RPSBLAST alignment for GI: 254780999 and conserved domain: pfam06508

>gnl|CDD|148238 pfam06508, ExsB, ExsB. This family includes putative transcriptional regulators from Bacteria and Archaea. Length = 137
 Score = 40.6 bits (96), Expect = 0.001
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 294 KVIIGLSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQS--LEDAAACAKALGCKYD 351
           K ++ LSGG+DS  C A A    G E      L + Y    S  LE A   AKALG ++ 
Sbjct: 1   KAVVLLSGGLDSTTCLAWAKKE-GYE---VYALTFDYGQRHSKELECAKKIAKALGVEHK 56

Query: 352 VLPI 355
           ++ +
Sbjct: 57  IVDL 60