RPSBLAST alignment for GI: 254780999 and conserved domain: KOG0806

>gnl|CDD|36024 KOG0806, KOG0806, KOG0806, Carbon-nitrogen hydrolase [Amino acid transport and metabolism]. Length = 298
 Score = 61.1 bits (148), Expect = 8e-10
 Identities = 39/170 (22%), Positives = 59/170 (34%), Gaps = 22/170 (12%)

Query: 2   LKKLKIAIAQLNPVVGDIAGNIAKARRAREEANRQGMDLILFTELFISGYPPEDLVFKKS 61
           L     A+  L   +  +  NI    +A +EA +QG  +I+F E  + GY      F +S
Sbjct: 11  LPNATEALVSLEEALLLMNENIDILEKAVKEAAKQGAKIIVFPEDGLYGY-----NFTES 65

Query: 62  FIQACSSAIDTLKSDTHDGGAG---------IVVGFPRQDQEG--VLNSVVILDA-GNII 109
           F        D    D    G           I+ G   ++  G  + NS       G+ +
Sbjct: 66  FYPYLEDIPDPGCRDPSRQGLSEVAERLSCYIIGGSIEEEALGDKLYNSCADSSCPGDGL 125

Query: 110 AVRDKINL-----PNYSEFHEKRTFISGYSNDPIVFRDIRLGILICEDIW 154
           A   K +L     P    + E      G     +     + GI IC DI 
Sbjct: 126 AKYRKNHLFDTDGPGVIRYRESHLLSPGDQFTVVDTSYGKFGIFICFDIR 175