RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781005|ref|YP_003065418.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62] (85 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 29.5 bits (66), Expect = 0.19 Identities = 27/132 (20%), Positives = 38/132 (28%), Gaps = 63/132 (47%) Query: 5 GLIVASLISS---------------TV---IMSGCSE-----TLDP-------ENG---- 30 GL+ A I+ TV I C E +L P EN Sbjct: 276 GLVTAVAIAETDSWESFFVSVRKAITVLFFIGVRCYEAYPNTSLPPSILEDSLENNEGVP 335 Query: 31 -----IRELGARMKQERKKADQPIGGGKTGETLPKGGGRKISLDSNN-----------LS 74 I L +++ + KT LP G+++ + N S Sbjct: 336 SPMLSISNL------TQEQVQDYV--NKTNSHLPA--GKQVEISLVNGAKNLVVSGPPQS 385 Query: 75 TELRSQN-FLRK 85 L N LRK Sbjct: 386 --LYGLNLTLRK 395 >1fft_B Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli} SCOP: b.6.1.2 f.17.2.1 Length = 315 Score = 26.8 bits (59), Expect = 1.2 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Query: 3 IKGLIVASLISSTVIMSGCS-ETLDP 27 K L SL + TV++SGC+ LDP Sbjct: 7 NKSLGWLSLFAGTVLLSGCNSALLDP 32 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.311 0.132 0.358 Gapped Lambda K H 0.267 0.0582 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 676,229 Number of extensions: 26042 Number of successful extensions: 46 Number of sequences better than 10.0: 1 Number of HSP's gapped: 46 Number of HSP's successfully gapped: 4 Length of query: 85 Length of database: 5,693,230 Length adjustment: 53 Effective length of query: 32 Effective length of database: 4,408,298 Effective search space: 141065536 Effective search space used: 141065536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 50 (23.4 bits)