RPSBLAST alignment for GI: 254780999 and conserved domain: PLN02747

>gnl|CDD|178348 PLN02747, PLN02747, N-carbamolyputrescine amidase. Length = 296
 Score = 47.5 bits (113), Expect = 9e-06
 Identities = 45/167 (26%), Positives = 72/167 (43%), Gaps = 18/167 (10%)

Query: 17  GDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKSFIQACSS-----AID 71
            D A N+ KA R   EA+ +G ++IL  ELF   Y  +    ++ F Q          I 
Sbjct: 18  DDRAANVDKAERLVREAHAKGANIILIQELFEGYYFCQ--AQREDFFQRAKPYEGHPTIA 75

Query: 72  TLKSDTHDGGAGIVVGFPRQDQEGVLNSVVILDA-GNIIAVRDKINLPNYSEFHEKRTFI 130
            ++    + G  I V F  +      NS+ I+DA G  + +  K ++P+   + EK  F 
Sbjct: 76  RMQKLAKELGVVIPVSFFEEANNAHYNSIAIIDADGTDLGLYRKSHIPDGPGYQEKFYFN 135

Query: 131 SGYSNDPIVFRDI-----RLGILICEDIWKNSNICKHLKKQGAEFLF 172
            G +     F+       ++G+ IC D W      + +  QGAE L 
Sbjct: 136 PGDTG----FKVFDTKFAKIGVAICWDQW-FPEAARAMVLQGAEVLL 177