RPSBLAST alignment for GI: 254780999 and conserved domain: COG0171

>gnl|CDD|30520 COG0171, NadE, NAD synthase [Coenzyme metabolism]. Length = 268
 Score =  254 bits (649), Expect = 7e-68
 Identities = 117/287 (40%), Positives = 157/287 (54%), Gaps = 31/287 (10%)

Query: 270 QEEEADYNACVLSLRDYVQKNNFHKVIIGLSGGIDSALCAAIAVDALGK----ENVQTIM 325
            + E + N  V  LRDY++K  F  V++GLSGGIDSAL  A+AV ALGK    ENV  + 
Sbjct: 3   IDLEEEINRLVDFLRDYLKKAGFKGVVLGLSGGIDSALVLALAVRALGKGDSKENVLAVR 62

Query: 326 LPYKYTSPQSLEDAAACAKALGCKYDVLPIHDLVNHFFS-LMSQFLQEEPSGIVAENIQS 384
           LPY YT     EDA   A+ALG  Y  + I   V+ F   L+  FL      +   NI++
Sbjct: 63  LPYGYTVQADEEDAQDLAEALGIDYKEINIKPAVDAFLKKLLKLFLGIYLEDLALGNIKA 122

Query: 385 RIRGNILMALSNHSKAMLLTTSNKSEISVGYGTLYGDMSGGFNPLKDLYKTQVFQLASWR 444
           R+R  IL A++N    ++L T NKSE+++GY T YGD +   NP+ DLYKTQV+ LA   
Sbjct: 123 RLRMVILYAIANKLGGLVLGTGNKSELALGYFTKYGDGAVDINPIADLYKTQVYALARHL 182

Query: 445 NSHGITSGLGPLTEVIPPSILEKSPSAELRPH---QTDQESLP-PYPILDDIIKRIVENE 500
                          IP  IL+K P+A+L P    QTD+  L  PY  LDDI+  ++EN 
Sbjct: 183 G--------------IPEEILKKPPTADLWPDEPGQTDEAELGMPYEELDDILYGLLENG 228

Query: 501 ESFINNDQEYNDETVRYVEHLLYGSEYKRRQAPVGTKITAKSFGRDR 547
           +       E ++E V+ +E L   SE+KRR  P+G KIT   F    
Sbjct: 229 Q-------EISEELVKKIERLYKKSEHKRR-LPIGPKITPWKFLSFG 267