>TIGR00740 TIGR00740 methyltransferase, putative; InterPro: IPR005271 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalyzed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order . Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI ), shared by other AdoMet-Mtases , is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments , although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases , , , . The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences . The proteins of this family are restricted to the Proteobacteria, sharing consistent length, full-length homology, and on average better than 35 0dentity. It is reasonable to predict equivalent function within this subfamily. .

Probab=95.25  E-value=0.062  Score=31.83  Aligned_cols=59  Identities=24%  Similarity=0.416  Sum_probs=49.5

Q ss_pred             CEEEEECCCCCHHHHHHHHCCC----EEEEECCCHHHHHHHHHHHHHCCC-CCEEEEECCHHHH
Q ss_conf             3388602464235888850685----699844758899999997886089-9649997689999
Q gi|254781000|r  211 GDLLELYCGNGNFSLVLARHFD----RVLAVEIAKPSVEAARYNIAANHV-NNVKIVRMSSKEF  269 (371)
Q Consensus       211 ~~vlDLycG~G~fsl~La~~~~----~V~gvE~~~~ai~~A~~Na~~N~i-~n~~f~~~~a~~~  269 (371)
T Consensus        63 ~~vYDLGCS~G~~~l~~~R~I~~~~~~~igIDNS~pM~~~~~~~~~~y~~~~Pv~~~~~D~~~v  126 (247)
T TIGR00740        63 PLVYDLGCSTGAATLSLRRNIQQDNIKIIGIDNSMPMLERCREHIKAYKNAIPVEVLCMDIREV  126 (247)
T ss_pred             CCEEECCCCHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEHHHHHHH
T ss_conf             7412233432357766530468785379884188889999999998742478823201024566