HHsearch alignment of GI: 254781006 and MMDB domain: 2p1i_A_162-349

>2p1i_A (A:162-349) Ribonucleotide reductase, small chain; F222 twinning, plasmodb PY03671, structural genomics consortium, SGC, oxidoreductase; 2.70A {Plasmodium yoelii yoelii str}
Probab=99.97  E-value=1.9e-31  Score=211.56  Aligned_cols=114  Identities=31%  Similarity=0.617  Sum_probs=104.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             94037899999999999996770003112299999999999999999857630876018899999999999999999985
Q gi|254781006|r    1 MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQI   80 (125)
Q Consensus         1 ~RDE~lH~~~~~~l~~~l~~e~pe~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yiky~an~rL~~l   80 (125)
                      +|||++|+.+++.+++.++.+.|       ++.+++|+++||++|++|++++++.+++|+|++++++||+|+||+||++|
T Consensus        62 ~rDE~~H~~~~~~l~~~l~~e~~-------~~~~~~l~~eav~~E~~~~~~~~~~~~~gi~~~~~~~yi~y~an~~L~~l  134 (188)
T 2p1i_A           62 SRDEGLHTDFNCLIYSLLENKLP-------ENVVQNIVKEAVEVERSFICESLPCDLIGMNSRLMSQYIEFVADRLLECL  134 (188)
T ss_dssp             HHHHHHHHHHHHHHHHTCSSCCC-------HHHHHHHHHHHHHHHHHHHTTTSCSTTTTCCHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCC-------HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             66677768899899999982498-------99999899999999999999970435212006779999999999999977


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHCCCC
Q ss_conf             9787889878886899998346657321310033334306577
Q gi|254781006|r   81 GLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAELK  123 (125)
Q Consensus        81 Gl~~~f~~~~nPl~W~~~~~~~~~~~nFFE~r~t~Y~k~~~~~  123 (125)
                      |++|+|+. +||+|||+.+. ..+++||||+|+|+|+||+..+
T Consensus       135 G~~~~f~~-~nP~~w~~~~~-~~~~~nFFE~~~t~Y~k~~~~~  175 (188)
T 2p1i_A          135 GCSKVFHS-KNPFNWMDLIS-LQGKTNFFEKRVADYQKSGVMA  175 (188)
T ss_dssp             TCCCSSCC-CCSCCC----------------------------
T ss_pred             CCCCCCCC-CCCCCCHHHCC-CCCCCCCCCCCHHHHHCCCCCC
T ss_conf             99999999-99965055515-6745578877765630366667