BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781001|ref|YP_003065414.1| hypothetical protein CLIBASIA_04510 [Candidatus Liberibacter asiaticus str. psy62] (93 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781001|ref|YP_003065414.1| hypothetical protein CLIBASIA_04510 [Candidatus Liberibacter asiaticus str. psy62] Length = 93 Score = 189 bits (480), Expect = 7e-51, Method: Compositional matrix adjust. Identities = 93/93 (100%), Positives = 93/93 (100%) Query: 1 MTISSPSLSDYLKIEHYMLHSFIEGPTKAIVIIWLSIFSMPSGSIEYRDTLDERVANSGL 60 MTISSPSLSDYLKIEHYMLHSFIEGPTKAIVIIWLSIFSMPSGSIEYRDTLDERVANSGL Sbjct: 1 MTISSPSLSDYLKIEHYMLHSFIEGPTKAIVIIWLSIFSMPSGSIEYRDTLDERVANSGL 60 Query: 61 YMIVKKALVRSKKRKIAVPSRQVTDLYKETLFP 93 YMIVKKALVRSKKRKIAVPSRQVTDLYKETLFP Sbjct: 61 YMIVKKALVRSKKRKIAVPSRQVTDLYKETLFP 93 >gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Score = 23.1 bits (48), Expect = 0.85, Method: Compositional matrix adjust. Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 2 TISSPSLSDYLKIEHYMLHSFIE 24 T + PSL+D +E MLH E Sbjct: 701 TGNEPSLADMPALEQLMLHRLTE 723 >gi|255764488|ref|YP_003065099.2| flagellar motor protein MotA [Candidatus Liberibacter asiaticus str. psy62] Length = 290 Score = 20.8 bits (42), Expect = 4.5, Method: Compositional matrix adjust. Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Query: 54 RVANSGLYMIVKKALVRSKKRKIAVPSRQVTDLYKETLFP 93 R+ LY+IVKKAL+ A+P QV Y + P Sbjct: 231 RLKQHRLYIIVKKALIAYMNG--AIP--QVAIEYGRKVLP 266 >gi|254780776|ref|YP_003065189.1| ribosome recycling factor [Candidatus Liberibacter asiaticus str. psy62] Length = 186 Score = 20.8 bits (42), Expect = 4.6, Method: Compositional matrix adjust. Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 5 SPSLSDYLKIEHYMLH 20 SPS+ D +K+E Y H Sbjct: 34 SPSMLDLVKVEAYGSH 49 >gi|254780682|ref|YP_003065095.1| hypothetical protein CLIBASIA_02845 [Candidatus Liberibacter asiaticus str. psy62] Length = 199 Score = 20.4 bits (41), Expect = 5.4, Method: Compositional matrix adjust. Identities = 8/31 (25%), Positives = 17/31 (54%) Query: 58 SGLYMIVKKALVRSKKRKIAVPSRQVTDLYK 88 SG+ +I+ + I +PSR++ D ++ Sbjct: 52 SGIILILSPTDCTANTANILIPSRKIIDYHR 82 >gi|254780232|ref|YP_003064645.1| inorganic pyrophosphatase [Candidatus Liberibacter asiaticus str. psy62] Length = 177 Score = 20.4 bits (41), Expect = 5.4, Method: Compositional matrix adjust. Identities = 7/15 (46%), Positives = 12/15 (80%) Query: 73 KRKIAVPSRQVTDLY 87 ++ +AVPS+ +T LY Sbjct: 105 EKILAVPSKNITSLY 119 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.135 0.380 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,235 Number of Sequences: 1233 Number of extensions: 1861 Number of successful extensions: 9 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 93 length of database: 328,796 effective HSP length: 60 effective length of query: 33 effective length of database: 254,816 effective search space: 8408928 effective search space used: 8408928 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 31 (16.5 bits)