------- 93
           ++SF QA   A+  L  D  + G     +VVG                P  D        
Sbjct: 61  RESFAQASEKALVELAGDLAERGLGDTAVVVGYLAHTEGIGPATTESMPGDDDRPADANP 120

Query: 94  --EGVLNSVVILDAGNIIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICE 151
                 N+  +L  G ++    K +LPNY  F E R F+ G     +    + + + +CE
Sbjct: 121 RRGAPRNAAALLHGGEVVVRYHKRHLPNYGVFDEARYFVPGTELPVVRLHGVDVALTVCE 180

Query: 152 DIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQ 211
           D+W     C    + G + + S NASPY   K   R  +V  + +     ++Y NQVGGQ
Sbjct: 181 DLWVEGGPCGVAGEAGVDLVLSPNASPYERAKDDLRLPLVRRRAAEARATVVYCNQVGGQ 240

Query: 212 DELIFDGASFCFDGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMS------------- 258
           DEL+FDG S       +L  +   F E     +   D+                      
Sbjct: 241 DELVFDGDSMAVAPDGELLGRAPQFVEHLLCVDLRVDRSAVPDRREGRFGPMTVTRHVLS 300

Query: 259 -------DDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAI 311
                  D   +++  PL + E  + A VL LRD++ KN    V++GLSGGIDSA+CAA+
Sbjct: 301 EEPVPAFDPRPASVAEPLSDCEEVWRALVLGLRDFIDKNGMPSVVLGLSGGIDSAVCAAL 360

Query: 312 AVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQ 371
           AVDALG + V  + LP +Y+S  SL DA   A+  G  Y V+PI  +V+ + S +     
Sbjct: 361 AVDALGADRVYGVGLPSRYSSEHSLADAEDLARRTGLHYSVVPIAPMVDAYHSSV----- 415

Query: 372 EEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKD 431
            E SG+ AEN+Q+R+RG +LM LSN    +LLTT NKSEI+VGY TLYGD +GGF P+KD
Sbjct: 416 -ELSGVAAENLQARVRGTLLMGLSNQHGHLLLTTGNKSEIAVGYSTLYGDSAGGFAPIKD 474

Query: 432 LYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDD 491
           + KT V+ LA WRN +    G    TE IP + +EK PSAEL P Q D +SLP Y  LD 
Sbjct: 475 VPKTLVWALARWRNEYARGRG---ETEPIPVNSIEKPPSAELAPGQVDTDSLPSYEELDA 531

Query: 492 IIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYP 550
           ++   V+ +       ++ ++ E V  V  L+  +E+KRRQ+  GTKI+ K+FGRDR  P
Sbjct: 532 VVADYVDRDLGMGELLERGHDPEVVARVLRLVDAAEFKRRQSAPGTKISLKAFGRDRRLP 591

Query: 551 ISNKFRDHI 559
           ++N++R+ +
Sbjct: 592 VTNRWRETL 600


>gi|296269233|ref|YP_003651865.1| NAD+ synthetase [Thermobispora bispora DSM 43833]
 gi|296092020|gb|ADG87972.1| NAD+ synthetase [Thermobispora bispora DSM 43833]
          Length = 584

 Score =  474 bits (1220), Expect = e-131,   Method: Composition-based stats.
 Identities = 218/596 (36%), Positives = 309/596 (51%), Gaps = 49/596 (8%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           + +L+IA+AQ NPVVGDI GN          A  +   L+ F E+F++GYPPEDLV + S
Sbjct: 1   MAQLRIALAQTNPVVGDITGNAEMLVEWTRRAAERNAHLVAFPEMFLTGYPPEDLVLRSS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAG---IVVGFPRQDQ---------EGVLNSVVILDAGNII 109
           F++A +SA+          G G   ++VG+  +              L++  +L  G +I
Sbjct: 61  FVEASTSALTAAAERLAAEGLGDLPVIVGYLDRAGLTPRVGQPKGAPLDAAALLHRGRVI 120

Query: 110 AVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAE 169
               K +LPNY  F E R F+ G          I + + ICED+W++      + + GA 
Sbjct: 121 TKSAKHHLPNYGVFDEHRYFVRGDRLPIFRLHGIDVAVAICEDLWQDGGPVSVVGEVGAG 180

Query: 170 FLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQL 229
            L  LN SPY  NK   R E+   +       I YVN VGGQDEL+FDG S       +L
Sbjct: 181 LLVVLNGSPYEMNKDDVRLELCARRAREAGCTIAYVNLVGGQDELVFDGDSLIVSPTGEL 240

Query: 230 AFQMKHFSEQNFMTEWHYDQQLSQW----------------NYMSDDSASTMYIP----- 268
             +   F+E+  + +    +   +                  +         Y P     
Sbjct: 241 IARAAQFTEELLVADLDLPEGTGEPGEVRVDARDGTVITVERFTISAEPVAPYEPEPARI 300

Query: 269 ---LQEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIM 325
              L +    Y A VL  RDYV KN F  VI+GLSGGIDSAL A IAVDALG   V  ++
Sbjct: 301 AERLDDLAEVYQALVLGTRDYVTKNGFRSVILGLSGGIDSALTATIAVDALGPSRVHAVL 360

Query: 326 LPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSR 385
           +P +Y+S  S+ DA    +  G     +PI  ++  F   +S        G+ AEN+Q+R
Sbjct: 361 MPSRYSSEHSIIDAEELVRRQGINAVTVPITGIMEAFEKEIS------LHGLAAENLQAR 414

Query: 386 IRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRN 445
           IRG ILM+LSN    ++LTT NKSE++ GY TLYGD +GGF P+KD+ KT V++LA WRN
Sbjct: 415 IRGMILMSLSNEHGHLVLTTGNKSELATGYSTLYGDSAGGFAPIKDVLKTMVWRLAEWRN 474

Query: 446 SHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN 505
           +        P       + + K PSAELRP Q D +SLPPY +LD +++  VE +     
Sbjct: 475 AQPPGPPPIP------ENSITKEPSAELRPGQRDTDSLPPYHVLDPLLRDYVERDMGRDE 528

Query: 506 -NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHIS 560
                ++ E V  V  ++  +EYKRRQ P G KIT K+FGRDR  P++N++R+ ++
Sbjct: 529 LIAAGHDPELVTRVIRMVDRAEYKRRQYPPGPKITPKNFGRDRRLPLTNRWRERLA 584


>gi|304415435|ref|ZP_07396084.1| putative NAD synthase [Candidatus Regiella insecticola LSR1]
 gi|304282699|gb|EFL91213.1| putative NAD synthase [Candidatus Regiella insecticola LSR1]
          Length = 546

 Score =  474 bits (1219), Expect = e-131,   Method: Composition-based stats.
 Identities = 233/557 (41%), Positives = 342/557 (61%), Gaps = 20/557 (3%)

Query: 1   MLKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK 60
           M + L IA+AQLN +VGDI GN  +  RA ++   +  DL++F+EL + GYPPEDL+F+ 
Sbjct: 2   MNRSLSIALAQLNLLVGDIKGNTDRILRALKQQRGR-ADLVMFSELALCGYPPEDLLFRA 60

Query: 61  SFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNY 120
            F Q C + +  L+  +      I+VG P +  + + N++     G ++    K  LPN+
Sbjct: 61  DFNQLCITQLARLQKAS--VHTAILVGHPWKQGDQLYNALSFFSEGKLLGRYFKQLLPNH 118

Query: 121 SEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYY 180
           S F EKR F  G ++  + F+  RLG+LICEDIW + +    LK  GAE L S+NASPY+
Sbjct: 119 SVFDEKRYFTPGNTSCIVEFKGYRLGMLICEDIW-SPDPVDALKNLGAEVLLSINASPYH 177

Query: 181 HNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSEQN 240
             K   R++++        LP++Y+NQVG QDELIFDG S  F+ Q  L  ++  FSE++
Sbjct: 178 REKPYIRNQLLINHCKGTTLPLVYLNQVGVQDELIFDGCSKVFNAQGDLIHRLAAFSEES 237

Query: 241 FMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVIIGLS 300
            +  ++  +  SQ        A T           Y+A V+++RDYV KN F   I+GLS
Sbjct: 238 LV--FNLKELASQ------QIAETAIDADHPLAQIYDALVMAVRDYVNKNGFKTAILGLS 289

Query: 301 GGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVN 360
           GGIDSAL  AIAVDAL  +NVQ +M+P++YTS +S+  A   A+    +   + IH + +
Sbjct: 290 GGIDSALTLAIAVDALTAKNVQALMMPFRYTSEESINYARQQAQKQKIELKEIDIHPIFD 349

Query: 361 HFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYG 420
                ++ F  +       EN+Q+R RG +LMA++N    ++LTT NKSE++VGY TLYG
Sbjct: 350 AVMGQLAPFFADRKKDTTEENLQARCRGMLLMAMANKFGHIVLTTGNKSELAVGYSTLYG 409

Query: 421 DMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAELRPHQTDQ 480
           DM+GGF+ LKD+ KT VF+LA +RN+           EVIP +++++ PSAEL P+QTDQ
Sbjct: 410 DMAGGFDVLKDVSKTLVFKLAKYRNAR-------DGVEVIPQAVIDRPPSAELAPNQTDQ 462

Query: 481 ESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKIT 539
           + LPPY +LD I++  +E +ES  +   Q  ++ TVR V HL+  +E+KRRQA +G +IT
Sbjct: 463 DQLPPYAVLDKILEGYLEKDESVTDLVAQGCDEATVRKVIHLVDSNEHKRRQAAIGPRIT 522

Query: 540 AKSFGRDRLYPISNKFR 556
            + FG+DR YPI+N FR
Sbjct: 523 CRDFGKDRRYPITNGFR 539


>gi|212715673|ref|ZP_03323801.1| hypothetical protein BIFCAT_00573 [Bifidobacterium catenulatum DSM
           16992]
 gi|212661040|gb|EEB21615.1| hypothetical protein BIFCAT_00573 [Bifidobacterium catenulatum DSM
           16992]
          Length = 565

 Score =  474 bits (1219), Expect = e-131,   Method: Composition-based stats.
 Identities = 211/579 (36%), Positives = 310/579 (53%), Gaps = 37/579 (6%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  ++ A+AQ++  VGD+  N  K  R    A      +++F E+ ++GYP EDL  + +
Sbjct: 1   MTDIRFALAQIDTCVGDLDSNADKVMRYAHLAANNNAQVVVFPEMTLTGYPIEDLALRAT 60

Query: 62  FIQACSSAIDTLKSDTHDGGAG---IVVGFP--RQDQEGVLNSVVILDAGNIIAVRDKIN 116
           F +A  +  + L ++    G G   +VVG     ++     N +V+L  G + A  DK  
Sbjct: 61  FRKAAWNKANWLATELAADGLGDLFVVVGTVGTDRETSKPRNRLVVLHDGVVWAGYDKHF 120

Query: 117 LPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNA 176
           LPNY  F E R F  G  +  +     R+G+ ICEDIW++      L +Q  + L ++N 
Sbjct: 121 LPNYGVFDEFRIFSPGNKSMVLDVDGARIGVAICEDIWQDGGPVAELAEQHIDLLLTMNG 180

Query: 177 SPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHF 236
           SPY   K   R ++   + + V+ P+IY+NQVGGQD+L+FDG SF  D    L  +   F
Sbjct: 181 SPYEEGKTDTRLDLAVRRAAEVNAPMIYLNQVGGQDDLVFDGGSFVVDADGTLLERSPMF 240

Query: 237 SEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSLRDYVQKNNFHKVI 296
            E     +                    +      +E  Y ACVL L+DY+ KN+F  V 
Sbjct: 241 MEDLSFFDLD--------TAAEHQQVGVIAAKPDPDEEVYTACVLGLKDYMAKNHFKGVC 292

Query: 297 IGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIH 356
           +GLSGGIDSAL AA+A DA+G  NV  I +P  Y+S  S +DAA  AK +G  YDV PI 
Sbjct: 293 LGLSGGIDSALVAAMAADAVGGSNVYGISMPSMYSSDGSKDDAADLAKNIGAHYDVQPIE 352

Query: 357 DLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLLTTSNKSEISVGYG 416
            L   F   +      +  G+ AEN+Q+RIRG I+MA SN    + + T NKSE++ GY 
Sbjct: 353 PLFVSFQKQL------DLEGVAAENLQARIRGVIVMAYSNSKGLLAVATGNKSELACGYS 406

Query: 417 TLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLG-----------------PLTEV 459
           T+YGD  GG+ P+KDL KT+V++++ WRN                          P   +
Sbjct: 407 TIYGDAVGGYAPIKDLLKTRVWEISRWRNKAAAEGMGIGGLHVVGNEQGSKGTPLPDGVM 466

Query: 460 IPPSILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFIN-NDQEYNDETVRYV 518
           IP + +EK+PSAELRP Q D +SLP Y +LD ++   +E+     +     +++ TV  V
Sbjct: 467 IPVNSIEKAPSAELRPGQKDSDSLPEYELLDQVLAMYIEHAHGREDLLADGFDETTVDTV 526

Query: 519 EHLLYGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRD 557
             L+  +E+KRRQ P+G K+TA +FGRDR  PI+N FR+
Sbjct: 527 MRLVDRAEWKRRQYPLGPKVTALAFGRDRRLPITNAFRE 565


>gi|254424253|ref|ZP_05037971.1| NAD synthase family [Synechococcus sp. PCC 7335]
 gi|196191742|gb|EDX86706.1| NAD synthase family [Synechococcus sp. PCC 7335]
          Length = 568

 Score =  474 bits (1219), Expect = e-131,   Method: Composition-based stats.
 Identities = 213/580 (36%), Positives = 313/580 (53%), Gaps = 39/580 (6%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQ 64
           +KIAIAQ+NP VGD++GN  +   A  +A   G DL+L  EL + GYPP DL+ + SFI 
Sbjct: 1   MKIAIAQINPTVGDLSGNAQRILEAAIQAADLGADLVLTPELSLCGYPPRDLLMRPSFIT 60

Query: 65  ACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG-------VLNSVVILDAGNIIAVRDKINL 117
                 + L          ++VG    +          + NS+ +L +G +  V  K  L
Sbjct: 61  KTKRQAEALAKALPS-DLSVLVGIAEDNPSAAMQGQKPIFNSMALLQSGKVKEVFHKRLL 119

Query: 118 PNYSEFHEKRTFISGYSNDPI----VFRDIRLGILICEDIWKNSNIC----------KHL 163
           P Y  F E R F SG              I +G+ ICED+W N              + L
Sbjct: 120 PTYDVFDEDRYFESGTKASSFLLQAERESIHVGVTICEDLWNNETFWGKRTYSINPTQEL 179

Query: 164 KKQGAEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCF 223
            + G + + +L+ASPY + K   R +++  +       I+YVNQVGG D+LIFDG S  F
Sbjct: 180 VENGVDLVVNLSASPYVYAKQVLREDMIAHEAKQHQRAIVYVNQVGGNDDLIFDGQSVAF 239

Query: 224 DGQQQLAFQMKHFSEQNFMTEWHYDQQLSQWNYMSDDSASTMYIPLQEEEADYNACVLSL 283
           + Q +L  +   FS    +  +  D+Q  Q        A      L  +   ++A VL +
Sbjct: 240 NRQGELVCRAAAFSTDLKLVNFDIDKQDLQ-------PAVIETTLLAADAEIWSALVLGV 292

Query: 284 RDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAAACA 343
           +DY +K  F K +IGLSGGIDSAL +AIA +ALG +NV  +++P  Y+S  S+ DA   A
Sbjct: 293 KDYARKCGFRKAVIGLSGGIDSALVSAIAAEALGPQNVLGVLMPSPYSSKHSISDAEQLA 352

Query: 344 KALGCKYDVLPIHDLVNHFFSLMSQFLQEEPSGIVAENIQSRIRGNILMALSNHSKAMLL 403
           K +G   + +PI  L++ +   +    +   S +  EN+QSRIRGN+LMA+SN    +LL
Sbjct: 353 KNIGIPTETIPIGQLMSGYEKTLDDLFKGTESDVTEENLQSRIRGNLLMAVSNKFGHLLL 412

Query: 404 TTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPS 463
           TT NKSE++VGY TLYGDM+GG   + D+ KT+V+ +  W N             +IP +
Sbjct: 413 TTGNKSEMAVGYCTLYGDMNGGLAVIADVPKTRVYSICRWLNRKQ---------ALIPNN 463

Query: 464 ILEKSPSAELRPHQTDQESLPPYPILDDIIKRIVENEESFINN-DQEYNDETVRYVEHLL 522
           I+ K PSAEL+P Q DQ+SLP Y ILDDI++R+V+ ++S  +     +   TV  V  L+
Sbjct: 464 IITKPPSAELKPGQVDQDSLPDYEILDDILERLVQKQQSADDIVAAGHPAATVEKVVRLV 523

Query: 523 YGSEYKRRQAPVGTKITAKSFGRDRLYPISNKFRDHISEE 562
             SE+KRRQ P   K+T ++FG     PI++++   +S E
Sbjct: 524 TRSEFKRRQTPPVLKVTDRAFGMGWRMPIASQWSLELSAE 563


>gi|302869087|ref|YP_003837724.1| NAD+ synthetase [Micromonospora aurantiaca ATCC 27029]
 gi|315504440|ref|YP_004083327.1| nad+ synthetase [Micromonospora sp. L5]
 gi|302571946|gb|ADL48148.1| NAD+ synthetase [Micromonospora aurantiaca ATCC 27029]
 gi|315411059|gb|ADU09176.1| NAD+ synthetase [Micromonospora sp. L5]
          Length = 586

 Score =  474 bits (1219), Expect = e-131,   Method: Composition-based stats.
 Identities = 222/593 (37%), Positives = 322/593 (54%), Gaps = 46/593 (7%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           +  L++A+ Q+NP VGD+AGN    R    +A   G  L+LF EL ++GYP EDLVF++S
Sbjct: 1   MPTLRLALCQVNPTVGDLAGNAGLVRSWTRQAADAGAQLVLFPELMLTGYPVEDLVFRRS 60

Query: 62  FIQACSSAIDTLKSDTHDGGAG---IVVGFPRQD-----------QEGVLNSVVILDAGN 107
           F+ A  +A+  L +D    G G   ++VG+   D             G  N+  +L  G 
Sbjct: 61  FVAASRAALHRLAADLAADGLGDLPVLVGYLDADGPPQVSSDAEPGRGARNAAAVLHRGE 120

Query: 108 IIAVRDKINLPNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQG 167
           ++A   K +LPNY  F E R F+SG +   +    + + + ICED+W+        ++ G
Sbjct: 121 VVATYFKHHLPNYGVFDEDRYFVSGDTLTVVRVGGVDVALTICEDLWQAGGPFAVAREAG 180

Query: 168 AEFLFSLNASPYYHNKLKKRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQ 227
              + S+N SPY  NK   R  +V  + +     I YVN VGGQDEL++DG S       
Sbjct: 181 VGLVLSINGSPYELNKDDVRLPLVRRRAAEAGAAIAYVNMVGGQDELVYDGDSMVVAADG 240

Query: 228 QLAFQMKHFSEQNFMTEWHY-------DQQLSQWNYMSDDSASTMYIPL----------- 269
            L  +   F E   + +             ++  + M         IP