BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781008|ref|YP_003065421.1| hypothetical protein CLIBASIA_04550 [Candidatus Liberibacter asiaticus str. psy62] (99 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781008|ref|YP_003065421.1| hypothetical protein CLIBASIA_04550 [Candidatus Liberibacter asiaticus str. psy62] gi|254040685|gb|ACT57481.1| hypothetical protein CLIBASIA_04550 [Candidatus Liberibacter asiaticus str. psy62] Length = 99 Score = 192 bits (489), Expect = 1e-47, Method: Composition-based stats. Identities = 99/99 (100%), Positives = 99/99 (100%) Query: 1 MSEDVIIHSSIGEHDAKFDITIPIGVLDSPRSIRIQCWSAYKYKHQLHMSDLSDTVIDLP 60 MSEDVIIHSSIGEHDAKFDITIPIGVLDSPRSIRIQCWSAYKYKHQLHMSDLSDTVIDLP Sbjct: 1 MSEDVIIHSSIGEHDAKFDITIPIGVLDSPRSIRIQCWSAYKYKHQLHMSDLSDTVIDLP 60 Query: 61 NHISIITCMEDMRLSSVVYATREDCQKILRALSEVSKLF 99 NHISIITCMEDMRLSSVVYATREDCQKILRALSEVSKLF Sbjct: 61 NHISIITCMEDMRLSSVVYATREDCQKILRALSEVSKLF 99 >gi|261252202|ref|ZP_05944775.1| metallo-beta-lactamase family protein RNA-specific [Vibrio orientalis CIP 102891] gi|260935593|gb|EEX91582.1| metallo-beta-lactamase family protein RNA-specific [Vibrio orientalis CIP 102891] Length = 438 Score = 35.0 bits (79), Expect = 3.4, Method: Composition-based stats. Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 14/86 (16%) Query: 14 HDAKFDITIPIGVLDSPRSIRI--------QCW-SAYKYKHQLHMSDLS----DTVIDLP 60 HD + DI+IPI +LDSP + R+ Q W K + ++H L+ TV D Sbjct: 246 HDHQIDISIPI-ILDSPMAQRVTRSYRRFKQLWGQEAKQRLKMHRHPLAFEQCITVEDYR 304 Query: 61 NHISIITCMEDMRLSSVVYATREDCQ 86 H ++ ++ R +++V A CQ Sbjct: 305 THQRLVNRLQSTREAAIVVAASGMCQ 330 >gi|301094566|ref|XP_002896388.1| 3-phosphoinositide-dependent protein kinase, putative [Phytophthora infestans T30-4] gi|262109571|gb|EEY67623.1| 3-phosphoinositide-dependent protein kinase, putative [Phytophthora infestans T30-4] Length = 457 Score = 35.0 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 25/93 (26%), Positives = 48/93 (51%), Gaps = 3/93 (3%) Query: 3 EDVIIHSSIGEHDAKFDITIPIGVLDSPRSIRIQCWSAYKYKHQLHMS-DLSDTVIDLPN 61 E + S++ F+ T + + D+PR I I WS ++K +L ++ D + ID P+ Sbjct: 367 EQIRFESTVKVRSKMFNRTRDLYLTDAPRLIVISAWSG-RFKRELFLTPDTTVNEID-PH 424 Query: 62 HISIITCMEDMRLSSVVYATREDCQKILRALSE 94 ++T E +R++ ++ + IL A+SE Sbjct: 425 TFDVVTRSETIRITDSNNLAQQWARAILEAVSE 457 >gi|332375412|gb|AEE62847.1| unknown [Dendroctonus ponderosae] Length = 242 Score = 34.3 bits (77), Expect = 6.1, Method: Composition-based stats. Identities = 27/98 (27%), Positives = 49/98 (50%), Gaps = 25/98 (25%) Query: 9 SSIGEHDAKFDITI-----------PIGVLDSPRSIRIQC-WSAYKYK---HQLHMSDLS 53 SSI + D KF+IT+ P V P ++ + W++ K K ++H++ L Sbjct: 7 SSILKSDGKFEITLDQRKLKTPKGSPFLVDTEPLALAVATEWNSQKGKIVQSKMHITTLC 66 Query: 54 DTVIDLPNHIS-------IITCMEDMRLSSVVYATRED 84 +TV+D PN+++ I+ C++ +V+Y ED Sbjct: 67 NTVLDNPNNLTKLDIVNYIVNCLDT---DTVLYQANED 101 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.323 0.135 0.398 Lambda K H 0.267 0.0443 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,075,851,520 Number of Sequences: 14124377 Number of extensions: 44756002 Number of successful extensions: 79038 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 79036 Number of HSP's gapped (non-prelim): 5 length of query: 99 length of database: 4,842,793,630 effective HSP length: 68 effective length of query: 31 effective length of database: 3,882,335,994 effective search space: 120352415814 effective search space used: 120352415814 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 76 (33.8 bits)