RPSBLAST alignment for GI: 254780999 and conserved domain: cd07570

>gnl|CDD|143594 cd07570, GAT_Gln-NAD-synth, Glutamine aminotransferase (GAT, glutaminase) domain of glutamine-dependent NAD synthetases (class 7 and 8 nitrilases). Glutamine-dependent NAD synthetases are bifunctional enzymes, which have an N-terminal GAT domain and a C-terminal NAD+ synthetase domain. The GAT domain is a glutaminase (EC 3.5.1.2) which hydrolyses L-glutamine to L-glutamate and ammonia. The ammonia is used by the NAD+ synthetase domain in the ATP-dependent amidation of nicotinic acid adenine dinucleotide. Glutamine aminotransferases are categorized depending on their active site residues into different unrelated classes. This class of GAT domain belongs to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to classes 7 and 8. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer. Mycobacterium tuberculosis glutamine-dependent NAD+ synthetase forms a homooctamer. Length = 261
 Score =  299 bits (769), Expect = 1e-81
 Identities = 97/233 (41%), Positives = 138/233 (59%)

Query: 6   KIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQA 65
           +IA+AQLNP VGD+ GN  K   A  EA  QG DL++F EL ++GYPPEDL+ +  F++A
Sbjct: 1   RIALAQLNPTVGDLEGNAEKILEAIREAKAQGADLVVFPELSLTGYPPEDLLLRPDFLEA 60

Query: 66  CSSAIDTLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDAGNIIAVRDKINLPNYSEFHE 125
              A++ L + T D    +VVG P +    + N+  +L  G I+ V  K  LPNY  F E
Sbjct: 61  AEEALEELAAATADLDIAVVVGLPLRHDGKLYNAAAVLQNGKILGVVPKQLLPNYGVFDE 120

Query: 126 KRTFISGYSNDPIVFRDIRLGILICEDIWKNSNICKHLKKQGAEFLFSLNASPYYHNKLK 185
           KR F  G   D + F+ +R+G+ ICED+W        L   GA+ + +L+ASP++  K  
Sbjct: 121 KRYFTPGDKPDVLFFKGLRIGVEICEDLWVPDPPSAELALAGADLILNLSASPFHLGKQD 180

Query: 186 KRHEIVTGQISHVHLPIIYVNQVGGQDELIFDGASFCFDGQQQLAFQMKHFSE 238
            R E+V+ + +   LP +YVNQVGGQD+L+FDG SF  D   +L  +   F E
Sbjct: 181 YRRELVSSRSARTGLPYVYVNQVGGQDDLVFDGGSFIADNDGELLAEAPRFEE 233