RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781003|ref|YP_003065416.1| hypothetical protein CLIBASIA_04520 [Candidatus Liberibacter asiaticus str. psy62] (304 letters) >gnl|CDD|183128 PRK11423, PRK11423, methylmalonyl-CoA decarboxylase; Provisional. Length = 261 Score = 31.5 bits (72), Expect = 0.30 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 3/35 (8%) Query: 113 AIAVRKKNVRVLQQSYPLLGAKDSFSR-AGNRRAV 146 AIAV K+ +RVL +++P+ D F R G RRAV Sbjct: 205 AIAVIKEQLRVLGEAHPM--NPDEFERIQGLRRAV 237 >gnl|CDD|180068 PRK05421, PRK05421, hypothetical protein; Provisional. Length = 263 Score = 29.9 bits (68), Expect = 0.88 Identities = 43/202 (21%), Positives = 72/202 (35%), Gaps = 52/202 (25%) Query: 25 RLVSWNINTLSEQEGVSLWKNSVKRTTSDYTLLRQYAKNLDADIVFLQEMGSYNAVAKVF 84 RL+ WNI +K S L+ K DAD+V LQE + + + Sbjct: 45 RLLVWNI-----------YKQQRAGWLSV---LKNLGK--DADLVLLQEAQTTPELVQFA 88 Query: 85 PKNTWCIFYSTERLINHSKRDSNNDIHTAIAVRKKNVRVLQQSYPLLG-AKDSFSRAGNR 143 N + + + T L++ P L K + Sbjct: 89 TANYLAADQAP----AFVLPQHPSGVMTLSKAHPVYCCPLREREPWLRLPKSA------- 137 Query: 144 RAVELLVE---INGKKIWVLDIHLKSFCFLDSLENTYSPSCSLLSQQAQWLKDWITQKKE 200 L+ E NG+ + V++IH +F ++ YS +Q + + D I Sbjct: 138 ----LITEYPLPNGRTLLVVNIHAINFSL--GVDV-YS-------KQLEPIGDQIAHHSG 183 Query: 201 SLVPFVIAGDFN----RKINYL 218 P ++AGDFN +++N L Sbjct: 184 ---PVILAGDFNTWSRKRMNAL 202 >gnl|CDD|162323 TIGR01371, met_syn_B12ind, 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase. This model describes the cobalamin-independent methionine synthase. A family of uncharacterized archaeal proteins is homologous to the C-terminal region of this family. That family is excluded from this model but, along with this family, belongs to pfam model pfam01717. Length = 750 Score = 28.9 bits (65), Expect = 1.9 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 6/38 (15%) Query: 152 INGKKIWVLDIHLKSFCFLDSLEN-----TYSPSCSLL 184 I+G+ IW D+ S L L S SCSLL Sbjct: 283 IDGRNIWRNDL-EASLSLLKKLLAHVGKLVVSTSCSLL 319 >gnl|CDD|179415 PRK02362, PRK02362, ski2-like helicase; Provisional. Length = 737 Score = 27.6 bits (62), Expect = 3.6 Identities = 11/28 (39%), Positives = 18/28 (64%) Query: 209 GDFNRKINYLGNNDDFWKTIDPNDSLIR 236 GD++ + +LG+ND T + DSL+R Sbjct: 102 GDYDSRDEWLGDNDIIVATSEKVDSLLR 129 >gnl|CDD|180840 PRK07105, PRK07105, pyridoxamine kinase; Validated. Length = 284 Score = 27.6 bits (62), Expect = 3.8 Identities = 9/29 (31%), Positives = 18/29 (62%) Query: 269 FLIQESFSEILYNEDDIKSRGKRLSDHCP 297 L+ + + E Y+E++IK ++L+D P Sbjct: 150 LLLDKPYLEKSYSEEEIKQLLRKLADLGP 178 >gnl|CDD|181809 PRK09376, rho, transcription termination factor Rho; Provisional. Length = 416 Score = 27.8 bits (63), Expect = 3.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Query: 159 VLDIHLKSFCFLDSLENTYSPS 180 VL+I F FL S + Y P Sbjct: 54 VLEILPDGFGFLRSPDANYLPG 75 >gnl|CDD|140318 PTZ00297, PTZ00297, pantothenate kinase; Provisional. Length = 1452 Score = 27.5 bits (61), Expect = 4.6 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 12/62 (19%) Query: 156 KIWVLDIHLKSFCFLDSLENTYSPSCSLLSQQAQWLKDWITQKKE-----SLVPFVIAGD 210 +I ++HL+ DSL +T S + + ++++ I E + +PFVIAGD Sbjct: 151 RIVFFNVHLRQ---EDSLPSTSSQ----VQETRRFVESVIANVYEQNNDGAEIPFVIAGD 203 Query: 211 FN 212 FN Sbjct: 204 FN 205 >gnl|CDD|180921 PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated. Length = 720 Score = 27.0 bits (60), Expect = 5.8 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query: 38 EGVSLWKN-SVKRTTSDYTLLRQYAKN 63 +G+ WK+ + K TT D ++LR YA N Sbjct: 665 KGLYEWKDRTNKMTTRDLSILRNYAFN 691 >gnl|CDD|161970 TIGR00633, xth, exodeoxyribonuclease III (xth). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 255 Score = 26.9 bits (60), Expect = 6.1 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 15/56 (26%) Query: 248 NKNLRNKIPIDYFVMDQNAYKFLIQESFSEILYNEDDIKSRGKRLSDHCPISIDYD 303 N+ R IDYF L+ E +E + D R SDHCPI ++ D Sbjct: 215 NRGWR----IDYF---------LVSEPLAERV--VDSYIDSEIRGSDHCPIVLELD 255 >gnl|CDD|179966 PRK05222, PRK05222, 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase; Provisional. Length = 758 Score = 26.6 bits (60), Expect = 8.7 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 6/38 (15%) Query: 152 INGKKIWVLDIHLKSFCFLDSLENTY-----SPSCSLL 184 I+G+ IW D+ + L+ L +PSCSLL Sbjct: 289 IDGRNIWRADLE-AALALLEPLAAKVDRLWVAPSCSLL 325 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.135 0.408 Gapped Lambda K H 0.267 0.0711 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 4,838,391 Number of extensions: 297711 Number of successful extensions: 565 Number of sequences better than 10.0: 1 Number of HSP's gapped: 565 Number of HSP's successfully gapped: 20 Length of query: 304 Length of database: 5,994,473 Length adjustment: 93 Effective length of query: 211 Effective length of database: 3,984,929 Effective search space: 840820019 Effective search space used: 840820019 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (25.8 bits)