RPSBLAST alignment for GI: 254780999 and conserved domain: PLN02339

>gnl|CDD|177973 PLN02339, PLN02339, NAD+ synthase (glutamine-hydrolysing). Length = 700
 Score = 63.9 bits (156), Expect = 9e-11
 Identities = 135/614 (21%), Positives = 206/614 (33%), Gaps = 166/614 (27%)

Query: 5   LKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKK-SFI 63
           LK+A   LN    D  GN+ + + +  EA   G    +  EL I+GY  ED   +  +  
Sbjct: 4   LKVATCNLNQWAMDFDGNLKRIKESIAEAKAAGAVYRVGPELEITGYGCEDHFLELDTVT 63

Query: 64  QACSSAIDTLKSDTHDGGAGIV--VGFPRQDQEGVL-NSVVILDAGNIIAVRDKINLPNY 120
            +     + L  D  D   GI+  +G P     GV  N  V      I+ +R K+ L N 
Sbjct: 64  HSWECLAEILVGDLTD---GILCDIGMPVI-HGGVRYNCRVFCLNRKILLIRPKMWLAND 119

Query: 121 SEFHEKRTFISGYSNDPIV-------------------------FRDIRLGILICEDIWK 155
             + E R F +      +                          F D  +    CE+++ 
Sbjct: 120 GNYRELRWFTAWKHKKKVEDFQLPEEIAEATSQKSVPFGDGYLQFLDTAVAAETCEELFT 179

Query: 156 NSNICKHLKKQGAEFLFSLNASPYYHN--KLKKRHEI---VTGQISHVHLPIIYVNQVGG 210
                  L   G E +   N S  +H   KL  R ++    T +   V+L   Y NQ G 
Sbjct: 180 PQAPHIDLALNGVEII--SNGSGSHHQLRKLNTRLDLIRSATHKCGGVYL---YANQRG- 233

Query: 211 QDELIFDGASFCFDG-------------QQQLAFQ--------------------MKHFS 237
                 DG    +DG               Q + Q                    +  F 
Sbjct: 234 -----CDGGRLYYDGCACIVVNGEVVAQGSQFSLQDVEVVTACVDLDAVVSFRGSISSFR 288

Query: 238 EQ----NFMTEWHYDQQLSQWNYMSDDSASTMYIPL-------QEEEADYNACVLSLRDY 286
           EQ      +       +L          +     PL       +EE A   AC   L DY
Sbjct: 289 EQASSKKRVPSVAVPFKLCP----PFSLSLVPSSPLKIRYHSPEEEIALGPAC--WLWDY 342

Query: 287 VQKNNFHKVIIGLSGGIDSALCAAI-------------------AVDA------------ 315
           ++++     ++ LSGG DS+  AAI                     DA            
Sbjct: 343 LRRSGASGFLLPLSGGADSSSVAAIVGSMCQLVVKAIREGDEQVKADARRIGNYADGEVP 402

Query: 316 -----LGKENVQTIMLPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFSLMSQFL 370
                  K    T+ +  + +S ++   A   A  +G  +  + I  +V+   SL     
Sbjct: 403 TDSKEFAKRIFYTVYMGSENSSEETRSRAKQLADEIGSSHLDVKIDGVVSAVLSLFQTLT 462

Query: 371 QEEP-----SGIVAEN-----IQSRIRGNILMALSN-----HSKA---MLLTTSNKSEIS 412
            + P      G  AEN     IQ+RIR  +   L++       K+   ++L ++N  E  
Sbjct: 463 GKRPRYKVDGGSNAENLALQNIQARIRMVLAFMLASLLPWVRGKSGFLLVLGSANVDEGL 522

Query: 413 VGYGTLYGDMSGGFNPLKDLYKTQVFQLASWRNSHGITSGLGPLTEVIPPSILEKSPSAE 472
            GY T Y   S   NP+  + K  +     W  ++    G   L EV         P+AE
Sbjct: 523 RGYLTKYDCSSADINPIGGISKQDLRSFLRWAATN---LGYPSLAEVE-----AAPPTAE 574

Query: 473 LRP-----HQTDQE 481
           L P      QTD+E
Sbjct: 575 LEPIRDDYSQTDEE 588