RPSBLAST alignment for GI: 254780999 and conserved domain: cd07566

>gnl|CDD|143590 cd07566, ScNTA1_like, Saccharomyces cerevisiae N-terminal amidase NTA1, and related proteins (class 3 nitrilases). Saccharomyces cerevisiae NTA1 functions in the N-end rule protein degradation pathway. It specifically deaminates the N-terminal asparagine and glutamine residues of substrates of this pathway, to aspartate and glutamate respectively, these latter are the destabilizing residues. This subgroup belongs to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 3. Length = 295
 Score = 51.6 bits (124), Expect = 7e-07
 Identities = 41/178 (23%), Positives = 70/178 (39%), Gaps = 38/178 (21%)

Query: 6   KIAIAQLNPVVGDIAGNIAKA----RRAREEANRQGMDLILFTELFISGY--------PP 53
           +IA  QLNP +G +  N+++A     + ++ A  +  D+++  EL ++GY         P
Sbjct: 1   RIACLQLNPQIGQVEENLSRAWELLDKTKKRAKLKKPDILVLPELALTGYNFHSLEHIKP 60

Query: 54  --EDLVFKKSFIQACSSAIDTLKSDTHDGGAGIVVGFPRQDQEG---VLNSVVILDA-GN 107
             E      SF  A   A    K + H     +V+G+P +  E    + NS +++D  G 
Sbjct: 61  YLEPTTSGPSFEWAREVA---KKFNCH-----VVIGYPEKVDESSPKLYNSALVVDPEGE 112

Query: 108 IIAVRDKINLPNYSE-----------FHEKRTFISGYSNDP-IVFRDIRLGILICEDI 153
           ++    K  L    E                 F      D   V   ++  I IC D+
Sbjct: 113 VVFNYRKSFLYYTDEEWGCEENPGGFQTFPLPFAKDDDFDGGSVDVTLKTSIGICMDL 170