>TIGR00415 serS_MJ seryl-tRNA synthetase; InterPro: IPR004503 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . Seryl-tRNA synthetase (6.1.1.11 from EC) exists as monomer and belongs to class IIa . The seryl-tRNA synthetases from a few of the archaea that belong to this group are different from the set of mutually more closely related seryl-tRNA synthetases from eubacteria, eukaryotes, and other archaea (IPR002317 from INTERPRO).; GO: 0000166 nucleotide binding, 0004828 serine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006434 seryl-tRNA aminoacylation, 0005737 cytoplasm.

Probab=98.30 E-value=4.9e-06 Score=61.50 Aligned_cols=164 Identities=16% Similarity=0.226 Sum_probs=135.1 Q ss_pred EECCC-CCCEEEEECCHHHHHHHHHHHHHHH-HHC-CCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCC----- Q ss_conf 42267-8743565010789999999999988-768-963855543244310001121001255542010014567----- Q gi|254781004|r 257 HIAED-GSGVIFWHRKGWKIFQTLISYMRRK-IKD-DYEEINTPQVLDQHLWQQSGHWDSYRANMFAVKCADDTI----- 328 (652) Q Consensus 257 ~~~~~-~~G~~~wlP~G~~i~~~ie~~ir~~-~~~-G~~eV~tP~l~~~~Lw~~SGh~~~y~~~mf~~~~~~~~~----- 328 (652) T Consensus 206 w~~~~pg~g~w~~~p~~~~~~~~~~~~~~~~~~~~~g~~~c~~p~~~p~~~~~~~~~~~g~p~g~~~~~~p~~~p~~~~~ 285 (520) T TIGR00415 206 WVKKFPGRGQWFYGPPITALFRALEELFVEEVVKPLGFVECLFPKLIPLDILYKLRYLEGLPEGLYYCCPPKRDPELFEE 285 (520) T ss_pred CHHCCCCCCCEECCCCHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCHHHHHH T ss_conf 01126887620016506788888998889887654011345310010267777767641365452552277556357898 Q ss_pred -------------------CCCCEEEECCCCHHHHHHHHHHCCCCHHHCCHHHHH-HEEEECCCCCCCCEEEEECCCCCC Q ss_conf -------------------778237743431257777652012222310432000-100012787645200010563533 Q gi|254781004|r 329 -------------------KDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRLAE-FGSVYRNEPSGSLHGLMRVRGFTQ 388 (652) Q Consensus 329 -------------------~~~~~~~LkPmncp~h~~i~~~~~~SYrdLPlrl~e-~~~~~R~E~sg~l~GL~R~ReF~~ 388 (652) T Consensus 286 ~~~~~~~~~~~p~~~~~~~~~dpg~~~~p~~c~p~~~~~~~~~~~~~d~p~~~~d~~gw~~~w~~gg-~~g~d~~~~~~~ 364 (520) T TIGR00415 286 FKNELLINKEVPLDLLKNGLKDPGYVLAPAQCEPFYQFLEGEVVDAEDLPVKFFDRSGWTYRWEGGG-AKGLDRVNEFLR 364 (520) T ss_pred HHHHHHHHCCCCHHHHHHHHCCCCCEECCCCCCHHHHHHCCCCCCCCCCCEEEECCCCCEEEECCCC-CCCHHHHHHHHH T ss_conf 7665542003557898753048770430311003567541211000014311220577424423766-321245545331 Q ss_pred CCCEEECCHHHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 442101053767887899999988766552133 Q gi|254781004|r 389 DDAHVFCTKEQMFNECLKIHNLIISIYKDFGFE 421 (652) Q Consensus 389 ~Dah~F~~~eq~~~e~~~~~~~~~~v~~~~g~~ 421 (652) T Consensus 365 ~~~~w~~~p~~~~~~~d~~~~~~~~~~~~~~~~ 397 (520) T TIGR00415 365 VELVWLGEPGFTEETRDKTLELAEDLADELDLE 397 (520) T ss_pred EEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 113551475201233344566555555541001

HHsearch alignment for GI: 254781004 and conserved domain: TIGR00415