RPSBLAST alignment for GI: 254780999 and conserved domain: cd01991

>gnl|CDD|30178 cd01991, Asn_Synthase_B_C, The C-terminal domain of Asparagine Synthase B. This domain is always found associated n-terminal amidotransferase domain. Family members that contain this domain catalyse the conversion of aspartate to asparagine. Asparagine synthetase B catalyzes the assembly of asparagine from aspartate, Mg(2+)ATP, and glutamine. The three-dimensional architecture of the N-terminal domain of asparagine synthetase B is similar to that observed for glutamine phosphoribosylpyrophosphate amidotransferase while the molecular motif of the C-domain is reminiscent to that observed for GMP synthetase .. Length = 269
 Score = 42.8 bits (100), Expect = 2e-04
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 7/99 (7%)

Query: 283 LRDYVQKNNFHKVIIG--LSGGIDSALCAAIAVDALGKENVQTIMLPYKYTSPQSLEDAA 340
           L D V++     V +G  LSGG+DS+L AA+A   L  E V+T  + + +      E A 
Sbjct: 4   LEDAVRRRLRSDVPVGVLLSGGLDSSLVAALA-ARLLPEPVKTFSIGFGFEGSDEREYAR 62

Query: 341 ACAKALGCKYDVLPI--HDLVNHFFSLMSQFLQEEPSGI 377
             A+ LG ++  +     DL+     ++  +  +EP   
Sbjct: 63  RVAEHLGTEHHEVEFTPADLLAALPDVI--WELDEPFAD 99