Query gi|254781002|ref|YP_003065415.1| hypothetical protein CLIBASIA_04515 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 108 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 02:46:34 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781002.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam04656 Pox_E6 Pox virus E6 57.5 9.9 0.00025 18.2 2.7 46 37-82 3-52 (566) 2 PRK09697 chromosome replicatio 36.2 33 0.00085 15.3 3.0 20 11-30 30-60 (139) 3 TIGR00366 TIGR00366 conserved 30.3 28 0.00072 15.7 1.5 11 19-29 107-117 (463) 4 pfam11085 YqhR Conserved membr 24.5 41 0.0011 14.8 1.5 14 49-62 109-122 (174) 5 TIGR01774 PFL2-3 pyruvate form 24.0 49 0.0013 14.3 1.8 17 51-67 266-282 (812) 6 PRK13460 F0F1 ATP synthase sub 21.7 61 0.0016 13.8 2.5 16 76-91 19-34 (173) 7 pfam06678 DUF1179 Protein of u 20.0 49 0.0012 14.4 1.1 26 4-29 1-26 (108) 8 KOG3208 consensus 20.0 67 0.0017 13.6 3.2 26 65-90 205-230 (231) 9 TIGR00800 ncs1 NCS1 nucleoside 18.5 72 0.0018 13.4 4.7 36 11-48 376-411 (465) 10 KOG0811 consensus 15.9 84 0.0021 13.1 2.6 19 12-30 245-263 (269) No 1 >pfam04656 Pox_E6 Pox virus E6 protein. Family of pox virus E6 proteins. Probab=57.52 E-value=9.9 Score=18.20 Aligned_cols=46 Identities=37% Similarity=0.539 Sum_probs=31.6 Q ss_pred HHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHCCHHHHHHHHHHHHHH Q ss_conf 8889999999998689999----998898676204788999999999999 Q gi|254781002|r 37 FIRRKYVLTAILLNYQFFY----SLQTIFSVEHYTNPHSIILAFVWSILS 82 (108) Q Consensus 37 firrkyvltaillnyqffy----slqtifsvehytnphsiilafvwsils 82 (108) ||||||..-+|--|-.|+- +--..||..|--.-+-+|+.|--+.++ T Consensus 3 fIRRKYLiytien~iDFlr~e~~~KisnFsLnHVLAlkYli~~f~~~Vlt 52 (566) T pfam04656 3 FIRRKYLIYTIENNIDFLRDEVLSKVSNFSLNHVLALKYLILNFPKDVLT 52 (566) T ss_pred HHHHHHHHHHHHCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCHHHCC T ss_conf 46554556666213168899999886531356899999999967386500 No 2 >PRK09697 chromosome replication protein PioO; Provisional Probab=36.19 E-value=33 Score=15.29 Aligned_cols=20 Identities=45% Similarity=0.936 Sum_probs=11.8 Q ss_pred HHHHHHHHHHHHH-----------HHHHHHH Q ss_conf 9999999999999-----------9999997 Q gi|254781002|r 11 FTCILLLWCVFIG-----------LIACWIV 30 (108) Q Consensus 11 ftcilllwcvfig-----------liacwiv 30 (108) |.--|++||.|.. |-||||+ T Consensus 30 ~Vi~L~~~~L~~AG~~~~GGYA~QlwA~~~~ 60 (139) T PRK09697 30 YVICLLLICLWFAGMVLVGGYARQLWALWIV 60 (139) T ss_pred HHHHHHHHHHHHHHHEEECHHHHHHHHHHHH T ss_conf 8999999999970014541378778888876 No 3 >TIGR00366 TIGR00366 conserved hypothetical protein TIGR00366; InterPro: IPR006161 This is a family of conserved hypothetical proteins of no clearly defined function, although they may act as short chain fatty acid transporters.; GO: 0015635 short-chain fatty acid transporter activity, 0015912 short-chain fatty acid transport, 0016020 membrane. Probab=30.26 E-value=28 Score=15.67 Aligned_cols=11 Identities=73% Similarity=1.709 Sum_probs=6.6 Q ss_pred HHHHHHHHHHH Q ss_conf 99999999999 Q gi|254781002|r 19 CVFIGLIACWI 29 (108) Q Consensus 19 cvfigliacwi 29 (108) ..|+|+||||| T Consensus 107 vtf~~~iA~~I 117 (463) T TIGR00366 107 VTFLGLIACWI 117 (463) T ss_pred HHHHHHHHHHH T ss_conf 99999999998 No 4 >pfam11085 YqhR Conserved membrane protein YqhR. This family is conserved in the Bacillaceae family of the Firmicutes. The function is not known. Probab=24.54 E-value=41 Score=14.77 Aligned_cols=14 Identities=36% Similarity=0.624 Sum_probs=6.6 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 86899999988986 Q gi|254781002|r 49 LNYQFFYSLQTIFS 62 (108) Q Consensus 49 lnyqffyslqtifs 62 (108) +=--.||-+..+|. T Consensus 109 lW~vvF~~lnP~fp 122 (174) T pfam11085 109 LWLLVFFVLNPIFP 122 (174) T ss_pred HHHHHHHHHCCCCC T ss_conf 99999998363656 No 5 >TIGR01774 PFL2-3 pyruvate formate-lyase; InterPro: IPR010098 This entry represents isoforms of the pyruvate-formate lyases found in a limited number of species including Escherichia coli. This enzyme converts pyruvate + CoA to acetyl-CoA + formate, which is a step in the fermentation of glucose.. Probab=24.01 E-value=49 Score=14.32 Aligned_cols=17 Identities=24% Similarity=0.399 Sum_probs=10.1 Q ss_pred HHHHHHHHHHHHHHHHC Q ss_conf 89999998898676204 Q gi|254781002|r 51 YQFFYSLQTIFSVEHYT 67 (108) Q Consensus 51 yqffyslqtifsvehyt 67 (108) -||+|-.|.|...|.|. T Consensus 266 ~Ql~w~~q~iLq~Esn~ 282 (812) T TIGR01774 266 VQLVWYVQLILQIESNE 282 (812) T ss_pred HHHHHHHHHHHHHHCCH T ss_conf 99999999997431000 No 6 >PRK13460 F0F1 ATP synthase subunit B; Provisional Probab=21.70 E-value=61 Score=13.81 Aligned_cols=16 Identities=19% Similarity=0.837 Sum_probs=10.3 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 9999999999999999 Q gi|254781002|r 76 FVWSILSFFITFWIFV 91 (108) Q Consensus 76 fvwsilsffitfwifv 91 (108) ++|.+++|.+-+|++- T Consensus 19 ~iw~~i~F~il~~il~ 34 (173) T PRK13460 19 VVWTLVTFLVVVLVLK 34 (173) T ss_pred HHHHHHHHHHHHHHHH T ss_conf 9999999999999999 No 7 >pfam06678 DUF1179 Protein of unknown function (DUF1179). This family consists of several hypothetical Caenorhabditis elegans proteins of around 106 residues in length. The function of the family is unknown. Probab=20.02 E-value=49 Score=14.36 Aligned_cols=26 Identities=31% Similarity=0.475 Sum_probs=19.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999999999 Q gi|254781002|r 4 MIFFAFVFTCILLLWCVFIGLIACWI 29 (108) Q Consensus 4 miffafvftcilllwcvfigliacwi 29 (108) |.-|++.|.||.|..--|.-||.|-+ T Consensus 1 M~sf~~if~sI~L~fgpfflliv~iv 26 (108) T pfam06678 1 MFSFTTIFKSISLYFGPFFLLIVSIV 26 (108) T ss_pred CCCHHHHHHHHHHHHCCHHHHHHHHH T ss_conf 96412256556886415788766533 No 8 >KOG3208 consensus Probab=19.99 E-value=67 Score=13.60 Aligned_cols=26 Identities=27% Similarity=0.404 Sum_probs=20.5 Q ss_pred HHCCHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 20478899999999999999999999 Q gi|254781002|r 65 HYTNPHSIILAFVWSILSFFITFWIF 90 (108) Q Consensus 65 hytnphsiilafvwsilsffitfwif 90 (108) --..-.++|||-|-++..+|+-||.| T Consensus 205 ~kkrrdslILa~Vis~C~llllfy~~ 230 (231) T KOG3208 205 IKKRRDSLILAAVISVCTLLLLFYWI 230 (231) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 87642268999999999999999983 No 9 >TIGR00800 ncs1 NCS1 nucleoside transporter family; InterPro: IPR012681 The Nucleobase Cation Symporter-1 (NCS1) family consists of bacterial and yeast transporters for nucleobases including purines and pyrimidines. Members of this family possess twelve putative transmembrane a-helical spanners (TMSs). At least some of them have been shown to function in uptake by substrate:H+ symport mechanism. ; GO: 0015205 nucleobase transmembrane transporter activity, 0015931 nucleobase nucleoside nucleotide and nucleic acid transport, 0016020 membrane. Probab=18.47 E-value=72 Score=13.41 Aligned_cols=36 Identities=31% Similarity=0.483 Sum_probs=20.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999997456898888999999999 Q gi|254781002|r 11 FTCILLLWCVFIGLIACWIVDRWEYFFIRRKYVLTAIL 48 (108) Q Consensus 11 ftcilllwcvfigliacwivdrweyffirrkyvltail 48 (108) |+-.|.+--++++-++-=+ -=|||++||+|.--..+ T Consensus 376 ~~~~L~~ig~~l~~~~gv~--~aDYF~~Rr~~~~~~~~ 411 (465) T TIGR00800 376 FTTFLSSIGGFLSPVAGVM--IADYFIVRRRYLHLTTL 411 (465) T ss_pred HHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHH T ss_conf 9999999999999999999--97567886778766653 No 10 >KOG0811 consensus Probab=15.90 E-value=84 Score=13.05 Aligned_cols=19 Identities=47% Similarity=0.653 Sum_probs=9.5 Q ss_pred HHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999997 Q gi|254781002|r 12 TCILLLWCVFIGLIACWIV 30 (108) Q Consensus 12 tcilllwcvfigliacwiv 30 (108) .|++++--+.+||++|-++ T Consensus 245 ~~~ll~v~~~v~lii~l~i 263 (269) T KOG0811 245 KCILLLVGGPVGLIIGLII 263 (269) T ss_pred HHHHHHHHHHHHHHHHHHH T ss_conf 1136589999999999999 Done!