RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781008|ref|YP_003065421.1| hypothetical protein CLIBASIA_04550 [Candidatus Liberibacter asiaticus str. psy62] (99 letters) >3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} (A:24-41,A:273-367) Length = 113 Score = 25.9 bits (57), Expect = 1.9 Identities = 5/26 (19%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Query: 72 MRLSSVVYATREDCQKILRALSEVSK 97 +R++ +T E+ + L A + + Sbjct: 90 LRVT---VSTPEENAQFLEAFAASLQ 112 >2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal phosphate dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} (A:22-57,A:298-401) Length = 140 Score = 25.2 bits (55), Expect = 3.2 Identities = 12/82 (14%), Positives = 28/82 (34%), Gaps = 6/82 (7%) Query: 22 IPIGVLDSPRSIRIQCWSAYKYKHQLHMSD--LSDTVIDLP--NHISIITCMEDMRLSSV 77 + + ++D I H +SD LSD + + N ++ E +R + Sbjct: 60 LGMPIIDHGSHIV--PVVIGDPVHTKAVSDMLLSDYGVYVQPINFPTVPRGTERLRFTPS 117 Query: 78 VYATREDCQKILRALSEVSKLF 99 + ++ A+ + Sbjct: 118 PVHDLKQIDGLVHAMDLLWARC 139 >1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocysteine, aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} (A:1-25,A:294-390) Length = 122 Score = 24.1 bits (52), Expect = 6.9 Identities = 4/24 (16%), Positives = 8/24 (33%) Query: 73 RLSSVVYATREDCQKILRALSEVS 96 R E+ +L L++ Sbjct: 98 RACCHYITDEEEINHLLARLADFG 121 >1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, coenzyme A, transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} (A:27-56,A:297-401) Length = 135 Score = 23.6 bits (51), Expect = 8.9 Identities = 5/27 (18%), Positives = 9/27 (33%) Query: 73 RLSSVVYATREDCQKILRALSEVSKLF 99 R T E + + A + + K Sbjct: 105 RTQXSAAHTPEQITRAVEAFTRIGKQL 131 >1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} (A:1-37,A:302-420) Length = 156 Score = 23.7 bits (51), Expect = 9.5 Identities = 8/27 (29%), Positives = 13/27 (48%) Query: 73 RLSSVVYATREDCQKILRALSEVSKLF 99 R S Y T+E+ L++L + F Sbjct: 123 RASLYFYNTKEEIDLFLQSLQATIRFF 149 >3f0h_A Aminotransferase; RER070207000802, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE LLP; 1.70A {Eubacterium rectale} (A:1-28,A:275-376) Length = 130 Score = 23.7 bits (51), Expect = 9.8 Identities = 5/24 (20%), Positives = 11/24 (45%) Query: 72 MRLSSVVYATREDCQKILRALSEV 95 R+ + T ED ++ A ++ Sbjct: 101 FRVGHIGALTHEDNTTLVNAFKDL 124 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.323 0.135 0.398 Gapped Lambda K H 0.267 0.0567 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 724,503 Number of extensions: 27749 Number of successful extensions: 97 Number of sequences better than 10.0: 1 Number of HSP's gapped: 97 Number of HSP's successfully gapped: 15 Length of query: 99 Length of database: 4,956,049 Length adjustment: 58 Effective length of query: 41 Effective length of database: 2,995,359 Effective search space: 122809719 Effective search space used: 122809719 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.4 bits)